F434852
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 401 | 193 | 802 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10561507|Ga0157369_105615072 |
| Length | 151 |
| Sequence | MNQFDFVSTTDKPALLAFSTPEWLETARSALSELGYKVHTAATHGDFQIRYQVVIIEERFAANDITENLTLQVMQRMSMGQRRHSTVILIGDNFQTFTPMQAFQQSVHAVINSSELFLLKQLIEKTIADNELFLQTYKETQTRVLTAGRAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 48 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 49 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 91 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 92 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 93 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 94 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 95 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 96 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 97 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 98 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 99 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 100 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 101 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 102 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 103 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 104 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 105 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 106 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 107 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 109 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 110 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 111 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 112 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 113 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 114 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 115 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 116 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 118 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 119 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 120 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 121 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 122 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 123 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 124 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 126 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 127 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 128 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 129 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 130 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 131 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 132 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 134 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 136 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 137 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 138 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 139 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 140 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 141 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 177 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 178 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 179 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.25 |
| Nodule | 0 |
| Rhizoplane | 1.25 |
| Rhizosphere | 97.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 30.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157369_10561507 | 3300013105 | Unclassified | 1179 |
| 2 | rootH2_10054090 | 3300003320 | Bacteria | 5928 |
| 3 | Ga0070658_10056106 | 3300005327 | Bacteria | 3201 |
| 4 | Ga0070690_100007018 | 3300005330 | Bacteria | 6422 |
| 5 | Ga0068869_100278578 | 3300005334 | Unclassified | 1344 |
| 6 | Ga0070666_10028244 | 3300005335 | Bacteria | 3680 |
| 7 | Ga0068868_100096426 | 3300005338 | Unclassified | 2389 |
| 8 | Ga0070689_100017564 | 3300005340 | Bacteria | 5258 |
| 9 | Ga0070689_100144589 | 3300005340 | Bacteria | 1914 |
| 10 | Ga0070689_100345112 | 3300005340 | Bacteria | 1248 |
| 11 | Ga0070689_100466856 | 3300005340 | Unclassified | 1076 |
| 12 | Ga0070689_101084175 | 3300005340 | Bacteria | 715 |
| 13 | Ga0070691_10226693 | 3300005341 | Bacteria | 993 |
| 14 | Ga0070692_10088341 | 3300005345 | Bacteria | 1681 |
| 15 | Ga0070675_100332417 | 3300005354 | Bacteria | 1344 |
| 16 | Ga0070671_101639737 | 3300005355 | Unclassified | 570 |
| 17 | Ga0070688_100160568 | 3300005365 | Bacteria | 1544 |
| 18 | Ga0070688_100165528 | 3300005365 | Bacteria | 1522 |
| 19 | Ga0070667_100312220 | 3300005367 | Unclassified | 1417 |
| 20 | Ga0070714_100015285 | 3300005435 | Bacteria | 6175 |
| 21 | Ga0070714_101253019 | 3300005435 | Unclassified | 724 |
| 22 | Ga0070713_101038031 | 3300005436 | Unclassified | 791 |
| 23 | Ga0070713_101287144 | 3300005436 | Unclassified | 708 |
| 24 | Ga0070705_100515414 | 3300005440 | Bacteria | 910 |
| 25 | Ga0070681_10074824 | 3300005458 | Bacteria | 3347 |
| 26 | Ga0070681_10426024 | 3300005458 | Bacteria | 1239 |
| 27 | Ga0070681_10449788 | 3300005458 | Bacteria | 1200 |
| 28 | Ga0070681_10665485 | 3300005458 | Bacteria | 956 |
| 29 | Ga0068867_101052845 | 3300005459 | Unclassified | 740 |
| 30 | Ga0070685_10014015 | 3300005466 | Bacteria | 4242 |
| 31 | Ga0070679_100132479 | 3300005530 | Bacteria | 2474 |
| 32 | Ga0070679_100806016 | 3300005530 | Bacteria | 882 |
| 33 | Ga0070684_100181824 | 3300005535 | Unclassified | 1912 |
| 34 | Ga0070684_100296475 | 3300005535 | Unclassified | 1483 |
| 35 | Ga0070684_101425656 | 3300005535 | Unclassified | 652 |
| 36 | Ga0070697_100117784 | 3300005536 | Bacteria | 2219 |
| 37 | Ga0068853_100024060 | 3300005539 | Bacteria | 5105 |
| 38 | Ga0070686_100065343 | 3300005544 | Unclassified | 2363 |
| 39 | Ga0070686_100124689 | 3300005544 | Bacteria | 1773 |
| 40 | Ga0070686_100186577 | 3300005544 | Bacteria | 1477 |
| 41 | Ga0070686_100301557 | 3300005544 | Unclassified | 1188 |
| 42 | Ga0070695_101174837 | 3300005545 | Unclassified | 630 |
| 43 | Ga0070693_100198914 | 3300005547 | Bacteria | 1300 |
| 44 | Ga0070704_100854292 | 3300005549 | Unclassified | 816 |
| 45 | Ga0068855_100125625 | 3300005563 | Bacteria | 2933 |
| 46 | Ga0068855_100133062 | 3300005563 | Bacteria | 2839 |
| 47 | Ga0068855_100529953 | 3300005563 | Unclassified | 1277 |
| 48 | Ga0068857_100098997 | 3300005577 | Bacteria | 2615 |
| 49 | Ga0068857_100597569 | 3300005577 | Bacteria | 1043 |
| 50 | Ga0068856_100029138 | 3300005614 | Bacteria | 5392 |
| 51 | Ga0068856_100041360 | 3300005614 | Bacteria | 4529 |
| 52 | Ga0068856_101842325 | 3300005614 | Unclassified | 616 |
| 53 | Ga0070702_100111274 | 3300005615 | Viruses | 1698 |
| 54 | Ga0068859_100033101 | 3300005617 | Bacteria | 5192 |
| 55 | Ga0068859_100296545 | 3300005617 | Bacteria | 1710 |
| 56 | Ga0068859_100652474 | 3300005617 | Bacteria | 1144 |
| 57 | Ga0068859_101643559 | 3300005617 | Unclassified | 709 |
| 58 | Ga0068859_102037134 | 3300005617 | Unclassified | 634 |
| 59 | Ga0068859_102341226 | 3300005617 | Viruses | 589 |
| 60 | Ga0068864_100015488 | 3300005618 | Bacteria | 6339 |
| 61 | Ga0068866_10443232 | 3300005718 | Unclassified | 847 |
| 62 | Ga0068861_101997603 | 3300005719 | Unclassified | 578 |
| 63 | Ga0068863_100339277 | 3300005841 | Bacteria | 1462 |
| 64 | Ga0068863_100964817 | 3300005841 | Bacteria | 854 |
| 65 | Ga0068858_100075457 | 3300005842 | Bacteria | 3132 |
| 66 | Ga0068858_101646338 | 3300005842 | Unclassified | 634 |
| 67 | Ga0068862_100307116 | 3300005844 | Unclassified | 1461 |
| 68 | Ga0068862_100340318 | 3300005844 | Bacteria | 1389 |
| 69 | Ga0070717_10625085 | 3300006028 | Bacteria | 977 |
| 70 | Ga0070712_100324328 | 3300006175 | Bacteria | 1253 |
| 71 | Ga0070712_100381727 | 3300006175 | Unclassified | 1160 |
| 72 | Ga0097621_100139447 | 3300006237 | Unclassified | 2071 |
| 73 | Ga0097621_100388862 | 3300006237 | Bacteria | 1247 |
| 74 | Ga0097621_101398773 | 3300006237 | Unclassified | 662 |
| 75 | Ga0097621_101803421 | 3300006237 | Bacteria | 583 |
| 76 | Ga0068871_100014149 | 3300006358 | Bacteria | 5937 |
| 77 | Ga0068871_100474049 | 3300006358 | Unclassified | 1125 |
| 78 | Ga0068871_101400341 | 3300006358 | Unclassified | 659 |
| 79 | Ga0068865_100115160 | 3300006881 | Bacteria | 1989 |
| 80 | Ga0075436_100578462 | 3300006914 | Unclassified | 826 |
| 81 | Ga0075436_100851756 | 3300006914 | Unclassified | 680 |
| 82 | Ga0097620_100033101 | 3300006931 | Bacteria | 5192 |
| 83 | Ga0097620_100296547 | 3300006931 | Bacteria | 1710 |
| 84 | Ga0097620_100652428 | 3300006931 | Bacteria | 1144 |
| 85 | Ga0097620_101643541 | 3300006931 | Unclassified | 709 |
| 86 | Ga0097620_102340892 | 3300006931 | Viruses | 589 |
| 87 | Ga0075435_100129022 | 3300007076 | Bacteria | 2115 |
| 88 | Ga0075435_100726991 | 3300007076 | Unclassified | 863 |
| 89 | Ga0075435_100804733 | 3300007076 | Unclassified | 818 |
| 90 | Ga0099794_10243831 | 3300007265 | Bacteria | 926 |
| 91 | Ga0099795_10193139 | 3300007788 | Bacteria | 856 |
| 92 | Ga0105240_10003594 | 3300009093 | Bacteria | 24026 |
| 93 | Ga0105240_10076034 | 3300009093 | Bacteria | 4141 |
| 94 | Ga0105240_10295247 | 3300009093 | Unclassified | 1856 |
| 95 | Ga0105240_10669466 | 3300009093 | Bacteria | 1136 |
| 96 | Ga0105240_10674776 | 3300009093 | Unclassified | 1130 |
| 97 | Ga0105240_10715003 | 3300009093 | Bacteria | 1092 |
| 98 | Ga0105240_11502780 | 3300009093 | Bacteria | 706 |
| 99 | Ga0111539_10809455 | 3300009094 | Unclassified | 1090 |
| 100 | Ga0111539_11541392 | 3300009094 | Bacteria | 771 |
| 101 | Ga0105245_10335077 | 3300009098 | Bacteria | 1494 |
| 102 | Ga0105241_10149676 | 3300009174 | Bacteria | 1908 |
| 103 | Ga0105241_10979190 | 3300009174 | Unclassified | 790 |
| 104 | Ga0105242_10686484 | 3300009176 | Unclassified | 1000 |
| 105 | Ga0105248_10194861 | 3300009177 | Bacteria | 2283 |
| 106 | Ga0105238_10002928 | 3300009551 | Bacteria | 17040 |
| 107 | Ga0105238_10027806 | 3300009551 | Bacteria | 5763 |
| 108 | Ga0105238_10562978 | 3300009551 | Unclassified | 1145 |
| 109 | Ga0099796_10081491 | 3300010159 | Unclassified | 1187 |
| 110 | Ga0157371_10661233 | 3300013102 | Bacteria | 780 |
| 111 | Ga0157370_10087563 | 3300013104 | Bacteria | 2925 |
| 112 | Ga0157370_10340613 | 3300013104 | Unclassified | 1382 |
| 113 | Ga0157374_10351742 | 3300013296 | Bacteria | 1464 |
| 114 | Ga0157374_10917534 | 3300013296 | Unclassified | 894 |
| 115 | Ga0157374_11029903 | 3300013296 | Bacteria | 843 |
| 116 | Ga0157374_11120370 | 3300013296 | Unclassified | 808 |
| 117 | Ga0157374_11327138 | 3300013296 | Unclassified | 742 |
| 118 | Ga0157374_11375247 | 3300013296 | Unclassified | 728 |
| 119 | Ga0157374_11464012 | 3300013296 | Bacteria | 706 |
| 120 | Ga0157374_11648516 | 3300013296 | Unclassified | 666 |
| 121 | Ga0157378_10782342 | 3300013297 | Unclassified | 979 |
| 122 | Ga0163162_11089773 | 3300013306 | Bacteria | 905 |
| 123 | Ga0163162_11221420 | 3300013306 | Bacteria | 853 |
| 124 | Ga0157372_10180286 | 3300013307 | Bacteria | 2445 |
| 125 | Ga0157372_10241781 | 3300013307 | Unclassified | 2095 |
| 126 | Ga0157375_10000006 | 3300013308 | Bacteria | 384086 |
| 127 | Ga0157375_10778573 | 3300013308 | Bacteria | 1106 |
| 128 | Ga0163163_10000124 | 3300014325 | Bacteria | 81990 |
| 129 | Ga0163163_10116373 | 3300014325 | Bacteria | 2704 |
| 130 | Ga0163163_11273562 | 3300014325 | Unclassified | 797 |
| 131 | Ga0157377_11498168 | 3300014745 | Unclassified | 536 |
| 132 | Ga0157376_10081255 | 3300014969 | Bacteria | 2782 |
| 133 | Ga0157376_10462835 | 3300014969 | Unclassified | 1239 |
| 134 | Ga0157376_10778951 | 3300014969 | Unclassified | 968 |
| 135 | Ga0157376_11811220 | 3300014969 | Unclassified | 647 |
| 136 | Ga0207680_10024576 | 3300025903 | Unclassified | 3309 |
| 137 | Ga0207705_10235087 | 3300025909 | Bacteria | 1395 |
| 138 | Ga0207695_10049797 | 3300025913 | Bacteria | 4412 |
| 139 | Ga0207695_10069197 | 3300025913 | Unclassified | 3612 |
| 140 | Ga0207695_10100345 | 3300025913 | Bacteria | 2891 |
| 141 | Ga0207695_10462674 | 3300025913 | Bacteria | 1151 |
| 142 | Ga0207695_10552515 | 3300025913 | Bacteria | 1033 |
| 143 | Ga0207660_10854494 | 3300025917 | Unclassified | 743 |
| 144 | Ga0207694_10060915 | 3300025924 | Bacteria | 2937 |
| 145 | Ga0207694_10176179 | 3300025924 | Unclassified | 1733 |
| 146 | Ga0207694_10181323 | 3300025924 | Bacteria | 1708 |
| 147 | Ga0207659_10415805 | 3300025926 | Unclassified | 1127 |
| 148 | Ga0207687_10222552 | 3300025927 | Bacteria | 1487 |
| 149 | Ga0207700_10569643 | 3300025928 | Bacteria | 1006 |
| 150 | Ga0207700_10885261 | 3300025928 | Unclassified | 799 |
| 151 | Ga0207664_10024852 | 3300025929 | Bacteria | 4504 |
| 152 | Ga0207686_10231943 | 3300025934 | Bacteria | 1339 |
| 153 | Ga0207686_10288587 | 3300025934 | Bacteria | 1214 |
| 154 | Ga0207670_10016447 | 3300025936 | Bacteria | 4445 |
| 155 | Ga0207670_10303615 | 3300025936 | Unclassified | 1251 |
| 156 | Ga0207670_10458604 | 3300025936 | Bacteria | 1029 |
| 157 | Ga0207670_10805388 | 3300025936 | Unclassified | 783 |
| 158 | Ga0207689_10251948 | 3300025942 | Unclassified | 1460 |
| 159 | Ga0207667_10230420 | 3300025949 | Unclassified | 1897 |
| 160 | Ga0207667_10480585 | 3300025949 | Unclassified | 1261 |
| 161 | Ga0207667_11316503 | 3300025949 | Bacteria | 698 |
| 162 | Ga0207677_10333119 | 3300026023 | Unclassified | 1265 |
| 163 | Ga0207639_10362799 | 3300026041 | Bacteria | 1297 |
| 164 | Ga0207702_10000808 | 3300026078 | Bacteria | 33196 |
| 165 | Ga0207702_10020731 | 3300026078 | Bacteria | 5435 |
| 166 | Ga0207702_10020867 | 3300026078 | Bacteria | 5420 |
| 167 | Ga0207641_10435933 | 3300026088 | Unclassified | 1264 |
| 168 | Ga0207641_11045609 | 3300026088 | Unclassified | 814 |
| 169 | Ga0207648_11202485 | 3300026089 | Unclassified | 712 |
| 170 | Ga0207676_11062445 | 3300026095 | Unclassified | 799 |
| 171 | Ga0207674_10096275 | 3300026116 | Bacteria | 2945 |
| 172 | Ga0207674_10131333 | 3300026116 | Bacteria | 2467 |
| 173 | Ga0207698_10461120 | 3300026142 | Unclassified | 1229 |
| 174 | Ga0268265_10573712 | 3300028380 | Unclassified | 1074 |
| 175 | Ga0268265_11755641 | 3300028380 | Unclassified | 627 |
| 176 | Ga0265337_1044031 | 3300028556 | Bacteria | 1274 |
| 177 | Ga0265326_10010559 | 3300028558 | Bacteria | 2737 |
| 178 | Ga0265326_10015765 | 3300028558 | Bacteria | 2189 |
| 179 | Ga0265326_10026945 | 3300028558 | Bacteria | 1638 |
| 180 | Ga0265319_1000016 | 3300028563 | Bacteria | 176245 |
| 181 | Ga0265319_1054778 | 3300028563 | Bacteria | 1307 |
| 182 | Ga0265334_10035360 | 3300028573 | Bacteria | 1978 |
| 183 | Ga0265334_10036479 | 3300028573 | Bacteria | 1941 |
| 184 | Ga0265318_10181978 | 3300028577 | Unclassified | 769 |
| 185 | Ga0265318_10271937 | 3300028577 | Unclassified | 618 |
| 186 | Ga0265323_10043416 | 3300028653 | Bacteria | 1623 |
| 187 | Ga0265322_10152290 | 3300028654 | Unclassified | 661 |
| 188 | Ga0265336_10121625 | 3300028666 | Unclassified | 777 |
| 189 | Ga0265336_10157091 | 3300028666 | Unclassified | 676 |
| 190 | Ga0265336_10185351 | 3300028666 | Bacteria | 619 |
| 191 | Ga0265338_10000032 | 3300028800 | Bacteria | 257580 |
| 192 | Ga0265338_10000487 | 3300028800 | Bacteria | 70806 |
| 193 | Ga0265338_10000605 | 3300028800 | Bacteria | 62898 |
| 194 | Ga0265338_10000808 | 3300028800 | Bacteria | 52850 |
| 195 | Ga0265338_10003037 | 3300028800 | Bacteria | 24157 |
| 196 | Ga0265338_10004439 | 3300028800 | Bacteria | 18945 |
| 197 | Ga0265338_10006411 | 3300028800 | Bacteria | 14999 |
| 198 | Ga0265338_10006466 | 3300028800 | Bacteria | 14930 |
| 199 | Ga0265338_10017598 | 3300028800 | Bacteria | 7694 |
| 200 | Ga0265338_10021100 | 3300028800 | Bacteria | 6809 |
| 201 | Ga0265338_10025641 | 3300028800 | Bacteria | 5976 |
| 202 | Ga0265338_10032281 | 3300028800 | Bacteria | 5112 |
| 203 | Ga0265338_10036354 | 3300028800 | Bacteria | 4715 |
| 204 | Ga0265338_10052764 | 3300028800 | Bacteria | 3644 |
| 205 | Ga0265338_10081261 | 3300028800 | Bacteria | 2719 |
| 206 | Ga0265338_10194091 | 3300028800 | Bacteria | 1536 |
| 207 | Ga0265338_10265699 | 3300028800 | Bacteria | 1259 |
| 208 | Ga0265338_10798695 | 3300028800 | Unclassified | 647 |
| 209 | Ga0265338_11026978 | 3300028800 | Unclassified | 557 |
| 210 | Ga0265338_11076035 | 3300028800 | Unclassified | 542 |
| 211 | Ga0265324_10000275 | 3300029957 | Bacteria | 38013 |
| 212 | Ga0265324_10000434 | 3300029957 | Bacteria | 29709 |
| 213 | Ga0265324_10013737 | 3300029957 | Bacteria | 3013 |
| 214 | Ga0265324_10086271 | 3300029957 | Bacteria | 1067 |
| 215 | Ga0265320_10001118 | 3300031240 | Bacteria | 19763 |
| 216 | Ga0265320_10015186 | 3300031240 | Bacteria | 4359 |
| 217 | Ga0265320_10090798 | 3300031240 | Bacteria | 1415 |
| 218 | Ga0265320_10100847 | 3300031240 | Unclassified | 1330 |
| 219 | Ga0265320_10186352 | 3300031240 | Unclassified | 929 |
| 220 | Ga0265320_10512329 | 3300031240 | Unclassified | 530 |
| 221 | Ga0265325_10010574 | 3300031241 | Bacteria | 5339 |
| 222 | Ga0265325_10250743 | 3300031241 | Bacteria | 802 |
| 223 | Ga0265340_10000208 | 3300031247 | Bacteria | 29683 |
| 224 | Ga0265339_10075341 | 3300031249 | Bacteria | 1791 |
| 225 | Ga0265339_10106588 | 3300031249 | Unclassified | 1454 |
| 226 | Ga0265327_10001424 | 3300031251 | Bacteria | 30421 |
| 227 | Ga0265327_10048177 | 3300031251 | Bacteria | 2243 |
| 228 | Ga0265327_10277127 | 3300031251 | Unclassified | 742 |
| 229 | Ga0265316_10440738 | 3300031344 | Unclassified | 935 |
| 230 | Ga0265313_10026169 | 3300031595 | Bacteria | 3078 |
| 231 | Ga0265314_10029742 | 3300031711 | Bacteria | 4056 |
| 232 | Ga0265314_10328695 | 3300031711 | Unclassified | 848 |
| 233 | Ga0265314_10496370 | 3300031711 | Unclassified | 643 |
| 234 | Ga0265342_10345588 | 3300031712 | Bacteria | 776 |
| 235 | Ga0316578_10260700 | 3300031728 | Bacteria | 1039 |
| 236 | Ga0307516_10304137 | 3300031730 | Unclassified | 1270 |
| 237 | Ga0316577_10408216 | 3300031733 | Bacteria | 772 |
| 238 | Ga0373926_0319801 | 3300035083 | Unclassified | 607 |
| 239 | Ga0373928_0006300 | 3300035084 | Bacteria | 2281 |
| 240 | Ga0373944_0002365 | 3300035089 | Bacteria | 4803 |
| 241 | Ga0373949_0001197 | 3300035090 | Bacteria | 7696 |
| 242 | Ga0373932_0000003 | 3300035112 | Bacteria | 459351 |
| 243 | Ga0373939_0008858 | 3300035114 | Bacteria | 2479 |
| 244 | Ga0373953_0091247 | 3300035117 | Bacteria | 1275 |
| 245 | Ga0373954_0019754 | 3300035118 | Bacteria | 3041 |
| 246 | Ga0373954_0052119 | 3300035118 | Bacteria | 1922 |
| 247 | Ga0373956_0132088 | 3300035119 | Bacteria | 1169 |
| 248 | Ga0373957_0071932 | 3300035120 | Bacteria | 1354 |
| 249 | Ga0373943_0083080 | 3300035170 | Bacteria | 1646 |
| 250 | Ga0373955_0675937 | 3300035172 | Bacteria | 633 |
| 251 | Ga0373942_0091305 | 3300035207 | Bacteria | 918 |
| 252 | Ga0373962_0000106 | 3300035242 | Bacteria | 18384 |
| 253 | Ga0373924_0282904 | 3300035410 | Bacteria | 736 |
| 254 | Ga0373931_0000017 | 3300035691 | Bacteria | 207733 |
| 255 | Ga0373931_0682849 | 3300035691 | Unclassified | 677 |
| 256 | Ga0373935_0018453 | 3300035692 | Bacteria | 4243 |
| 257 | Ga0373935_0247232 | 3300035692 | Bacteria | 1247 |
| 258 | Ga0373927_0009723 | 3300035695 | Bacteria | 6446 |
| 259 | Ga0373927_0057013 | 3300035695 | Bacteria | 2526 |
| 260 | Ga0373927_0322657 | 3300035695 | Unclassified | 1017 |
| 261 | Ga0373927_0660894 | 3300035695 | Unclassified | 691 |
| 262 | Ga0373933_0081746 | 3300035724 | Bacteria | 1982 |
| 263 | Ga0373933_0277286 | 3300035724 | Unclassified | 1083 |
| 264 | Ga0373933_0375953 | 3300035724 | Unclassified | 925 |
| 265 | Ga0373947_0018292 | 3300035725 | Bacteria | 4033 |
| 266 | Ga0373947_0023833 | 3300035725 | Bacteria | 3563 |
| 267 | Ga0373947_0510227 | 3300035725 | Bacteria | 817 |
| 268 | Ga0373947_0785781 | 3300035725 | Unclassified | 650 |
| 269 | Ga0373937_0041151 | 3300036401 | Bacteria | 4216 |
| 270 | Ga0373937_0413763 | 3300036401 | Bacteria | 1279 |
| 271 | Ga0373937_0639770 | 3300036401 | Bacteria | 1009 |
| 272 | Ga0373937_2013903 | 3300036401 | Unclassified | 523 |
| 273 | Ga0316584_0692393 | 3300036712 | Bacteria | 699 |
| 274 | Ga0373925_0001370 | 3300037068 | Bacteria | 21253 |
| 275 | Ga0373925_0004833 | 3300037068 | Bacteria | 10144 |
| 276 | Ga0373925_0009024 | 3300037068 | Bacteria | 7262 |
| 277 | Ga0373925_0065716 | 3300037068 | Bacteria | 2733 |
| 278 | Ga0373925_0337671 | 3300037068 | Unclassified | 1222 |
| 279 | Ga0436363_1175420 | 3300039450 | Bacteria | 654 |
| 280 | Ga0451807_1625061 | 3300041486 | Bacteria | 1120 |
| 281 | Ga0451577_0003436 | 3300042876 | Bacteria | 17641 |
| 282 | Ga0451577_0015600 | 3300042876 | Bacteria | 7060 |
| 283 | Ga0451577_0326402 | 3300042876 | Bacteria | 1392 |
| 284 | Ga0453683_0433601 | 3300044673 | Unclassified | 849 |
| 285 | Ga0453683_0584459 | 3300044673 | Bacteria | 728 |
| 286 | Ga0453684_0004628 | 3300044712 | Bacteria | 28595 |
| 287 | Ga0453684_0013527 | 3300044712 | Bacteria | 13239 |
| 288 | Ga0453684_0257863 | 3300044712 | Bacteria | 1999 |
| 289 | Ga0453684_0304608 | 3300044712 | Bacteria | 1810 |
| 290 | Ga0451576_0015861 | 3300045051 | Bacteria | 8334 |
| 291 | Ga0451576_0070874 | 3300045051 | Bacteria | 3628 |
| 292 | Ga0451576_0101374 | 3300045051 | Bacteria | 2994 |
| 293 | Ga0451576_0119407 | 3300045051 | Bacteria | 2745 |
| 294 | Ga0451576_0277401 | 3300045051 | Bacteria | 1753 |
| 295 | Ga0451576_0285316 | 3300045051 | Bacteria | 1726 |
| 296 | Ga0451576_0327736 | 3300045051 | Bacteria | 1603 |
| 297 | Ga0451576_0559374 | 3300045051 | Bacteria | 1202 |
| 298 | Ga0451576_0911256 | 3300045051 | Bacteria | 922 |
| 299 | Ga0451576_0921262 | 3300045051 | Bacteria | 917 |
| 300 | Ga0451576_1388397 | 3300045051 | Bacteria | 731 |
| 301 | Ga0495592_0000012 | 3300046454 | Bacteria | 154054 |
| 302 | Ga0495592_0008014 | 3300046454 | Bacteria | 7929 |
| 303 | Ga0495641_0020043 | 3300046461 | Bacteria | 3403 |
| 304 | Ga0495651_0820379 | 3300046462 | Unclassified | 573 |
| 305 | Ga0495653_0269626 | 3300046463 | Bacteria | 1122 |
| 306 | Ga0495582_0008132 | 3300046473 | Bacteria | 5791 |
| 307 | Ga0495582_0042644 | 3300046473 | Bacteria | 2499 |
| 308 | Ga0495639_0193063 | 3300046475 | Bacteria | 995 |
| 309 | Ga0495662_0024801 | 3300046476 | Bacteria | 2894 |
| 310 | Ga0495664_0116525 | 3300046477 | Bacteria | 1615 |
| 311 | Ga0495664_0183556 | 3300046477 | Bacteria | 1268 |
| 312 | Ga0495618_0003395 | 3300046514 | Bacteria | 9912 |
| 313 | Ga0495618_0152470 | 3300046514 | Bacteria | 1476 |
| 314 | Ga0495628_0000320 | 3300046516 | Bacteria | 43366 |
| 315 | Ga0495628_0101979 | 3300046516 | Bacteria | 2214 |
| 316 | Ga0495628_0112984 | 3300046516 | Bacteria | 2088 |
| 317 | Ga0495628_0546532 | 3300046516 | Unclassified | 832 |
| 318 | Ga0495630_0000010 | 3300046517 | Bacteria | 265324 |
| 319 | Ga0495630_0015375 | 3300046517 | Bacteria | 5589 |
| 320 | Ga0495630_0085523 | 3300046517 | Bacteria | 2381 |
| 321 | Ga0495630_0349178 | 3300046517 | Bacteria | 1132 |
| 322 | Ga0495630_0866189 | 3300046517 | Unclassified | 689 |
| 323 | Ga0495666_0001932 | 3300046526 | Bacteria | 10222 |
| 324 | Ga0495666_0215491 | 3300046526 | Unclassified | 880 |
| 325 | Ga0495652_0213841 | 3300046529 | Bacteria | 1453 |
| 326 | Ga0495640_0114169 | 3300046533 | Bacteria | 1761 |
| 327 | Ga0495640_0145786 | 3300046533 | Bacteria | 1523 |
| 328 | Ga0495640_0164527 | 3300046533 | Bacteria | 1420 |
| 329 | Ga0495586_0000048 | 3300046535 | Bacteria | 71629 |
| 330 | Ga0495586_0000867 | 3300046535 | Bacteria | 17339 |
| 331 | Ga0495586_0001538 | 3300046535 | Bacteria | 12729 |
| 332 | Ga0495586_0010259 | 3300046535 | Bacteria | 4982 |
| 333 | Ga0495586_0105757 | 3300046535 | Bacteria | 1565 |
| 334 | Ga0495586_0619264 | 3300046535 | Bacteria | 625 |
| 335 | Ga0495587_0125912 | 3300046536 | Bacteria | 1466 |
| 336 | Ga0495645_0060630 | 3300046543 | Bacteria | 2742 |
| 337 | Ga0495645_0121318 | 3300046543 | Bacteria | 1840 |
| 338 | Ga0495667_0706338 | 3300046559 | Unclassified | 625 |
| 339 | Ga0495667_0829181 | 3300046559 | Unclassified | 569 |
| 340 | Ga0495634_0018314 | 3300046642 | Bacteria | 4987 |
| 341 | Ga0495634_0018945 | 3300046642 | Bacteria | 4894 |
| 342 | Ga0495634_0067853 | 3300046642 | Bacteria | 2358 |
| 343 | Ga0495635_0010465 | 3300046663 | Bacteria | 6488 |
| 344 | Ga0495657_0275130 | 3300046675 | Bacteria | 1009 |
| 345 | Ga0495599_0022090 | 3300046678 | Bacteria | 3971 |
| 346 | Ga0495599_0091371 | 3300046678 | Bacteria | 1899 |
| 347 | Ga0495599_0326041 | 3300046678 | Unclassified | 923 |
| 348 | Ga0495647_0015866 | 3300046681 | Bacteria | 2645 |
| 349 | Ga0495647_0017659 | 3300046681 | Bacteria | 2527 |
| 350 | Ga0495647_0181821 | 3300046681 | Unclassified | 915 |
| 351 | Ga0495658_0017047 | 3300046683 | Bacteria | 3746 |
| 352 | Ga0495669_0112776 | 3300046684 | Unclassified | 1270 |
| 353 | Ga0495669_0166625 | 3300046684 | Bacteria | 1047 |
| 354 | Ga0495613_0001643 | 3300046689 | Bacteria | 17024 |
| 355 | Ga0495613_0072400 | 3300046689 | Bacteria | 2512 |
| 356 | Ga0495613_0608166 | 3300046689 | Bacteria | 727 |
| 357 | Ga0495624_0032378 | 3300046690 | Bacteria | 3391 |
| 358 | Ga0495624_0076653 | 3300046690 | Bacteria | 2075 |
| 359 | Ga0495624_0251536 | 3300046690 | Unclassified | 1069 |
| 360 | Ga0495581_0243749 | 3300047315 | Unclassified | 1051 |
| 361 | Ga0495636_0298126 | 3300047318 | Unclassified | 754 |
| 362 | Ga0495674_0001886 | 3300047319 | Bacteria | 20650 |
| 363 | Ga0495674_0029720 | 3300047319 | Bacteria | 4973 |
| 364 | Ga0495674_0190824 | 3300047319 | Bacteria | 1703 |
| 365 | Ga0495676_0022222 | 3300047321 | Bacteria | 5524 |
| 366 | Ga0495676_0027623 | 3300047321 | Bacteria | 4863 |
| 367 | Ga0495680_0002831 | 3300047322 | Bacteria | 17453 |
| 368 | Ga0495680_0155991 | 3300047322 | Bacteria | 1660 |
| 369 | Ga0495680_0160512 | 3300047322 | Bacteria | 1633 |
| 370 | Ga0495675_0118648 | 3300047444 | Bacteria | 1648 |
| 371 | Ga0495684_0833832 | 3300047471 | Unclassified | 600 |
| 372 | Ga0495614_0274048 | 3300048089 | Unclassified | 776 |
| 373 | Ga0496105_0809376 | 3300048908 | Unclassified | 712 |
| 374 | Ga0496112_1165561 | 3300048915 | Unclassified | 688 |
| 375 | Ga0496112_1589082 | 3300048915 | Bacteria | 567 |
| 376 | Ga0496115_0011297 | 3300048918 | Bacteria | 6691 |
| 377 | Ga0501031_0000012 | 3300049568 | Bacteria | 137943 |
| 378 | Ga0501032_0007666 | 3300049569 | Bacteria | 7870 |
| 379 | Ga0501032_0020292 | 3300049569 | Bacteria | 4631 |
| 380 | Ga0501032_0282887 | 3300049569 | Bacteria | 1074 |
| 381 | Ga0501033_0001607 | 3300049570 | Bacteria | 19842 |
| 382 | Ga0501033_0012811 | 3300049570 | Bacteria | 6395 |
| 383 | Ga0501033_0039943 | 3300049570 | Bacteria | 3504 |
| 384 | Ga0501034_0250705 | 3300049571 | Bacteria | 1715 |
| 385 | Ga0501034_0472220 | 3300049571 | Bacteria | 1170 |
| 386 | Ga0501036_0265967 | 3300049572 | Bacteria | 1436 |
| 387 | Ga0501037_0042861 | 3300049573 | Bacteria | 3326 |
| 388 | Ga0501037_0096065 | 3300049573 | Bacteria | 2142 |
| 389 | Ga0501043_0321666 | 3300049579 | Unclassified | 1179 |
| 390 | Ga0501046_0356647 | 3300049580 | Bacteria | 1061 |
| 391 | Ga0501047_0132940 | 3300049581 | Bacteria | 2368 |
| 392 | Ga0501047_0283253 | 3300049581 | Bacteria | 1502 |
| 393 | Ga0501080_0031912 | 3300049742 | Bacteria | 4909 |
| 394 | Ga0501035_0003711 | 3300049822 | Bacteria | 14559 |
| 395 | Ga0501035_0078062 | 3300049822 | Bacteria | 2926 |
| 396 | Ga0501044_0000024 | 3300049823 | Bacteria | 194302 |
| 397 | Ga0501044_0040160 | 3300049823 | Bacteria | 4878 |
| 398 | Ga0501044_0411069 | 3300049823 | Bacteria | 1264 |
| 399 | nmdc:mga0rr50_931194_c1 | 3300050513 | Unclassified | 741 |
| 400 | nmdc:mga08x19_538286_c1 | 3300050514 | Unclassified | 826 |
| 401 | Ga0500650_0083328 | 3300053098 | Unclassified | 1495 |
| 402 | Ga0157369_10561507 | |||
| 403 | rootH2_10054090 | |||
| 404 | Ga0070658_10056106 | |||
| 405 | Ga0070690_100007018 | |||
| 406 | Ga0068869_100278578 | |||
| 407 | Ga0070666_10028244 | |||
| 408 | Ga0068868_100096426 | |||
| 409 | Ga0070689_100017564 | |||
| 410 | Ga0070689_100144589 | |||
| 411 | Ga0070689_100345112 | |||
| 412 | Ga0070689_100466856 | |||
| 413 | Ga0070689_101084175 | |||
| 414 | Ga0070691_10226693 | |||
| 415 | Ga0070692_10088341 | |||
| 416 | Ga0070675_100332417 | |||
| 417 | Ga0070671_101639737 | |||
| 418 | Ga0070688_100160568 | |||
| 419 | Ga0070688_100165528 | |||
| 420 | Ga0070667_100312220 | |||
| 421 | Ga0070714_100015285 | |||
| 422 | Ga0070714_101253019 | |||
| 423 | Ga0070713_101038031 | |||
| 424 | Ga0070713_101287144 | |||
| 425 | Ga0070705_100515414 | |||
| 426 | Ga0070681_10074824 | |||
| 427 | Ga0070681_10426024 | |||
| 428 | Ga0070681_10449788 | |||
| 429 | Ga0070681_10665485 | |||
| 430 | Ga0068867_101052845 | |||
| 431 | Ga0070685_10014015 | |||
| 432 | Ga0070679_100132479 | |||
| 433 | Ga0070679_100806016 | |||
| 434 | Ga0070684_100181824 | |||
| 435 | Ga0070684_100296475 | |||
| 436 | Ga0070684_101425656 | |||
| 437 | Ga0070697_100117784 | |||
| 438 | Ga0068853_100024060 | |||
| 439 | Ga0070686_100065343 | |||
| 440 | Ga0070686_100124689 | |||
| 441 | Ga0070686_100186577 | |||
| 442 | Ga0070686_100301557 | |||
| 443 | Ga0070695_101174837 | |||
| 444 | Ga0070693_100198914 | |||
| 445 | Ga0070704_100854292 | |||
| 446 | Ga0068855_100125625 | |||
| 447 | Ga0068855_100133062 | |||
| 448 | Ga0068855_100529953 | |||
| 449 | Ga0068857_100098997 | |||
| 450 | Ga0068857_100597569 | |||
| 451 | Ga0068856_100029138 | |||
| 452 | Ga0068856_100041360 | |||
| 453 | Ga0068856_101842325 | |||
| 454 | Ga0070702_100111274 | |||
| 455 | Ga0068859_100033101 | |||
| 456 | Ga0068859_100296545 | |||
| 457 | Ga0068859_100652474 | |||
| 458 | Ga0068859_101643559 | |||
| 459 | Ga0068859_102037134 | |||
| 460 | Ga0068859_102341226 | |||
| 461 | Ga0068864_100015488 | |||
| 462 | Ga0068866_10443232 | |||
| 463 | Ga0068861_101997603 | |||
| 464 | Ga0068863_100339277 | |||
| 465 | Ga0068863_100964817 | |||
| 466 | Ga0068858_100075457 | |||
| 467 | Ga0068858_101646338 | |||
| 468 | Ga0068862_100307116 | |||
| 469 | Ga0068862_100340318 | |||
| 470 | Ga0070717_10625085 | |||
| 471 | Ga0070712_100324328 | |||
| 472 | Ga0070712_100381727 | |||
| 473 | Ga0097621_100139447 | |||
| 474 | Ga0097621_100388862 | |||
| 475 | Ga0097621_101398773 | |||
| 476 | Ga0097621_101803421 | |||
| 477 | Ga0068871_100014149 | |||
| 478 | Ga0068871_100474049 | |||
| 479 | Ga0068871_101400341 | |||
| 480 | Ga0068865_100115160 | |||
| 481 | Ga0075436_100578462 | |||
| 482 | Ga0075436_100851756 | |||
| 483 | Ga0097620_100033101 | |||
| 484 | Ga0097620_100296547 | |||
| 485 | Ga0097620_100652428 | |||
| 486 | Ga0097620_101643541 | |||
| 487 | Ga0097620_102340892 | |||
| 488 | Ga0075435_100129022 | |||
| 489 | Ga0075435_100726991 | |||
| 490 | Ga0075435_100804733 | |||
| 491 | Ga0099794_10243831 | |||
| 492 | Ga0099795_10193139 | |||
| 493 | Ga0105240_10003594 | |||
| 494 | Ga0105240_10076034 | |||
| 495 | Ga0105240_10295247 | |||
| 496 | Ga0105240_10669466 | |||
| 497 | Ga0105240_10674776 | |||
| 498 | Ga0105240_10715003 | |||
| 499 | Ga0105240_11502780 | |||
| 500 | Ga0111539_10809455 | |||
| 501 | Ga0111539_11541392 | |||
| 502 | Ga0105245_10335077 | |||
| 503 | Ga0105241_10149676 | |||
| 504 | Ga0105241_10979190 | |||
| 505 | Ga0105242_10686484 | |||
| 506 | Ga0105248_10194861 | |||
| 507 | Ga0105238_10002928 | |||
| 508 | Ga0105238_10027806 | |||
| 509 | Ga0105238_10562978 | |||
| 510 | Ga0099796_10081491 | |||
| 511 | Ga0157371_10661233 | |||
| 512 | Ga0157370_10087563 | |||
| 513 | Ga0157370_10340613 | |||
| 514 | Ga0157374_10351742 | |||
| 515 | Ga0157374_10917534 | |||
| 516 | Ga0157374_11029903 | |||
| 517 | Ga0157374_11120370 | |||
| 518 | Ga0157374_11327138 | |||
| 519 | Ga0157374_11375247 | |||
| 520 | Ga0157374_11464012 | |||
| 521 | Ga0157374_11648516 | |||
| 522 | Ga0157378_10782342 | |||
| 523 | Ga0163162_11089773 | |||
| 524 | Ga0163162_11221420 | |||
| 525 | Ga0157372_10180286 | |||
| 526 | Ga0157372_10241781 | |||
| 527 | Ga0157375_10000006 | |||
| 528 | Ga0157375_10778573 | |||
| 529 | Ga0163163_10000124 | |||
| 530 | Ga0163163_10116373 | |||
| 531 | Ga0163163_11273562 | |||
| 532 | Ga0157377_11498168 | |||
| 533 | Ga0157376_10081255 | |||
| 534 | Ga0157376_10462835 | |||
| 535 | Ga0157376_10778951 | |||
| 536 | Ga0157376_11811220 | |||
| 537 | Ga0207680_10024576 | |||
| 538 | Ga0207705_10235087 | |||
| 539 | Ga0207695_10049797 | |||
| 540 | Ga0207695_10069197 | |||
| 541 | Ga0207695_10100345 | |||
| 542 | Ga0207695_10462674 | |||
| 543 | Ga0207695_10552515 | |||
| 544 | Ga0207660_10854494 | |||
| 545 | Ga0207694_10060915 | |||
| 546 | Ga0207694_10176179 | |||
| 547 | Ga0207694_10181323 | |||
| 548 | Ga0207659_10415805 | |||
| 549 | Ga0207687_10222552 | |||
| 550 | Ga0207700_10569643 | |||
| 551 | Ga0207700_10885261 | |||
| 552 | Ga0207664_10024852 | |||
| 553 | Ga0207686_10231943 | |||
| 554 | Ga0207686_10288587 | |||
| 555 | Ga0207670_10016447 | |||
| 556 | Ga0207670_10303615 | |||
| 557 | Ga0207670_10458604 | |||
| 558 | Ga0207670_10805388 | |||
| 559 | Ga0207689_10251948 | |||
| 560 | Ga0207667_10230420 | |||
| 561 | Ga0207667_10480585 | |||
| 562 | Ga0207667_11316503 | |||
| 563 | Ga0207677_10333119 | |||
| 564 | Ga0207639_10362799 | |||
| 565 | Ga0207702_10000808 | |||
| 566 | Ga0207702_10020731 | |||
| 567 | Ga0207702_10020867 | |||
| 568 | Ga0207641_10435933 | |||
| 569 | Ga0207641_11045609 | |||
| 570 | Ga0207648_11202485 | |||
| 571 | Ga0207676_11062445 | |||
| 572 | Ga0207674_10096275 | |||
| 573 | Ga0207674_10131333 | |||
| 574 | Ga0207698_10461120 | |||
| 575 | Ga0268265_10573712 | |||
| 576 | Ga0268265_11755641 | |||
| 577 | Ga0265337_1044031 | |||
| 578 | Ga0265326_10010559 | |||
| 579 | Ga0265326_10015765 | |||
| 580 | Ga0265326_10026945 | |||
| 581 | Ga0265319_1000016 | |||
| 582 | Ga0265319_1054778 | |||
| 583 | Ga0265334_10035360 | |||
| 584 | Ga0265334_10036479 | |||
| 585 | Ga0265318_10181978 | |||
| 586 | Ga0265318_10271937 | |||
| 587 | Ga0265323_10043416 | |||
| 588 | Ga0265322_10152290 | |||
| 589 | Ga0265336_10121625 | |||
| 590 | Ga0265336_10157091 | |||
| 591 | Ga0265336_10185351 | |||
| 592 | Ga0265338_10000032 | |||
| 593 | Ga0265338_10000487 | |||
| 594 | Ga0265338_10000605 | |||
| 595 | Ga0265338_10000808 | |||
| 596 | Ga0265338_10003037 | |||
| 597 | Ga0265338_10004439 | |||
| 598 | Ga0265338_10006411 | |||
| 599 | Ga0265338_10006466 | |||
| 600 | Ga0265338_10017598 | |||
| 601 | Ga0265338_10021100 | |||
| 602 | Ga0265338_10025641 | |||
| 603 | Ga0265338_10032281 | |||
| 604 | Ga0265338_10036354 | |||
| 605 | Ga0265338_10052764 | |||
| 606 | Ga0265338_10081261 | |||
| 607 | Ga0265338_10194091 | |||
| 608 | Ga0265338_10265699 | |||
| 609 | Ga0265338_10798695 | |||
| 610 | Ga0265338_11026978 | |||
| 611 | Ga0265338_11076035 | |||
| 612 | Ga0265324_10000275 | |||
| 613 | Ga0265324_10000434 | |||
| 614 | Ga0265324_10013737 | |||
| 615 | Ga0265324_10086271 | |||
| 616 | Ga0265320_10001118 | |||
| 617 | Ga0265320_10015186 | |||
| 618 | Ga0265320_10090798 | |||
| 619 | Ga0265320_10100847 | |||
| 620 | Ga0265320_10186352 | |||
| 621 | Ga0265320_10512329 | |||
| 622 | Ga0265325_10010574 | |||
| 623 | Ga0265325_10250743 | |||
| 624 | Ga0265340_10000208 | |||
| 625 | Ga0265339_10075341 | |||
| 626 | Ga0265339_10106588 | |||
| 627 | Ga0265327_10001424 | |||
| 628 | Ga0265327_10048177 | |||
| 629 | Ga0265327_10277127 | |||
| 630 | Ga0265316_10440738 | |||
| 631 | Ga0265313_10026169 | |||
| 632 | Ga0265314_10029742 | |||
| 633 | Ga0265314_10328695 | |||
| 634 | Ga0265314_10496370 | |||
| 635 | Ga0265342_10345588 | |||
| 636 | Ga0316578_10260700 | |||
| 637 | Ga0307516_10304137 | |||
| 638 | Ga0316577_10408216 | |||
| 639 | Ga0373926_0319801 | |||
| 640 | Ga0373928_0006300 | |||
| 641 | Ga0373944_0002365 | |||
| 642 | Ga0373949_0001197 | |||
| 643 | Ga0373932_0000003 | |||
| 644 | Ga0373939_0008858 | |||
| 645 | Ga0373953_0091247 | |||
| 646 | Ga0373954_0019754 | |||
| 647 | Ga0373954_0052119 | |||
| 648 | Ga0373956_0132088 | |||
| 649 | Ga0373957_0071932 | |||
| 650 | Ga0373943_0083080 | |||
| 651 | Ga0373955_0675937 | |||
| 652 | Ga0373942_0091305 | |||
| 653 | Ga0373962_0000106 | |||
| 654 | Ga0373924_0282904 | |||
| 655 | Ga0373931_0000017 | |||
| 656 | Ga0373931_0682849 | |||
| 657 | Ga0373935_0018453 | |||
| 658 | Ga0373935_0247232 | |||
| 659 | Ga0373927_0009723 | |||
| 660 | Ga0373927_0057013 | |||
| 661 | Ga0373927_0322657 | |||
| 662 | Ga0373927_0660894 | |||
| 663 | Ga0373933_0081746 | |||
| 664 | Ga0373933_0277286 | |||
| 665 | Ga0373933_0375953 | |||
| 666 | Ga0373947_0018292 | |||
| 667 | Ga0373947_0023833 | |||
| 668 | Ga0373947_0510227 | |||
| 669 | Ga0373947_0785781 | |||
| 670 | Ga0373937_0041151 | |||
| 671 | Ga0373937_0413763 | |||
| 672 | Ga0373937_0639770 | |||
| 673 | Ga0373937_2013903 | |||
| 674 | Ga0316584_0692393 | |||
| 675 | Ga0373925_0001370 | |||
| 676 | Ga0373925_0004833 | |||
| 677 | Ga0373925_0009024 | |||
| 678 | Ga0373925_0065716 | |||
| 679 | Ga0373925_0337671 | |||
| 680 | Ga0436363_1175420 | |||
| 681 | Ga0451807_1625061 | |||
| 682 | Ga0451577_0003436 | |||
| 683 | Ga0451577_0015600 | |||
| 684 | Ga0451577_0326402 | |||
| 685 | Ga0453683_0433601 | |||
| 686 | Ga0453683_0584459 | |||
| 687 | Ga0453684_0004628 | |||
| 688 | Ga0453684_0013527 | |||
| 689 | Ga0453684_0257863 | |||
| 690 | Ga0453684_0304608 | |||
| 691 | Ga0451576_0015861 | |||
| 692 | Ga0451576_0070874 | |||
| 693 | Ga0451576_0101374 | |||
| 694 | Ga0451576_0119407 | |||
| 695 | Ga0451576_0277401 | |||
| 696 | Ga0451576_0285316 | |||
| 697 | Ga0451576_0327736 | |||
| 698 | Ga0451576_0559374 | |||
| 699 | Ga0451576_0911256 | |||
| 700 | Ga0451576_0921262 | |||
| 701 | Ga0451576_1388397 | |||
| 702 | Ga0495592_0000012 | |||
| 703 | Ga0495592_0008014 | |||
| 704 | Ga0495641_0020043 | |||
| 705 | Ga0495651_0820379 | |||
| 706 | Ga0495653_0269626 | |||
| 707 | Ga0495582_0008132 | |||
| 708 | Ga0495582_0042644 | |||
| 709 | Ga0495639_0193063 | |||
| 710 | Ga0495662_0024801 | |||
| 711 | Ga0495664_0116525 | |||
| 712 | Ga0495664_0183556 | |||
| 713 | Ga0495618_0003395 | |||
| 714 | Ga0495618_0152470 | |||
| 715 | Ga0495628_0000320 | |||
| 716 | Ga0495628_0101979 | |||
| 717 | Ga0495628_0112984 | |||
| 718 | Ga0495628_0546532 | |||
| 719 | Ga0495630_0000010 | |||
| 720 | Ga0495630_0015375 | |||
| 721 | Ga0495630_0085523 | |||
| 722 | Ga0495630_0349178 | |||
| 723 | Ga0495630_0866189 | |||
| 724 | Ga0495666_0001932 | |||
| 725 | Ga0495666_0215491 | |||
| 726 | Ga0495652_0213841 | |||
| 727 | Ga0495640_0114169 | |||
| 728 | Ga0495640_0145786 | |||
| 729 | Ga0495640_0164527 | |||
| 730 | Ga0495586_0000048 | |||
| 731 | Ga0495586_0000867 | |||
| 732 | Ga0495586_0001538 | |||
| 733 | Ga0495586_0010259 | |||
| 734 | Ga0495586_0105757 | |||
| 735 | Ga0495586_0619264 | |||
| 736 | Ga0495587_0125912 | |||
| 737 | Ga0495645_0060630 | |||
| 738 | Ga0495645_0121318 | |||
| 739 | Ga0495667_0706338 | |||
| 740 | Ga0495667_0829181 | |||
| 741 | Ga0495634_0018314 | |||
| 742 | Ga0495634_0018945 | |||
| 743 | Ga0495634_0067853 | |||
| 744 | Ga0495635_0010465 | |||
| 745 | Ga0495657_0275130 | |||
| 746 | Ga0495599_0022090 | |||
| 747 | Ga0495599_0091371 | |||
| 748 | Ga0495599_0326041 | |||
| 749 | Ga0495647_0015866 | |||
| 750 | Ga0495647_0017659 | |||
| 751 | Ga0495647_0181821 | |||
| 752 | Ga0495658_0017047 | |||
| 753 | Ga0495669_0112776 | |||
| 754 | Ga0495669_0166625 | |||
| 755 | Ga0495613_0001643 | |||
| 756 | Ga0495613_0072400 | |||
| 757 | Ga0495613_0608166 | |||
| 758 | Ga0495624_0032378 | |||
| 759 | Ga0495624_0076653 | |||
| 760 | Ga0495624_0251536 | |||
| 761 | Ga0495581_0243749 | |||
| 762 | Ga0495636_0298126 | |||
| 763 | Ga0495674_0001886 | |||
| 764 | Ga0495674_0029720 | |||
| 765 | Ga0495674_0190824 | |||
| 766 | Ga0495676_0022222 | |||
| 767 | Ga0495676_0027623 | |||
| 768 | Ga0495680_0002831 | |||
| 769 | Ga0495680_0155991 | |||
| 770 | Ga0495680_0160512 | |||
| 771 | Ga0495675_0118648 | |||
| 772 | Ga0495684_0833832 | |||
| 773 | Ga0495614_0274048 | |||
| 774 | Ga0496105_0809376 | |||
| 775 | Ga0496112_1165561 | |||
| 776 | Ga0496112_1589082 | |||
| 777 | Ga0496115_0011297 | |||
| 778 | Ga0501031_0000012 | |||
| 779 | Ga0501032_0007666 | |||
| 780 | Ga0501032_0020292 | |||
| 781 | Ga0501032_0282887 | |||
| 782 | Ga0501033_0001607 | |||
| 783 | Ga0501033_0012811 | |||
| 784 | Ga0501033_0039943 | |||
| 785 | Ga0501034_0250705 | |||
| 786 | Ga0501034_0472220 | |||
| 787 | Ga0501036_0265967 | |||
| 788 | Ga0501037_0042861 | |||
| 789 | Ga0501037_0096065 | |||
| 790 | Ga0501043_0321666 | |||
| 791 | Ga0501046_0356647 | |||
| 792 | Ga0501047_0132940 | |||
| 793 | Ga0501047_0283253 | |||
| 794 | Ga0501080_0031912 | |||
| 795 | Ga0501035_0003711 | |||
| 796 | Ga0501035_0078062 | |||
| 797 | Ga0501044_0000024 | |||
| 798 | Ga0501044_0040160 | |||
| 799 | Ga0501044_0411069 | |||
| 800 | nmdc:mga0rr50_931194_c1 | |||
| 801 | nmdc:mga08x19_538286_c1 | |||
| 802 | Ga0500650_0083328 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mav-assembly1.cif.gz_A | crystal structure of the response regulator divk at ph 6.0 in complex with mn2+ | 0.8317 | 13 | 133 |
| 1mb0-assembly1.cif.gz_A | crystal structure of the response regulator divk at ph 8.0 in complex with mn2+ | 0.8272 | 13 | 133 |
| 1m5u-assembly1.cif.gz_A | crystal structure of the response regulator divk. structure at ph 8.0 in the apo-form | 0.8253 | 13 | 133 |
| 1mb3-assembly1.cif.gz_A | crystal structure of the response regulator divk at ph 8.5 in complex with mg2+ | 0.8121 | 13 | 133 |
| 1mb0-assembly1.cif.gz_A | crystal structure of the response regulator divk at ph 8.0 in complex with mn2+ | 0.8068 | 13 | 133 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3c97A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9034 | 14 | 62 | 3.40.50.2300 |
| 1m5uA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8253 | 13 | 133 | 3.40.50.2300 |
| af_O69730_8_88_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8128 | 14 | 97 | 3.40.50.2300 |
| af_P08368_2_83_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.797 | 12 | 97 | 3.40.50.2300 |
| 1nxoA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.7963 | 13 | 135 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A832DBV9-F1-model_v4 | Response regulatory domain-containing protein | 0.97 | 1 | 132 |
|
| AF-A0A2V8I6I8-F1-model_v4 | Response regulatory domain-containing protein | 0.968 | 25 | 137 |
|
| AF-A0A832DBV9-F1-model_v4 | Response regulatory domain-containing protein | 0.9489 | 1 | 132 |
|
| AF-A0A2V8I6I8-F1-model_v4 | Response regulatory domain-containing protein | 0.9436 | 25 | 137 |
|
| AF-A0A2N2LP17-F1-model_v4 | Response regulatory domain-containing protein | 0.943 | 5 | 122 |
|