F434877

General Info

Members Datasets Scaffolds Average Seq Length
401 285 802 110

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10000018|Ga0307508_1000001811
Length 127
Sequence MSVLLTHMTDVVREGLNMKIPALPFTVTDWSQVAPTRHPGETGEALWRTLNIGDLRVRMVEYSPGYLADHWCDRGHVLLVIEGELDTELRDGRSFKLTPGMSYEVSDFGDAAHRSSTKLGAKLFIVD

Samples

Sample ID Description Type Environment
1 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
131 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
132 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
156 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
157 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
158 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
159 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
162 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
163 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
164 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
165 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
166 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
167 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
224 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
225 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
226 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
227 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
228 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
229 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
230 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
231 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
232 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
233 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
234 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
235 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
236 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
237 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
238 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
239 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
240 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
241 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
242 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
245 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
246 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
247 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
248 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
249 2547132374 Acidovorax radicis N35 Isolate Unclassified
250 2643221570 Acidovorax sp. Root568 Isolate Unclassified
251 2643221596 Acidovorax sp. Root70 Isolate Unclassified
252 2643221652 Acidovorax sp. Root402 Isolate Unclassified
253 2643221717 Acidovorax sp. Root267 Isolate Unclassified
254 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
255 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
256 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
257 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
258 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
259 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
260 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
261 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
262 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
263 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
264 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
265 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
266 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
267 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
268 2904699407
269 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
270 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
271 2922425934
272 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
273 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
274 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
275 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
276 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
277 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
278 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
279 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
280 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
281 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
282 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
283 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
284 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
285 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.97
Metatranscriptomes 0
Isolates 10.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.23
Nodule 6.48
Rhizoplane 7.48
Rhizosphere 66.33
Stem 0
Stem Tuber 0
Unclassified 4.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307508_10000018 3300031616 Bacteria 202701
2 JGI24735J21928_10096896 3300002067 Bacteria 846
3 JGI25162J39368_1000768 3300002737 Bacteria 21685
4 JGI25165J46597_1000866 3300003214 Bacteria 21685
5 JGI25153J46596_10003653 3300003215 Bacteria 8519
6 Ga0065715_10356116 3300005293 Bacteria 943
7 Ga0070658_10450865 3300005327 Bacteria 1108
8 Ga0070676_10398935 3300005328 Bacteria 956
9 Ga0070670_100419516 3300005331 Bacteria 1183
10 Ga0068869_100227790 3300005334 Bacteria 1480
11 Ga0070680_100992684 3300005336 Unclassified 725
12 Ga0068868_100018639 3300005338 Bacteria 5193
13 Ga0068868_101372091 3300005338 Bacteria 658
14 Ga0070661_100324759 3300005344 Bacteria 1202
15 Ga0070661_100435100 3300005344 Bacteria 1042
16 Ga0070668_100189606 3300005347 Bacteria 1683
17 Ga0070668_100366008 3300005347 Bacteria 1224
18 Ga0070668_101469589 3300005347 Bacteria 623
19 Ga0070674_101975793 3300005356 Bacteria 531
20 Ga0070688_100414035 3300005365 Bacteria 1000
21 Ga0070688_100665670 3300005365 Bacteria 803
22 Ga0070667_100077285 3300005367 Bacteria 2842
23 Ga0070709_10015475 3300005434 Bacteria 4341
24 Ga0070709_10342988 3300005434 Bacteria 1102
25 Ga0070709_11197110 3300005434 Bacteria 610
26 Ga0070714_101089825 3300005435 Bacteria 778
27 Ga0070714_101317158 3300005435 Bacteria 705
28 Ga0070713_100030094 3300005436 Bacteria 4308
29 Ga0070713_100381392 3300005436 Bacteria 1313
30 Ga0070713_100763900 3300005436 Bacteria 925
31 Ga0070710_10003702 3300005437 Bacteria 7230
32 Ga0070710_10581634 3300005437 Bacteria 777
33 Ga0070711_100010613 3300005439 Bacteria 5706
34 Ga0070711_100945944 3300005439 Bacteria 737
35 Ga0070711_101346741 3300005439 Unclassified 620
36 Ga0070708_100552831 3300005445 Bacteria 1086
37 Ga0070663_100165450 3300005455 Bacteria 1705
38 Ga0070663_100244630 3300005455 Bacteria 1417
39 Ga0070678_100416397 3300005456 Bacteria 1170
40 Ga0070678_100750860 3300005456 Bacteria 882
41 Ga0070662_100947844 3300005457 Bacteria 736
42 Ga0070685_10006713 3300005466 Bacteria 5874
43 Ga0070699_100542781 3300005518 Bacteria 1058
44 Ga0068853_100041183 3300005539 Bacteria 3944
45 Ga0068853_100883889 3300005539 Bacteria 858
46 Ga0070672_100828239 3300005543 Bacteria 815
47 Ga0070686_100500241 3300005544 Bacteria 943
48 Ga0070665_100147673 3300005548 Bacteria 2354
49 Ga0070665_100353762 3300005548 Bacteria 1474
50 Ga0070665_100774469 3300005548 Bacteria 972
51 Ga0070665_101603393 3300005548 Bacteria 659
52 Ga0070704_100717104 3300005549 Bacteria 888
53 Ga0070704_101061899 3300005549 Unclassified 734
54 Ga0070664_100137574 3300005564 Bacteria 2149
55 Ga0068852_100423289 3300005616 Bacteria 1314
56 Ga0068859_100294042 3300005617 Bacteria 1717
57 Ga0068859_102408742 3300005617 Bacteria 580
58 Ga0068864_100512800 3300005618 Bacteria 1155
59 Ga0068861_100102950 3300005719 Bacteria 2274
60 Ga0068863_100013236 3300005841 Bacteria 7957
61 Ga0068863_100308453 3300005841 Bacteria 1536
62 Ga0068858_100217278 3300005842 Bacteria 1810
63 Ga0068858_100369411 3300005842 Bacteria 1375
64 Ga0068858_101635858 3300005842 Bacteria 636
65 Ga0068858_101904568 3300005842 Bacteria 587
66 Ga0068860_100001708 3300005843 Bacteria 23464
67 Ga0068862_100084709 3300005844 Bacteria 2754
68 Ga0081540_1003015 3300005983 Bacteria 13484
69 Ga0081540_1309876 3300005983 Unclassified 542
70 Ga0070717_10050191 3300006028 Bacteria 3427
71 Ga0075363_100298911 3300006048 Bacteria 934
72 Ga0070715_10248261 3300006163 Bacteria 929
73 Ga0070716_100017312 3300006173 Bacteria 3733
74 Ga0070716_100564178 3300006173 Bacteria 851
75 Ga0070712_100063171 3300006175 Bacteria 2621
76 Ga0070712_100161831 3300006175 Bacteria 1729
77 Ga0075362_10064688 3300006177 Bacteria 1660
78 Ga0075362_10144331 3300006177 Bacteria 1139
79 Ga0097621_100016261 3300006237 Bacteria 5619
80 Ga0097621_100185369 3300006237 Bacteria 1800
81 Ga0097621_100885705 3300006237 Bacteria 831
82 Ga0068871_100081780 3300006358 Bacteria 2677
83 Ga0068871_100522447 3300006358 Bacteria 1072
84 Ga0075428_101360940 3300006844 Bacteria 746
85 Ga0068865_101970010 3300006881 Bacteria 530
86 Ga0097620_100162997 3300006931 Unclassified 2309
87 Ga0097620_100294055 3300006931 Bacteria 1717
88 Ga0097620_102407340 3300006931 Bacteria 580
89 Ga0075435_100205689 3300007076 Bacteria 1668
90 Ga0111539_11456558 3300009094 Bacteria 794
91 Ga0105245_10117808 3300009098 Bacteria 2477
92 Ga0105245_11170872 3300009098 Bacteria 816
93 Ga0105245_12148330 3300009098 Bacteria 612
94 Ga0105247_10383921 3300009101 Bacteria 997
95 Ga0105247_11837669 3300009101 Bacteria 505
96 Ga0105241_10441934 3300009174 Bacteria 1149
97 Ga0105248_10410876 3300009177 Bacteria 1524
98 Ga0105248_11347328 3300009177 Unclassified 807
99 Ga0105237_10287554 3300009545 Bacteria 1647
100 Ga0105237_10509983 3300009545 Bacteria 1209
101 Ga0105237_11152000 3300009545 Bacteria 782
102 Ga0105238_10492469 3300009551 Bacteria 1226
103 Ga0105249_10109697 3300009553 Bacteria 2607
104 Ga0105249_10211314 3300009553 Bacteria 1904
105 Ga0105239_10680296 3300010375 Bacteria 1176
106 Ga0105239_10974960 3300010375 Bacteria 974
107 Ga0105239_12658765 3300010375 Bacteria 584
108 Ga0105246_10023862 3300011119 Bacteria 3964
109 Ga0157373_10543224 3300013100 Bacteria 842
110 Ga0157374_10294635 3300013296 Bacteria 1604
111 Ga0157374_10408948 3300013296 Bacteria 1354
112 Ga0157374_10411567 3300013296 Bacteria 1350
113 Ga0157378_10839753 3300013297 Bacteria 946
114 Ga0163162_10180545 3300013306 Bacteria 2237
115 Ga0163162_10408818 3300013306 Bacteria 1490
116 Ga0157372_10680342 3300013307 Bacteria 1198
117 Ga0157375_10021748 3300013308 Bacteria 5889
118 Ga0157375_10152378 3300013308 Bacteria 2448
119 Ga0157375_11433528 3300013308 Unclassified 814
120 Ga0157375_12065755 3300013308 Bacteria 678
121 Ga0163163_10015288 3300014325 Bacteria 7092
122 Ga0163163_10164154 3300014325 Bacteria 2267
123 Ga0182008_10052440 3300014497 Bacteria 2022
124 Ga0157377_10128330 3300014745 Bacteria 1545
125 Ga0157379_10366470 3300014968 Bacteria 1321
126 Ga0157379_10437192 3300014968 Bacteria 1206
127 Ga0157376_10005599 3300014969 Bacteria 8786
128 Ga0163161_10427912 3300017792 Bacteria 1066
129 Ga0213876_10011401 3300021384 Bacteria 4746
130 Ga0209672_113943 3300025228 Bacteria 946
131 Ga0209437_100326 3300025233 Bacteria 60536
132 Ga0209646_1010812 3300025246 Bacteria 1422
133 Ga0209026_1031106 3300025250 Bacteria 791
134 Ga0209233_1000505 3300025261 Bacteria 23256
135 Ga0209758_1008964 3300025297 Bacteria 6338
136 Ga0209758_1013766 3300025297 Bacteria 4376
137 Ga0207697_10155236 3300025315 Bacteria 997
138 Ga0207697_10449713 3300025315 Bacteria 571
139 Ga0207692_10085385 3300025898 Bacteria 1698
140 Ga0207642_10945111 3300025899 Bacteria 554
141 Ga0207710_10284797 3300025900 Bacteria 832
142 Ga0207710_10310792 3300025900 Bacteria 798
143 Ga0207688_10338691 3300025901 Bacteria 925
144 Ga0207699_10074221 3300025906 Bacteria 2089
145 Ga0207699_10298273 3300025906 Bacteria 1125
146 Ga0207643_10242574 3300025908 Bacteria 1108
147 Ga0207643_10417497 3300025908 Bacteria 850
148 Ga0207705_10523638 3300025909 Bacteria 921
149 Ga0207654_10355534 3300025911 Bacteria 1009
150 Ga0207654_11318950 3300025911 Bacteria 526
151 Ga0207671_10113085 3300025914 Bacteria 2068
152 Ga0207671_10268041 3300025914 Bacteria 1345
153 Ga0207671_10298484 3300025914 Bacteria 1272
154 Ga0207693_10135963 3300025915 Bacteria 1933
155 Ga0207663_10106019 3300025916 Bacteria 1898
156 Ga0207649_10236261 3300025920 Bacteria 1310
157 Ga0207649_10311878 3300025920 Bacteria 1153
158 Ga0207649_10354610 3300025920 Bacteria 1087
159 Ga0207649_11692100 3300025920 Bacteria 501
160 Ga0207646_10313740 3300025922 Bacteria 1417
161 Ga0207694_10273206 3300025924 Bacteria 1387
162 Ga0207694_10501938 3300025924 Bacteria 1016
163 Ga0207687_10147772 3300025927 Bacteria 1790
164 Ga0207700_10035247 3300025928 Bacteria 3603
165 Ga0207700_10296570 3300025928 Bacteria 1395
166 Ga0207700_10982747 3300025928 Unclassified 755
167 Ga0207690_10856090 3300025932 Unclassified 753
168 Ga0207706_10482835 3300025933 Bacteria 1071
169 Ga0207709_10695114 3300025935 Bacteria 813
170 Ga0207665_10431625 3300025939 Bacteria 1008
171 Ga0207665_10526520 3300025939 Bacteria 916
172 Ga0207691_10268222 3300025940 Unclassified 1470
173 Ga0207691_10874171 3300025940 Bacteria 753
174 Ga0207711_11205546 3300025941 Bacteria 698
175 Ga0207711_11401073 3300025941 Bacteria 641
176 Ga0207689_11082930 3300025942 Bacteria 676
177 Ga0207661_10833540 3300025944 Bacteria 849
178 Ga0207661_11632626 3300025944 Bacteria 590
179 Ga0207679_10027676 3300025945 Bacteria 3924
180 Ga0207712_10040854 3300025961 Bacteria 3186
181 Ga0207712_10199720 3300025961 Bacteria 1585
182 Ga0207668_10233377 3300025972 Bacteria 1484
183 Ga0207668_10291764 3300025972 Bacteria 1342
184 Ga0207658_10292708 3300025986 Bacteria 1400
185 Ga0207658_10736678 3300025986 Bacteria 892
186 Ga0207677_10119775 3300026023 Bacteria 1977
187 Ga0207703_10022563 3300026035 Bacteria 4938
188 Ga0207703_10191608 3300026035 Bacteria 1811
189 Ga0207703_10401673 3300026035 Bacteria 1271
190 Ga0207703_10900633 3300026035 Bacteria 847
191 Ga0207639_10087913 3300026041 Bacteria 2478
192 Ga0207639_10413735 3300026041 Bacteria 1217
193 Ga0207639_10415726 3300026041 Bacteria 1215
194 Ga0207678_10178552 3300026067 Bacteria 1813
195 Ga0207678_10298127 3300026067 Bacteria 1385
196 Ga0207708_10304786 3300026075 Bacteria 1296
197 Ga0207702_10000040 3300026078 Bacteria 151483
198 Ga0207641_10009889 3300026088 Bacteria 7853
199 Ga0207641_10731777 3300026088 Bacteria 976
200 Ga0207648_10689666 3300026089 Bacteria 946
201 Ga0207676_10327063 3300026095 Bacteria 1409
202 Ga0207676_10611812 3300026095 Bacteria 1048
203 Ga0207676_10749266 3300026095 Bacteria 950
204 Ga0207675_100078234 3300026118 Bacteria 3099
205 Ga0207675_100610963 3300026118 Bacteria 1094
206 Ga0207683_10436189 3300026121 Bacteria 1207
207 Ga0207683_10462291 3300026121 Bacteria 1170
208 Ga0207698_11940993 3300026142 Bacteria 603
209 Ga0209974_10011596 3300027876 Bacteria 2958
210 Ga0268266_10261005 3300028379 Bacteria 1605
211 Ga0268266_10376584 3300028379 Bacteria 1338
212 Ga0268265_10178960 3300028380 Bacteria 1820
213 Ga0268264_10000149 3300028381 Bacteria 163972
214 Ga0307517_10654946 3300028786 Bacteria 510
215 Ga0307511_10125907 3300030521 Bacteria 1563
216 Ga0265330_10295764 3300031235 Bacteria 682
217 Ga0265332_10313522 3300031238 Bacteria 648
218 Ga0265327_10042311 3300031251 Bacteria 2446
219 Ga0307509_10004311 3300031507 Bacteria 20669
220 Ga0307509_10074087 3300031507 Bacteria 3543
221 Ga0307509_10432074 3300031507 Unclassified 1015
222 Ga0307408_100269458 3300031548 Bacteria 1413
223 Ga0307508_10109943 3300031616 Bacteria 2355
224 Ga0265314_10335455 3300031711 Bacteria 837
225 Ga0307516_10151220 3300031730 Bacteria 2081
226 Ga0307516_10590103 3300031730 Bacteria 765
227 Ga0307516_10623843 3300031730 Unclassified 733
228 Ga0307410_11124945 3300031852 Unclassified 682
229 Ga0307412_10165818 3300031911 Bacteria 1647
230 Ga0307411_10076282 3300032005 Bacteria 2291
231 Ga0307507_10022838 3300033179 Bacteria 6892
232 Ga0307510_10059620 3300033180 Bacteria 3938
233 Ga0373940_0341583 3300035088 Bacteria 524
234 Ga0373943_0194994 3300035170 Bacteria 1119
235 Ga0373935_0062064 3300035692 Bacteria 2393
236 Ga0373927_0003237 3300035695 Bacteria 11718
237 Ga0373927_0947582 3300035695 Unclassified 568
238 Ga0373947_0202522 3300035725 Bacteria 1299
239 Ga0373937_0109298 3300036401 Bacteria 2571
240 Ga0373925_0021188 3300037068 Bacteria 4736
241 Ga0373925_0075820 3300037068 Bacteria 2549
242 Ga0373925_1511436 3300037068 Unclassified 549
243 Ga0395900_0149691 3300037418 Bacteria 2385
244 Ga0436364_1553594 3300037853 Unclassified 1081
245 Ga0436365_0059329 3300039437 Bacteria 12786
246 Ga0436363_0068060 3300039450 Bacteria 672
247 Ga0436363_0912950 3300039450 Bacteria 9571
248 Ga0439439_0131743 3300041406 Bacteria 702
249 Ga0439466_0118629 3300041411 Bacteria 818
250 Ga0451789_1031529 3300041443 Bacteria 756
251 Ga0451804_0833197 3300041463 Bacteria 1242
252 Ga0451833_0108840 3300041491 Bacteria 625
253 Ga0451853_0300582 3300041512 Bacteria 2124
254 Ga0439433_0015213 3300041999 Bacteria 1698
255 Ga0439437_028854 3300042000 Bacteria 692
256 Ga0439449_0005619 3300042007 Bacteria 4795
257 Ga0439462_0000745 3300042015 Bacteria 6738
258 Ga0439462_0044978 3300042015 Bacteria 1182
259 Ga0450914_008141 3300042118 Bacteria 963
260 Ga0450923_038294 3300042125 Bacteria 1000
261 Ga0439446_0204643 3300042156 Bacteria 667
262 Ga0466966_0000068 3300044684 Bacteria 68468
263 Ga0466961_0018916 3300044693 Bacteria 4432
264 Ga0495617_013796 3300046452 Bacteria 2748
265 Ga0495629_0263787 3300046459 Bacteria 1184
266 Ga0495638_0041985 3300046460 Bacteria 2890
267 Ga0495650_0283391 3300046471 Bacteria 557
268 Ga0495605_0032069 3300046474 Bacteria 2679
269 Ga0495639_0720979 3300046475 Unclassified 515
270 Ga0495585_0289014 3300046492 Bacteria 808
271 Ga0495594_0323226 3300046499 Bacteria 879
272 Ga0495596_0139092 3300046500 Bacteria 943
273 Ga0495606_0228644 3300046507 Bacteria 1044
274 Ga0495608_0427122 3300046511 Bacteria 808
275 Ga0495610_0380300 3300046512 Bacteria 525
276 Ga0495616_0073607 3300046513 Bacteria 1648
277 Ga0495616_0106505 3300046513 Bacteria 1308
278 Ga0495631_0050690 3300046518 Bacteria 1815
279 Ga0495643_0294641 3300046522 Bacteria 742
280 Ga0495648_0430502 3300046524 Bacteria 582
281 Ga0495665_0068196 3300046531 Bacteria 1876
282 Ga0495597_0197951 3300046542 Bacteria 806
283 Ga0495597_0293917 3300046542 Bacteria 631
284 Ga0495622_0019370 3300046557 Bacteria 3168
285 Ga0495622_0055686 3300046557 Bacteria 1834
286 Ga0495633_0036716 3300046558 Bacteria 2347
287 Ga0495668_0035929 3300046616 Bacteria 2777
288 Ga0495625_0511015 3300046660 Bacteria 733
289 Ga0495669_0078457 3300046684 Bacteria 1513
290 Ga0495669_0146692 3300046684 Bacteria 1116
291 Ga0495649_0393427 3300046694 Bacteria 696
292 Ga0495581_0092361 3300047315 Bacteria 1757
293 Ga0495636_0576433 3300047318 Bacteria 549
294 Ga0495672_0220882 3300047320 Bacteria 935
295 Ga0495684_0464515 3300047471 Bacteria 877
296 Ga0496100_0037385 3300048903 Bacteria 3069
297 Ga0496100_0275084 3300048903 Bacteria 1253
298 Ga0496101_0101587 3300048904 Bacteria 2153
299 Ga0496101_0841752 3300048904 Bacteria 723
300 Ga0496102_0006904 3300048905 Bacteria 9684
301 Ga0496102_0135995 3300048905 Bacteria 2303
302 Ga0496103_0072235 3300048906 Bacteria 2161
303 Ga0496103_0187515 3300048906 Bacteria 1330
304 Ga0496103_0575719 3300048906 Bacteria 718
305 Ga0496103_0875080 3300048906 Bacteria 564
306 Ga0496104_0971487 3300048907 Bacteria 754
307 Ga0496104_1024226 3300048907 Bacteria 729
308 Ga0496105_0035275 3300048908 Bacteria 4116
309 Ga0496106_0004983 3300048909 Bacteria 9830
310 Ga0496106_0012623 3300048909 Bacteria 6241
311 Ga0496106_0089116 3300048909 Bacteria 2379
312 Ga0496106_0758919 3300048909 Unclassified 771
313 Ga0496107_0037062 3300048910 Bacteria 3499
314 Ga0496107_0554680 3300048910 Bacteria 851
315 Ga0496108_0141407 3300048911 Bacteria 2073
316 Ga0496111_0127600 3300048914 Bacteria 1881
317 Ga0496111_0284625 3300048914 Bacteria 1226
318 Ga0496112_0058807 3300048915 Bacteria 3786
319 Ga0496113_0060292 3300048916 Bacteria 2860
320 Ga0496114_0127558 3300048917 Bacteria 2194
321 Ga0496114_1476290 3300048917 Bacteria 568
322 Ga0496115_0101304 3300048918 Bacteria 2361
323 Ga0496117_0060994 3300048920 Bacteria 2595
324 Ga0496118_0022727 3300048921 Bacteria 5470
325 Ga0496118_0312325 3300048921 Bacteria 857
326 Ga0496121_0001749 3300048924 Bacteria 35439
327 Ga0496121_0083873 3300048924 Bacteria 2514
328 Ga0496124_0010603 3300048927 Bacteria 9314
329 Ga0496125_0183091 3300048928 Bacteria 1393
330 Ga0496126_0057989 3300048929 Bacteria 3492
331 Ga0496126_0218959 3300048929 Bacteria 1600
332 Ga0496126_0452802 3300048929 Bacteria 1033
333 Ga0501070_0228674 3300049586 Bacteria 1524
334 nmdc:mga03683_534375_c1 3300050489 Bacteria 570
335 nmdc:mga03n38_659751_c1 3300050490 Bacteria 600
336 nmdc:mga0yw44_53700_c1 3300050492 Bacteria 2447
337 nmdc:mga06r32_1779477_c1 3300050510 Bacteria 552
338 Ga0495655_0052855 3300053083 Bacteria 1082
339 Ga0500644_0202925 3300053088 Bacteria 821
340 Ga0500646_0106073 3300053090 Bacteria 888
341 Ga0500647_0124431 3300053091 Bacteria 1219
342 Ga0500641_0001604 3300053096 Bacteria 8055
343 Ga0500648_372650 3300053097 Bacteria 564
344 Ga0500558_117782 3300053106 Bacteria 1033
345 Ga0500595_125953 3300053119 Bacteria 723
346 Ga0500658_0168228 3300053134 Bacteria 995
347 Ga0500559_0016966 3300053136 Bacteria 3076
348 Ga0500577_0043575 3300053142 Bacteria 1649
349 Ga0500590_067892 3300053148 Bacteria 1778
350 Ga0500603_043625 3300053150 Bacteria 1205
351 Ga0500603_105981 3300053150 Bacteria 840
352 Ga0500627_0180765 3300053158 Bacteria 949
353 Ga0500633_0182921 3300053160 Bacteria 786
354 Ga0500634_0401539 3300053161 Bacteria 506
355 Ga0500636_0018765 3300053177 Bacteria 4090
356 Ga0500552_089177 3300053733 Bacteria 575
357 Ga0500596_005269 3300053735 Bacteria 2296
358 Ga0590074_050217 3300059423 Bacteria 762
359 Ga0590075_059695 3300059424 Bacteria 983
360 2513640671 2513237094 Bacteria 8789602
361 2513645614 2513237095 Bacteria 8976980
362 2517102837 2517093001 Bacteria 9002274
363 2524534266 2524023228 Bacteria 10118060
364 2528853870 2528768022 Bacteria 10457665
365 2548501279 2547132374 Bacteria 5530232
366 2643868481 2643221570 Bacteria 5103772
367 2643994589 2643221596 Bacteria 5006805
368 2644295433 2643221652 Bacteria 5140275
369 2644649177 2643221717 Bacteria 5676132
370 2671117308 2667528174 Bacteria 6435400
371 2728753146 2728368998 Bacteria 8720350
372 2745079654 2744054633 Bacteria 8678936
373 2818238660 2816332527 Bacteria 8933356
374 2824708600 2824704595 Bacteria 9667483
375 2824759519 2824753945 Bacteria 9787441
376 2824771730 2824763712 Bacteria 9792355
377 2841964206 2841957949 Bacteria 8652217
378 2842038755 2842038055 Bacteria 8002051
379 2842048300 2842045827 Bacteria 8006841
380 2876764753 2876761206 Bacteria 10111113
381 2888384292 2888378607 Bacteria 9652610
382 2888393594 2888388044 Bacteria 7304136
383 2904694759 2904690495 Bacteria 9412302
384 2904702309
385 2904714903 2904711408 Bacteria 9771557
386 2906645149 2906643746 Bacteria 8722424
387 2922430531
388 2929621743 2929615660 Bacteria 9193770
389 2929629950 2929624759 Bacteria 9339455
390 2932798133 2932794094 Bacteria 7915132
391 2932807011 2932801729 Bacteria 7987968
392 2933583981 2933577622 Bacteria 9116884
393 2935886865 2935883170 Bacteria 7964738
394 2935960634 2935959822 Bacteria 7869783
395 2941533031 2941531003 Bacteria 7653939
396 3005599457 3005594810 Bacteria 8716512
397 3005722517 3005718088 Bacteria 8283608
398 8016626347 8016622563 Bacteria 7999408
399 8019553436 8019547302 Bacteria 7996444
400 8055746091 8055742211 Bacteria 9226248
401 8056691294 8056689827 Bacteria 6712655
402 Ga0307508_10000018
403 JGI24735J21928_10096896
404 JGI25162J39368_1000768
405 JGI25165J46597_1000866
406 JGI25153J46596_10003653
407 Ga0065715_10356116
408 Ga0070658_10450865
409 Ga0070676_10398935
410 Ga0070670_100419516
411 Ga0068869_100227790
412 Ga0070680_100992684
413 Ga0068868_100018639
414 Ga0068868_101372091
415 Ga0070661_100324759
416 Ga0070661_100435100
417 Ga0070668_100189606
418 Ga0070668_100366008
419 Ga0070668_101469589
420 Ga0070674_101975793
421 Ga0070688_100414035
422 Ga0070688_100665670
423 Ga0070667_100077285
424 Ga0070709_10015475
425 Ga0070709_10342988
426 Ga0070709_11197110
427 Ga0070714_101089825
428 Ga0070714_101317158
429 Ga0070713_100030094
430 Ga0070713_100381392
431 Ga0070713_100763900
432 Ga0070710_10003702
433 Ga0070710_10581634
434 Ga0070711_100010613
435 Ga0070711_100945944
436 Ga0070711_101346741
437 Ga0070708_100552831
438 Ga0070663_100165450
439 Ga0070663_100244630
440 Ga0070678_100416397
441 Ga0070678_100750860
442 Ga0070662_100947844
443 Ga0070685_10006713
444 Ga0070699_100542781
445 Ga0068853_100041183
446 Ga0068853_100883889
447 Ga0070672_100828239
448 Ga0070686_100500241
449 Ga0070665_100147673
450 Ga0070665_100353762
451 Ga0070665_100774469
452 Ga0070665_101603393
453 Ga0070704_100717104
454 Ga0070704_101061899
455 Ga0070664_100137574
456 Ga0068852_100423289
457 Ga0068859_100294042
458 Ga0068859_102408742
459 Ga0068864_100512800
460 Ga0068861_100102950
461 Ga0068863_100013236
462 Ga0068863_100308453
463 Ga0068858_100217278
464 Ga0068858_100369411
465 Ga0068858_101635858
466 Ga0068858_101904568
467 Ga0068860_100001708
468 Ga0068862_100084709
469 Ga0081540_1003015
470 Ga0081540_1309876
471 Ga0070717_10050191
472 Ga0075363_100298911
473 Ga0070715_10248261
474 Ga0070716_100017312
475 Ga0070716_100564178
476 Ga0070712_100063171
477 Ga0070712_100161831
478 Ga0075362_10064688
479 Ga0075362_10144331
480 Ga0097621_100016261
481 Ga0097621_100185369
482 Ga0097621_100885705
483 Ga0068871_100081780
484 Ga0068871_100522447
485 Ga0075428_101360940
486 Ga0068865_101970010
487 Ga0097620_100162997
488 Ga0097620_100294055
489 Ga0097620_102407340
490 Ga0075435_100205689
491 Ga0111539_11456558
492 Ga0105245_10117808
493 Ga0105245_11170872
494 Ga0105245_12148330
495 Ga0105247_10383921
496 Ga0105247_11837669
497 Ga0105241_10441934
498 Ga0105248_10410876
499 Ga0105248_11347328
500 Ga0105237_10287554
501 Ga0105237_10509983
502 Ga0105237_11152000
503 Ga0105238_10492469
504 Ga0105249_10109697
505 Ga0105249_10211314
506 Ga0105239_10680296
507 Ga0105239_10974960
508 Ga0105239_12658765
509 Ga0105246_10023862
510 Ga0157373_10543224
511 Ga0157374_10294635
512 Ga0157374_10408948
513 Ga0157374_10411567
514 Ga0157378_10839753
515 Ga0163162_10180545
516 Ga0163162_10408818
517 Ga0157372_10680342
518 Ga0157375_10021748
519 Ga0157375_10152378
520 Ga0157375_11433528
521 Ga0157375_12065755
522 Ga0163163_10015288
523 Ga0163163_10164154
524 Ga0182008_10052440
525 Ga0157377_10128330
526 Ga0157379_10366470
527 Ga0157379_10437192
528 Ga0157376_10005599
529 Ga0163161_10427912
530 Ga0213876_10011401
531 Ga0209672_113943
532 Ga0209437_100326
533 Ga0209646_1010812
534 Ga0209026_1031106
535 Ga0209233_1000505
536 Ga0209758_1008964
537 Ga0209758_1013766
538 Ga0207697_10155236
539 Ga0207697_10449713
540 Ga0207692_10085385
541 Ga0207642_10945111
542 Ga0207710_10284797
543 Ga0207710_10310792
544 Ga0207688_10338691
545 Ga0207699_10074221
546 Ga0207699_10298273
547 Ga0207643_10242574
548 Ga0207643_10417497
549 Ga0207705_10523638
550 Ga0207654_10355534
551 Ga0207654_11318950
552 Ga0207671_10113085
553 Ga0207671_10268041
554 Ga0207671_10298484
555 Ga0207693_10135963
556 Ga0207663_10106019
557 Ga0207649_10236261
558 Ga0207649_10311878
559 Ga0207649_10354610
560 Ga0207649_11692100
561 Ga0207646_10313740
562 Ga0207694_10273206
563 Ga0207694_10501938
564 Ga0207687_10147772
565 Ga0207700_10035247
566 Ga0207700_10296570
567 Ga0207700_10982747
568 Ga0207690_10856090
569 Ga0207706_10482835
570 Ga0207709_10695114
571 Ga0207665_10431625
572 Ga0207665_10526520
573 Ga0207691_10268222
574 Ga0207691_10874171
575 Ga0207711_11205546
576 Ga0207711_11401073
577 Ga0207689_11082930
578 Ga0207661_10833540
579 Ga0207661_11632626
580 Ga0207679_10027676
581 Ga0207712_10040854
582 Ga0207712_10199720
583 Ga0207668_10233377
584 Ga0207668_10291764
585 Ga0207658_10292708
586 Ga0207658_10736678
587 Ga0207677_10119775
588 Ga0207703_10022563
589 Ga0207703_10191608
590 Ga0207703_10401673
591 Ga0207703_10900633
592 Ga0207639_10087913
593 Ga0207639_10413735
594 Ga0207639_10415726
595 Ga0207678_10178552
596 Ga0207678_10298127
597 Ga0207708_10304786
598 Ga0207702_10000040
599 Ga0207641_10009889
600 Ga0207641_10731777
601 Ga0207648_10689666
602 Ga0207676_10327063
603 Ga0207676_10611812
604 Ga0207676_10749266
605 Ga0207675_100078234
606 Ga0207675_100610963
607 Ga0207683_10436189
608 Ga0207683_10462291
609 Ga0207698_11940993
610 Ga0209974_10011596
611 Ga0268266_10261005
612 Ga0268266_10376584
613 Ga0268265_10178960
614 Ga0268264_10000149
615 Ga0307517_10654946
616 Ga0307511_10125907
617 Ga0265330_10295764
618 Ga0265332_10313522
619 Ga0265327_10042311
620 Ga0307509_10004311
621 Ga0307509_10074087
622 Ga0307509_10432074
623 Ga0307408_100269458
624 Ga0307508_10109943
625 Ga0265314_10335455
626 Ga0307516_10151220
627 Ga0307516_10590103
628 Ga0307516_10623843
629 Ga0307410_11124945
630 Ga0307412_10165818
631 Ga0307411_10076282
632 Ga0307507_10022838
633 Ga0307510_10059620
634 Ga0373940_0341583
635 Ga0373943_0194994
636 Ga0373935_0062064
637 Ga0373927_0003237
638 Ga0373927_0947582
639 Ga0373947_0202522
640 Ga0373937_0109298
641 Ga0373925_0021188
642 Ga0373925_0075820
643 Ga0373925_1511436
644 Ga0395900_0149691
645 Ga0436364_1553594
646 Ga0436365_0059329
647 Ga0436363_0068060
648 Ga0436363_0912950
649 Ga0439439_0131743
650 Ga0439466_0118629
651 Ga0451789_1031529
652 Ga0451804_0833197
653 Ga0451833_0108840
654 Ga0451853_0300582
655 Ga0439433_0015213
656 Ga0439437_028854
657 Ga0439449_0005619
658 Ga0439462_0000745
659 Ga0439462_0044978
660 Ga0450914_008141
661 Ga0450923_038294
662 Ga0439446_0204643
663 Ga0466966_0000068
664 Ga0466961_0018916
665 Ga0495617_013796
666 Ga0495629_0263787
667 Ga0495638_0041985
668 Ga0495650_0283391
669 Ga0495605_0032069
670 Ga0495639_0720979
671 Ga0495585_0289014
672 Ga0495594_0323226
673 Ga0495596_0139092
674 Ga0495606_0228644
675 Ga0495608_0427122
676 Ga0495610_0380300
677 Ga0495616_0073607
678 Ga0495616_0106505
679 Ga0495631_0050690
680 Ga0495643_0294641
681 Ga0495648_0430502
682 Ga0495665_0068196
683 Ga0495597_0197951
684 Ga0495597_0293917
685 Ga0495622_0019370
686 Ga0495622_0055686
687 Ga0495633_0036716
688 Ga0495668_0035929
689 Ga0495625_0511015
690 Ga0495669_0078457
691 Ga0495669_0146692
692 Ga0495649_0393427
693 Ga0495581_0092361
694 Ga0495636_0576433
695 Ga0495672_0220882
696 Ga0495684_0464515
697 Ga0496100_0037385
698 Ga0496100_0275084
699 Ga0496101_0101587
700 Ga0496101_0841752
701 Ga0496102_0006904
702 Ga0496102_0135995
703 Ga0496103_0072235
704 Ga0496103_0187515
705 Ga0496103_0575719
706 Ga0496103_0875080
707 Ga0496104_0971487
708 Ga0496104_1024226
709 Ga0496105_0035275
710 Ga0496106_0004983
711 Ga0496106_0012623
712 Ga0496106_0089116
713 Ga0496106_0758919
714 Ga0496107_0037062
715 Ga0496107_0554680
716 Ga0496108_0141407
717 Ga0496111_0127600
718 Ga0496111_0284625
719 Ga0496112_0058807
720 Ga0496113_0060292
721 Ga0496114_0127558
722 Ga0496114_1476290
723 Ga0496115_0101304
724 Ga0496117_0060994
725 Ga0496118_0022727
726 Ga0496118_0312325
727 Ga0496121_0001749
728 Ga0496121_0083873
729 Ga0496124_0010603
730 Ga0496125_0183091
731 Ga0496126_0057989
732 Ga0496126_0218959
733 Ga0496126_0452802
734 Ga0501070_0228674
735 nmdc:mga03683_534375_c1
736 nmdc:mga03n38_659751_c1
737 nmdc:mga0yw44_53700_c1
738 nmdc:mga06r32_1779477_c1
739 Ga0495655_0052855
740 Ga0500644_0202925
741 Ga0500646_0106073
742 Ga0500647_0124431
743 Ga0500641_0001604
744 Ga0500648_372650
745 Ga0500558_117782
746 Ga0500595_125953
747 Ga0500658_0168228
748 Ga0500559_0016966
749 Ga0500577_0043575
750 Ga0500590_067892
751 Ga0500603_043625
752 Ga0500603_105981
753 Ga0500627_0180765
754 Ga0500633_0182921
755 Ga0500634_0401539
756 Ga0500636_0018765
757 Ga0500552_089177
758 Ga0500596_005269
759 Ga0590074_050217
760 Ga0590075_059695
761 2513640671
762 2513645614
763 2517102837
764 2524534266
765 2528853870
766 2548501279
767 2643868481
768 2643994589
769 2644295433
770 2644649177
771 2671117308
772 2728753146
773 2745079654
774 2818238660
775 2824708600
776 2824759519
777 2824771730
778 2841964206
779 2842038755
780 2842048300
781 2876764753
782 2888384292
783 2888393594
784 2904694759
785 2904702309
786 2904714903
787 2906645149
788 2922430531
789 2929621743
790 2929629950
791 2932798133
792 2932807011
793 2933583981
794 2935886865
795 2935960634
796 2941533031
797 3005599457
798 3005722517
799 8016626347
800 8019553436
801 8055746091
802 8056691294

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fag-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate 0.8736 38 109
4fbf-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant 0.8691 38 109
4xfg-assembly1.cif.gz_A cysteine dioxygenase variant - c93a at ph 6.2 with cysteine 0.8676 36 109
4xfh-assembly1.cif.gz_A cysteine dioxygenase variant - y157f at ph 6.2 with cysteine 0.8672 36 109
3eln-assembly1.cif.gz_A a putative fe2+-bound persulfenate intermediate in cysteine dioxygenase 0.8636 36 109
ID Description Score Start End Superfamily
3elnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8634 36 109 2.60.120.10
af_Q05212_199_307_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8482 39 109 2.60.120.10
5jspB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8405 28 109 2.60.120.10
1o5uB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8235 42 108 2.60.120.10
3es1A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8234 38 109 2.60.120.10
ID Description Score Start End GO Terms
AF-F4MYE7-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.9897 17 110
AF-A0A127Q2B0-F1-model_v4 Cupin domain protein 0.9884 6 110
AF-A0A645I2J9-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.982 28 110
AF-A0A1I0SAU6-F1-model_v4 DHCW motif cupin fold protein 0.9812 7 110
AF-A0A8B6KSK9-F1-model_v4 deleted 0.9809 44 110

Map