F434805

General Info

Members Datasets Scaffolds Average Seq Length
401 199 802 327

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100258897|Ga0068858_1002588972
Length 349
Sequence MKTRVTWKIAAGALAIAASVHVVGLTRAAGAQTSRERTRIERMPWGDPDLHGEWTSEGEYGVPVERPPQFGTRQFLTDEEYAKRLEEVRIRDQRDLARVDVFSGKVDGPNAPIPHWREYNTTSRRTSLIIDPPDGRLPPRTPQARPVPVQRCGSLQGGEPCDSYEEYGLGVRCVVHGGGFPDAMFPAVYNANMRILQSPGWVAISYELIHDTRLIPLDPVPQREPQSSSTIRTYMGAARGHWDGMTLVVESGHFKANTRGSSPGLRLIEQFTRTGRNSIEYRVTFVDPATWTAPWTAALDLKARPADAGVFEYACHEGNYGMFNMLSAARYLERTAGEDASSRPSRQQR

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
141 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
142 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.74
Rhizosphere 96.76
Stem 0
Stem Tuber 0
Unclassified 19.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100258897 3300005842 Bacteria 1654
2 JGI24746J21847_1001790 3300001977 Bacteria 3440
3 JGI25406J46586_10004130 3300003203 Bacteria 6779
4 JGI25406J46586_10036292 3300003203 Bacteria 1790
5 Ga0065712_10010592 3300005290 Bacteria 2381
6 Ga0065712_10068685 3300005290 Bacteria 9392
7 Ga0065707_10107058 3300005295 Bacteria 2556
8 Ga0065707_10168179 3300005295 Viruses 1505
9 Ga0070658_10303659 3300005327 Unclassified 1361
10 Ga0070676_10020202 3300005328 Bacteria 3715
11 Ga0070690_100011820 3300005330 Bacteria 5119
12 Ga0070690_100018836 3300005330 Unclassified 4178
13 Ga0070670_100010669 3300005331 Bacteria 7848
14 Ga0070670_100011010 3300005331 Bacteria 7726
15 Ga0070670_100026356 3300005331 Bacteria 5002
16 Ga0070670_100106993 3300005331 Unclassified 2410
17 Ga0070670_100182909 3300005331 Bacteria 1820
18 Ga0070677_10070775 3300005333 Unclassified 1467
19 Ga0068869_100011709 3300005334 Bacteria 5764
20 Ga0068869_100015078 3300005334 Bacteria 5175
21 Ga0068869_100101367 3300005334 Bacteria 2178
22 Ga0070666_10029251 3300005335 Bacteria 3620
23 Ga0070666_10046670 3300005335 Bacteria 2906
24 Ga0068868_100015352 3300005338 Bacteria 5663
25 Ga0068868_100067372 3300005338 Bacteria 2849
26 Ga0070689_100121384 3300005340 Bacteria 2087
27 Ga0070661_100018476 3300005344 Bacteria 4956
28 Ga0070668_100105513 3300005347 Bacteria 2238
29 Ga0070668_100120949 3300005347 Bacteria 2092
30 Ga0070669_100005575 3300005353 Bacteria 9091
31 Ga0070669_100050941 3300005353 Bacteria 3025
32 Ga0070669_100083774 3300005353 Bacteria 2378
33 Ga0070669_100107230 3300005353 Bacteria 2116
34 Ga0070675_100006859 3300005354 Bacteria 8744
35 Ga0070675_100022523 3300005354 Bacteria 5035
36 Ga0070675_100031824 3300005354 Bacteria 4266
37 Ga0070675_100040739 3300005354 Bacteria 3793
38 Ga0070675_100044047 3300005354 Unclassified 3649
39 Ga0070675_100051266 3300005354 Bacteria 3391
40 Ga0070675_100057620 3300005354 Unclassified 3204
41 Ga0070675_100058943 3300005354 Unclassified 3167
42 Ga0070675_100070382 3300005354 Bacteria 2899
43 Ga0070671_100017198 3300005355 Bacteria 5853
44 Ga0070674_100000136 3300005356 Bacteria 33863
45 Ga0070674_100010599 3300005356 Bacteria 5579
46 Ga0070674_100377011 3300005356 Bacteria 1153
47 Ga0070673_100110224 3300005364 Bacteria 2281
48 Ga0070673_100125865 3300005364 Bacteria 2144
49 Ga0070688_100030464 3300005365 Bacteria 3239
50 Ga0070688_100043069 3300005365 Unclassified 2779
51 Ga0070688_100284374 3300005365 Unclassified 1190
52 Ga0070667_100054459 3300005367 Bacteria 3377
53 Ga0070714_100193332 3300005435 Bacteria 1858
54 Ga0070701_10020983 3300005438 Unclassified 3110
55 Ga0070700_100006102 3300005441 Bacteria 6418
56 Ga0070694_100047970 3300005444 Unclassified 2872
57 Ga0070678_100119723 3300005456 Bacteria 2074
58 Ga0070678_100184628 3300005456 Bacteria 1710
59 Ga0070678_100251708 3300005456 Bacteria 1481
60 Ga0070678_100335956 3300005456 Unclassified 1294
61 Ga0068867_100028401 3300005459 Bacteria 4028
62 Ga0068867_100064109 3300005459 Bacteria 2731
63 Ga0070685_10054633 3300005466 Unclassified 2318
64 Ga0070685_10122460 3300005466 Bacteria 1617
65 Ga0070672_100048980 3300005543 Bacteria 3286
66 Ga0070672_100068116 3300005543 Unclassified 2822
67 Ga0070672_100093698 3300005543 Unclassified 2427
68 Ga0070672_100481324 3300005543 Bacteria 1072
69 Ga0070686_100050634 3300005544 Unclassified 2640
70 Ga0070686_100328280 3300005544 Unclassified 1143
71 Ga0070665_100010962 3300005548 Bacteria 9166
72 Ga0070665_100017920 3300005548 Bacteria 7111
73 Ga0070704_100015629 3300005549 Bacteria 4774
74 Ga0070664_100014829 3300005564 Bacteria 6362
75 Ga0068854_100084401 3300005578 Bacteria 2350
76 Ga0068856_100227430 3300005614 Bacteria 1881
77 Ga0068856_100377420 3300005614 Bacteria 1437
78 Ga0070702_100101372 3300005615 Bacteria 1767
79 Ga0070702_100194767 3300005615 Unclassified 1337
80 Ga0068859_100055725 3300005617 Unclassified 3977
81 Ga0068859_100062166 3300005617 Bacteria 3764
82 Ga0068859_100114556 3300005617 Unclassified 2760
83 Ga0068864_100020898 3300005618 Bacteria 5480
84 Ga0068861_100017124 3300005719 Bacteria 5137
85 Ga0068861_100181466 3300005719 Bacteria 1753
86 Ga0068861_100213588 3300005719 Bacteria 1626
87 Ga0068851_10007555 3300005834 Bacteria 4995
88 Ga0068870_10005245 3300005840 Bacteria 5642
89 Ga0068870_10066849 3300005840 Unclassified 1948
90 Ga0068863_100160940 3300005841 Unclassified 2151
91 Ga0068863_100179238 3300005841 Unclassified 2034
92 Ga0068863_100330510 3300005841 Unclassified 1482
93 Ga0068858_100007179 3300005842 Bacteria 10802
94 Ga0068858_100041910 3300005842 Bacteria 4243
95 Ga0068862_100015297 3300005844 Bacteria 6372
96 Ga0068862_100080103 3300005844 Bacteria 2831
97 Ga0081539_10000017 3300005985 Bacteria 375107
98 Ga0081539_10003210 3300005985 Bacteria 20650
99 Ga0097621_100001289 3300006237 Bacteria 17246
100 Ga0097621_100009382 3300006237 Bacteria 7100
101 Ga0097621_100033488 3300006237 Bacteria 4092
102 Ga0097621_100037166 3300006237 Unclassified 3899
103 Ga0097621_100063179 3300006237 Bacteria 3042
104 Ga0097621_100155258 3300006237 Bacteria 1964
105 Ga0097621_100234141 3300006237 Bacteria 1604
106 Ga0097621_100343648 3300006237 Bacteria 1325
107 Ga0068871_100000996 3300006358 Bacteria 18967
108 Ga0068871_100030689 3300006358 Unclassified 4235
109 Ga0068871_100105749 3300006358 Bacteria 2362
110 Ga0068871_100132581 3300006358 Bacteria 2114
111 Ga0075428_100006280 3300006844 Bacteria 13210
112 Ga0075428_100011018 3300006844 Bacteria 10056
113 Ga0075428_100012016 3300006844 Bacteria 9634
114 Ga0075428_100016541 3300006844 Bacteria 8144
115 Ga0075428_100067840 3300006844 Bacteria 3903
116 Ga0075430_100001697 3300006846 Bacteria 17996
117 Ga0075431_100004422 3300006847 Bacteria 13779
118 Ga0075431_100170912 3300006847 Bacteria 2233
119 Ga0075433_10105617 3300006852 Bacteria 2495
120 Ga0075434_100027324 3300006871 Bacteria 5602
121 Ga0075434_100113682 3300006871 Bacteria 2719
122 Ga0075434_100225924 3300006871 Bacteria 1892
123 Ga0075429_100000393 3300006880 Bacteria 32106
124 Ga0068865_100001368 3300006881 Bacteria 14184
125 Ga0068865_100007789 3300006881 Bacteria 6605
126 Ga0068865_100036179 3300006881 Bacteria 3327
127 Ga0068865_100083136 3300006881 Bacteria 2304
128 Ga0097620_100055732 3300006931 Unclassified 3977
129 Ga0097620_100062163 3300006931 Bacteria 3764
130 Ga0097620_100114552 3300006931 Unclassified 2760
131 Ga0111539_10001398 3300009094 Bacteria 32123
132 Ga0111539_10006912 3300009094 Bacteria 14572
133 Ga0111539_10039503 3300009094 Bacteria 5687
134 Ga0111539_10075304 3300009094 Bacteria 3976
135 Ga0111539_10108695 3300009094 Bacteria 3255
136 Ga0111539_10263215 3300009094 Bacteria 2007
137 Ga0105245_10003041 3300009098 Bacteria 15027
138 Ga0114129_10069563 3300009147 Unclassified 4907
139 Ga0114129_10075618 3300009147 Bacteria 4689
140 Ga0114129_10160027 3300009147 Bacteria 3077
141 Ga0114129_10337845 3300009147 Bacteria 1998
142 Ga0105243_10005954 3300009148 Bacteria 9445
143 Ga0105243_10616997 3300009148 Unclassified 1046
144 Ga0105242_10000631 3300009176 Bacteria 27615
145 Ga0105242_10003328 3300009176 Bacteria 12495
146 Ga0105242_10047751 3300009176 Unclassified 3477
147 Ga0105242_10080122 3300009176 Bacteria 2729
148 Ga0105248_10002583 3300009177 Bacteria 20126
149 Ga0105248_10016711 3300009177 Bacteria 8079
150 Ga0105248_10089539 3300009177 Bacteria 3464
151 Ga0105248_10212792 3300009177 Bacteria 2178
152 Ga0105238_10011880 3300009551 Bacteria 8772
153 Ga0105249_10653430 3300009553 Unclassified 1109
154 Ga0105239_10057630 3300010375 Bacteria 4262
155 Ga0157371_10060539 3300013102 Bacteria 2684
156 Ga0157371_10070722 3300013102 Bacteria 2470
157 Ga0157370_10264441 3300013104 Bacteria 1589
158 Ga0157374_10110438 3300013296 Bacteria 2644
159 Ga0157378_10025335 3300013297 Bacteria 5224
160 Ga0157378_10188891 3300013297 Unclassified 1942
161 Ga0163162_10003128 3300013306 Bacteria 15810
162 Ga0163162_10008759 3300013306 Bacteria 9841
163 Ga0163162_10018524 3300013306 Bacteria 6823
164 Ga0163162_10191507 3300013306 Bacteria 2173
165 Ga0157375_10002923 3300013308 Bacteria 14815
166 Ga0157375_10030225 3300013308 Bacteria 5106
167 Ga0163163_10028553 3300014325 Bacteria 5359
168 Ga0163163_10045105 3300014325 Bacteria 4327
169 Ga0163163_10064351 3300014325 Bacteria 3639
170 Ga0163163_10278158 3300014325 Unclassified 1725
171 Ga0157380_10002634 3300014326 Bacteria 12153
172 Ga0157380_10034594 3300014326 Bacteria 3897
173 Ga0157380_10094080 3300014326 Bacteria 2479
174 Ga0157380_10272496 3300014326 Bacteria 1544
175 Ga0157380_10419974 3300014326 Unclassified 1275
176 Ga0157377_10026324 3300014745 Bacteria 3112
177 Ga0157377_10051677 3300014745 Bacteria 2319
178 Ga0157379_10010220 3300014968 Bacteria 8175
179 Ga0157379_10145302 3300014968 Unclassified 2139
180 Ga0157376_10014864 3300014969 Bacteria 5859
181 Ga0157376_10347429 3300014969 Unclassified 1418
182 Ga0207656_10106969 3300025321 Unclassified 1288
183 Ga0207642_10009396 3300025899 Bacteria 3399
184 Ga0207688_10016220 3300025901 Bacteria 4039
185 Ga0207685_10095733 3300025905 Bacteria 1260
186 Ga0207645_10002556 3300025907 Bacteria 14220
187 Ga0207645_10003053 3300025907 Bacteria 12870
188 Ga0207645_10043362 3300025907 Bacteria 2879
189 Ga0207643_10015662 3300025908 Bacteria 4129
190 Ga0207693_10174920 3300025915 Bacteria 1689
191 Ga0207662_10008459 3300025918 Bacteria 5634
192 Ga0207662_10052231 3300025918 Bacteria 2432
193 Ga0207649_10267552 3300025920 Bacteria 1237
194 Ga0207681_10017614 3300025923 Bacteria 4488
195 Ga0207681_10033915 3300025923 Bacteria 3352
196 Ga0207681_10049085 3300025923 Unclassified 2851
197 Ga0207681_10220423 3300025923 Bacteria 1467
198 Ga0207694_10043949 3300025924 Bacteria 3449
199 Ga0207650_10004577 3300025925 Bacteria 9458
200 Ga0207659_10007632 3300025926 Bacteria 6674
201 Ga0207659_10026184 3300025926 Unclassified 3932
202 Ga0207659_10061995 3300025926 Bacteria 2698
203 Ga0207659_10083109 3300025926 Unclassified 2373
204 Ga0207659_10165881 3300025926 Bacteria 1738
205 Ga0207687_10049371 3300025927 Bacteria 2926
206 Ga0207706_10001893 3300025933 Bacteria 20555
207 Ga0207706_10039530 3300025933 Bacteria 4183
208 Ga0207706_10464827 3300025933 Bacteria 1094
209 Ga0207686_10002659 3300025934 Bacteria 9689
210 Ga0207686_10030718 3300025934 Unclassified 3184
211 Ga0207670_10030812 3300025936 Bacteria 3429
212 Ga0207670_10053852 3300025936 Bacteria 2712
213 Ga0207670_10129161 3300025936 Bacteria 1848
214 Ga0207669_10000925 3300025937 Bacteria 12437
215 Ga0207704_10017719 3300025938 Bacteria 3701
216 Ga0207704_10073852 3300025938 Unclassified 2173
217 Ga0207704_10111698 3300025938 Bacteria 1849
218 Ga0207704_10237572 3300025938 Unclassified 1359
219 Ga0207691_10006551 3300025940 Bacteria 11243
220 Ga0207691_10009246 3300025940 Bacteria 9456
221 Ga0207691_10030269 3300025940 Bacteria 5060
222 Ga0207691_10087111 3300025940 Unclassified 2801
223 Ga0207691_10168348 3300025940 Unclassified 1920
224 Ga0207691_10252326 3300025940 Bacteria 1523
225 Ga0207711_10061984 3300025941 Bacteria 3225
226 Ga0207711_10406428 3300025941 Unclassified 1265
227 Ga0207689_10002978 3300025942 Bacteria 15626
228 Ga0207689_10006058 3300025942 Bacteria 10695
229 Ga0207689_10028861 3300025942 Unclassified 4638
230 Ga0207689_10048348 3300025942 Bacteria 3508
231 Ga0207689_10148150 3300025942 Bacteria 1934
232 Ga0207661_10332565 3300025944 Bacteria 1368
233 Ga0207679_10004159 3300025945 Bacteria 8991
234 Ga0207679_10005607 3300025945 Bacteria 7870
235 Ga0207651_10110416 3300025960 Unclassified 2063
236 Ga0207651_10118651 3300025960 Unclassified 2002
237 Ga0207651_10126199 3300025960 Bacteria 1950
238 Ga0207651_10395314 3300025960 Bacteria 1174
239 Ga0207668_10020521 3300025972 Unclassified 4200
240 Ga0207658_10090532 3300025986 Bacteria 2371
241 Ga0207677_10239693 3300026023 Unclassified 1466
242 Ga0207677_10268133 3300026023 Unclassified 1395
243 Ga0207703_10039915 3300026035 Bacteria 3754
244 Ga0207703_10161202 3300026035 Bacteria 1964
245 Ga0207703_10212500 3300026035 Bacteria 1726
246 Ga0207708_10003433 3300026075 Bacteria 11679
247 Ga0207708_10005529 3300026075 Bacteria 9324
248 Ga0207708_10049362 3300026075 Unclassified 3204
249 Ga0207708_10112889 3300026075 Unclassified 2111
250 Ga0207708_10214248 3300026075 Bacteria 1541
251 Ga0207641_10037499 3300026088 Bacteria 4049
252 Ga0207641_10111774 3300026088 Unclassified 2423
253 Ga0207641_10150628 3300026088 Bacteria 2106
254 Ga0207641_10188207 3300026088 Bacteria 1895
255 Ga0207641_10320388 3300026088 Bacteria 1470
256 Ga0207648_10006130 3300026089 Bacteria 11984
257 Ga0207648_10030327 3300026089 Bacteria 4790
258 Ga0207648_10043264 3300026089 Bacteria 3953
259 Ga0207648_10055468 3300026089 Unclassified 3459
260 Ga0207648_10181085 3300026089 Bacteria 1865
261 Ga0207676_10205735 3300026095 Bacteria 1742
262 Ga0207674_10341100 3300026116 Bacteria 1449
263 Ga0207675_100076435 3300026118 Bacteria 3136
264 Ga0207675_100080895 3300026118 Bacteria 3046
265 Ga0207675_100102516 3300026118 Unclassified 2696
266 Ga0207675_100361611 3300026118 Bacteria 1424
267 Ga0207683_10108004 3300026121 Unclassified 2490
268 Ga0207683_10151922 3300026121 Bacteria 2090
269 Ga0207683_10225134 3300026121 Bacteria 1710
270 Ga0207683_10295643 3300026121 Bacteria 1481
271 Ga0207698_10156622 3300026142 Bacteria 1986
272 Ga0209974_10028723 3300027876 Bacteria 1842
273 Ga0207428_10002364 3300027907 Bacteria 18839
274 Ga0207428_10019783 3300027907 Bacteria 5734
275 Ga0207428_10096224 3300027907 Bacteria 2293
276 Ga0268266_10051679 3300028379 Bacteria 3528
277 Ga0268266_10296649 3300028379 Bacteria 1507
278 Ga0268265_10051853 3300028380 Bacteria 3099
279 Ga0268265_10296040 3300028380 Bacteria 1455
280 Ga0268265_10475121 3300028380 Bacteria 1173
281 Ga0307408_100025340 3300031548 Bacteria 4062
282 Ga0307405_10001680 3300031731 Bacteria 9431
283 Ga0307413_10234320 3300031824 Unclassified 1350
284 Ga0307407_10033545 3300031903 Unclassified 2802
285 Ga0307412_10111388 3300031911 Bacteria 1955
286 Ga0307409_100115375 3300031995 Bacteria 2261
287 Ga0307416_100005332 3300032002 Bacteria 7883
288 Ga0307416_100505199 3300032002 Bacteria 1274
289 Ga0307411_10010121 3300032005 Bacteria 5007
290 Ga0307411_10226810 3300032005 Unclassified 1453
291 Ga0307415_100074051 3300032126 Bacteria 2405
292 Ga0373957_0066002 3300035120 Bacteria 1409
293 Ga0373943_0014125 3300035170 Bacteria 3611
294 Ga0373946_0006003 3300035171 Bacteria 4407
295 Ga0373955_0050609 3300035172 Bacteria 2260
296 Ga0373924_0002776 3300035410 Bacteria 5909
297 Ga0373935_0004844 3300035692 Bacteria 7912
298 Ga0373933_0271326 3300035724 Bacteria 1095
299 Ga0373947_0008481 3300035725 Bacteria 5919
300 Ga0373937_0089783 3300036401 Bacteria 2846
301 Ga0373925_0010592 3300037068 Bacteria 6687
302 Ga0436365_0776017 3300039437 Bacteria 1783
303 Ga0451807_0145880 3300041486 Bacteria 1022
304 Ga0451853_1490853 3300041512 Bacteria 1788
305 Ga0439450_011127 3300042008 Bacteria 1753
306 Ga0450923_011609 3300042125 Unclassified 1587
307 Ga0450908_007317 3300042184 Unclassified 2082
308 Ga0495603_0045228 3300046455 Unclassified 2626
309 Ga0495580_0070976 3300046472 Unclassified 2433
310 Ga0495608_0109374 3300046511 Unclassified 1777
311 Ga0495628_0025807 3300046516 Bacteria 4798
312 Ga0495630_0142008 3300046517 Bacteria 1826
313 Ga0495630_0281330 3300046517 Bacteria 1271
314 Ga0495643_0000608 3300046522 Bacteria 43082
315 Ga0495652_0069264 3300046529 Bacteria 2954
316 Ga0495586_0023122 3300046535 Bacteria 3319
317 Ga0495587_0058229 3300046536 Bacteria 2270
318 Ga0495598_0012336 3300046537 Bacteria 2095
319 Ga0495645_0033279 3300046543 Bacteria 3760
320 Ga0495667_0036513 3300046559 Bacteria 3280
321 Ga0495634_0177260 3300046642 Unclassified 1337
322 Ga0495634_0177506 3300046642 Bacteria 1335
323 Ga0495634_0180142 3300046642 Bacteria 1323
324 Ga0495599_0131753 3300046678 Bacteria 1553
325 Ga0495658_0073454 3300046683 Unclassified 1991
326 Ga0495658_0201952 3300046683 Bacteria 1239
327 Ga0495613_0004099 3300046689 Bacteria 10893
328 Ga0495613_0235038 3300046689 Bacteria 1283
329 Ga0495670_0075819 3300046691 Bacteria 1708
330 Ga0495600_0017588 3300046809 Bacteria 4550
331 Ga0495581_0064918 3300047315 Bacteria 2110
332 Ga0495684_0000089 3300047471 Bacteria 64693
333 Ga0496100_0048167 3300048903 Bacteria 2750
334 Ga0496101_0000588 3300048904 Bacteria 22146
335 Ga0496104_0019783 3300048907 Bacteria 6164
336 Ga0496104_0142594 3300048907 Bacteria 2302
337 Ga0496105_0204932 3300048908 Bacteria 1609
338 Ga0496106_0050909 3300048909 Bacteria 3122
339 Ga0496106_0430672 3300048909 Unclassified 1060
340 Ga0496107_0016162 3300048910 Bacteria 5237
341 Ga0496114_0000328 3300048917 Bacteria 34453
342 Ga0496114_0003823 3300048917 Bacteria 11614
343 Ga0501033_0055487 3300049570 Bacteria 2929
344 Ga0501033_0154979 3300049570 Bacteria 1651
345 Ga0501036_0014691 3300049572 Bacteria 6527
346 Ga0501038_0023985 3300049574 Bacteria 5447
347 Ga0501039_0040880 3300049575 Bacteria 3579
348 Ga0501039_0163630 3300049575 Bacteria 1749
349 Ga0501040_0003484 3300049576 Bacteria 10161
350 Ga0501041_0006500 3300049577 Bacteria 6842
351 Ga0501041_0104731 3300049577 Bacteria 1753
352 Ga0501042_0001045 3300049578 Bacteria 15790
353 Ga0501042_0112360 3300049578 Bacteria 1962
354 Ga0501042_0146231 3300049578 Unclassified 1704
355 Ga0501042_0305343 3300049578 Bacteria 1150
356 Ga0501046_0042244 3300049580 Bacteria 3635
357 Ga0501046_0246476 3300049580 Bacteria 1316
358 Ga0501048_0020589 3300049582 Bacteria 4834
359 Ga0501072_0063787 3300049588 Bacteria 2906
360 Ga0501072_0067410 3300049588 Unclassified 2824
361 Ga0501072_0129964 3300049588 Bacteria 2007
362 Ga0501074_0122724 3300049590 Bacteria 1858
363 Ga0501074_0134392 3300049590 Bacteria 1769
364 Ga0501075_0001668 3300049591 Bacteria 14557
365 Ga0501075_0004775 3300049591 Bacteria 9212
366 Ga0501075_0200803 3300049591 Bacteria 1521
367 Ga0501076_0002656 3300049592 Bacteria 12336
368 Ga0501079_0000794 3300049741 Bacteria 21509
369 Ga0501081_0004582 3300049743 Bacteria 8877
370 Ga0501083_0047937 3300049744 Unclassified 2885
371 Ga0501045_0040986 3300049824 Bacteria 3368
372 nmdc:mga05p37_130774_c1 3300050507 Unclassified 3080
373 nmdc:mga05p37_509018_c1 3300050507 Unclassified 1380
374 nmdc:mga05p37_51512_c1 3300050507 Bacteria 5062
375 nmdc:mga09592_15363_c1 3300050508 Bacteria 6252
376 nmdc:mga09592_2991_c1 3300050508 Bacteria 13698
377 nmdc:mga0qj67_149875_c1 3300050509 Bacteria 1892
378 nmdc:mga0qj67_66545_c1 3300050509 Bacteria 2870
379 nmdc:mga06r32_129036_c1 3300050510 Bacteria 2498
380 nmdc:mga06r32_165263_c1 3300050510 Bacteria 2196
381 nmdc:mga06r32_18527_c1 3300050510 Bacteria 6376
382 nmdc:mga06r32_62679_c1 3300050510 Bacteria 3582
383 nmdc:mga08y16_166709_c1 3300050511 Bacteria 2288
384 nmdc:mga08y16_2930_c1 3300050511 Bacteria 17570
385 nmdc:mga08y16_416408_c1 3300050511 Bacteria 1374
386 nmdc:mga08y16_491119_c1 3300050511 Bacteria 1248
387 nmdc:mga0n895_224024_c1 3300050512 Bacteria 1909
388 nmdc:mga0n895_3565_c1 3300050512 Bacteria 12591
389 nmdc:mga0rr50_35555_c1 3300050513 Bacteria 3579
390 nmdc:mga0a205_27646_c1 3300050515 Bacteria 5417
391 nmdc:mga0a205_4225_c1 3300050515 Bacteria 12887
392 nmdc:mga0a205_57552_c1 3300050515 Bacteria 3753
393 Ga0495601_0040008 3300053077 Bacteria 2936
394 Ga0495601_0061039 3300053077 Unclassified 2393
395 Ga0495601_0177413 3300053077 Unclassified 1393
396 Ga0495619_0001749 3300053085 Bacteria 14432
397 Ga0501084_0016086 3300054114 Bacteria 6211
398 Ga0501084_0052085 3300054114 Bacteria 3425
399 Ga0501082_0002781 3300060353 Bacteria 15272
400 Ga0530510_0002013 3300061734 Bacteria 13947
401 Ga0530510_0018990 3300061734 Unclassified 4876
402 Ga0068858_100258897
403 JGI24746J21847_1001790
404 JGI25406J46586_10004130
405 JGI25406J46586_10036292
406 Ga0065712_10010592
407 Ga0065712_10068685
408 Ga0065707_10107058
409 Ga0065707_10168179
410 Ga0070658_10303659
411 Ga0070676_10020202
412 Ga0070690_100011820
413 Ga0070690_100018836
414 Ga0070670_100010669
415 Ga0070670_100011010
416 Ga0070670_100026356
417 Ga0070670_100106993
418 Ga0070670_100182909
419 Ga0070677_10070775
420 Ga0068869_100011709
421 Ga0068869_100015078
422 Ga0068869_100101367
423 Ga0070666_10029251
424 Ga0070666_10046670
425 Ga0068868_100015352
426 Ga0068868_100067372
427 Ga0070689_100121384
428 Ga0070661_100018476
429 Ga0070668_100105513
430 Ga0070668_100120949
431 Ga0070669_100005575
432 Ga0070669_100050941
433 Ga0070669_100083774
434 Ga0070669_100107230
435 Ga0070675_100006859
436 Ga0070675_100022523
437 Ga0070675_100031824
438 Ga0070675_100040739
439 Ga0070675_100044047
440 Ga0070675_100051266
441 Ga0070675_100057620
442 Ga0070675_100058943
443 Ga0070675_100070382
444 Ga0070671_100017198
445 Ga0070674_100000136
446 Ga0070674_100010599
447 Ga0070674_100377011
448 Ga0070673_100110224
449 Ga0070673_100125865
450 Ga0070688_100030464
451 Ga0070688_100043069
452 Ga0070688_100284374
453 Ga0070667_100054459
454 Ga0070714_100193332
455 Ga0070701_10020983
456 Ga0070700_100006102
457 Ga0070694_100047970
458 Ga0070678_100119723
459 Ga0070678_100184628
460 Ga0070678_100251708
461 Ga0070678_100335956
462 Ga0068867_100028401
463 Ga0068867_100064109
464 Ga0070685_10054633
465 Ga0070685_10122460
466 Ga0070672_100048980
467 Ga0070672_100068116
468 Ga0070672_100093698
469 Ga0070672_100481324
470 Ga0070686_100050634
471 Ga0070686_100328280
472 Ga0070665_100010962
473 Ga0070665_100017920
474 Ga0070704_100015629
475 Ga0070664_100014829
476 Ga0068854_100084401
477 Ga0068856_100227430
478 Ga0068856_100377420
479 Ga0070702_100101372
480 Ga0070702_100194767
481 Ga0068859_100055725
482 Ga0068859_100062166
483 Ga0068859_100114556
484 Ga0068864_100020898
485 Ga0068861_100017124
486 Ga0068861_100181466
487 Ga0068861_100213588
488 Ga0068851_10007555
489 Ga0068870_10005245
490 Ga0068870_10066849
491 Ga0068863_100160940
492 Ga0068863_100179238
493 Ga0068863_100330510
494 Ga0068858_100007179
495 Ga0068858_100041910
496 Ga0068862_100015297
497 Ga0068862_100080103
498 Ga0081539_10000017
499 Ga0081539_10003210
500 Ga0097621_100001289
501 Ga0097621_100009382
502 Ga0097621_100033488
503 Ga0097621_100037166
504 Ga0097621_100063179
505 Ga0097621_100155258
506 Ga0097621_100234141
507 Ga0097621_100343648
508 Ga0068871_100000996
509 Ga0068871_100030689
510 Ga0068871_100105749
511 Ga0068871_100132581
512 Ga0075428_100006280
513 Ga0075428_100011018
514 Ga0075428_100012016
515 Ga0075428_100016541
516 Ga0075428_100067840
517 Ga0075430_100001697
518 Ga0075431_100004422
519 Ga0075431_100170912
520 Ga0075433_10105617
521 Ga0075434_100027324
522 Ga0075434_100113682
523 Ga0075434_100225924
524 Ga0075429_100000393
525 Ga0068865_100001368
526 Ga0068865_100007789
527 Ga0068865_100036179
528 Ga0068865_100083136
529 Ga0097620_100055732
530 Ga0097620_100062163
531 Ga0097620_100114552
532 Ga0111539_10001398
533 Ga0111539_10006912
534 Ga0111539_10039503
535 Ga0111539_10075304
536 Ga0111539_10108695
537 Ga0111539_10263215
538 Ga0105245_10003041
539 Ga0114129_10069563
540 Ga0114129_10075618
541 Ga0114129_10160027
542 Ga0114129_10337845
543 Ga0105243_10005954
544 Ga0105243_10616997
545 Ga0105242_10000631
546 Ga0105242_10003328
547 Ga0105242_10047751
548 Ga0105242_10080122
549 Ga0105248_10002583
550 Ga0105248_10016711
551 Ga0105248_10089539
552 Ga0105248_10212792
553 Ga0105238_10011880
554 Ga0105249_10653430
555 Ga0105239_10057630
556 Ga0157371_10060539
557 Ga0157371_10070722
558 Ga0157370_10264441
559 Ga0157374_10110438
560 Ga0157378_10025335
561 Ga0157378_10188891
562 Ga0163162_10003128
563 Ga0163162_10008759
564 Ga0163162_10018524
565 Ga0163162_10191507
566 Ga0157375_10002923
567 Ga0157375_10030225
568 Ga0163163_10028553
569 Ga0163163_10045105
570 Ga0163163_10064351
571 Ga0163163_10278158
572 Ga0157380_10002634
573 Ga0157380_10034594
574 Ga0157380_10094080
575 Ga0157380_10272496
576 Ga0157380_10419974
577 Ga0157377_10026324
578 Ga0157377_10051677
579 Ga0157379_10010220
580 Ga0157379_10145302
581 Ga0157376_10014864
582 Ga0157376_10347429
583 Ga0207656_10106969
584 Ga0207642_10009396
585 Ga0207688_10016220
586 Ga0207685_10095733
587 Ga0207645_10002556
588 Ga0207645_10003053
589 Ga0207645_10043362
590 Ga0207643_10015662
591 Ga0207693_10174920
592 Ga0207662_10008459
593 Ga0207662_10052231
594 Ga0207649_10267552
595 Ga0207681_10017614
596 Ga0207681_10033915
597 Ga0207681_10049085
598 Ga0207681_10220423
599 Ga0207694_10043949
600 Ga0207650_10004577
601 Ga0207659_10007632
602 Ga0207659_10026184
603 Ga0207659_10061995
604 Ga0207659_10083109
605 Ga0207659_10165881
606 Ga0207687_10049371
607 Ga0207706_10001893
608 Ga0207706_10039530
609 Ga0207706_10464827
610 Ga0207686_10002659
611 Ga0207686_10030718
612 Ga0207670_10030812
613 Ga0207670_10053852
614 Ga0207670_10129161
615 Ga0207669_10000925
616 Ga0207704_10017719
617 Ga0207704_10073852
618 Ga0207704_10111698
619 Ga0207704_10237572
620 Ga0207691_10006551
621 Ga0207691_10009246
622 Ga0207691_10030269
623 Ga0207691_10087111
624 Ga0207691_10168348
625 Ga0207691_10252326
626 Ga0207711_10061984
627 Ga0207711_10406428
628 Ga0207689_10002978
629 Ga0207689_10006058
630 Ga0207689_10028861
631 Ga0207689_10048348
632 Ga0207689_10148150
633 Ga0207661_10332565
634 Ga0207679_10004159
635 Ga0207679_10005607
636 Ga0207651_10110416
637 Ga0207651_10118651
638 Ga0207651_10126199
639 Ga0207651_10395314
640 Ga0207668_10020521
641 Ga0207658_10090532
642 Ga0207677_10239693
643 Ga0207677_10268133
644 Ga0207703_10039915
645 Ga0207703_10161202
646 Ga0207703_10212500
647 Ga0207708_10003433
648 Ga0207708_10005529
649 Ga0207708_10049362
650 Ga0207708_10112889
651 Ga0207708_10214248
652 Ga0207641_10037499
653 Ga0207641_10111774
654 Ga0207641_10150628
655 Ga0207641_10188207
656 Ga0207641_10320388
657 Ga0207648_10006130
658 Ga0207648_10030327
659 Ga0207648_10043264
660 Ga0207648_10055468
661 Ga0207648_10181085
662 Ga0207676_10205735
663 Ga0207674_10341100
664 Ga0207675_100076435
665 Ga0207675_100080895
666 Ga0207675_100102516
667 Ga0207675_100361611
668 Ga0207683_10108004
669 Ga0207683_10151922
670 Ga0207683_10225134
671 Ga0207683_10295643
672 Ga0207698_10156622
673 Ga0209974_10028723
674 Ga0207428_10002364
675 Ga0207428_10019783
676 Ga0207428_10096224
677 Ga0268266_10051679
678 Ga0268266_10296649
679 Ga0268265_10051853
680 Ga0268265_10296040
681 Ga0268265_10475121
682 Ga0307408_100025340
683 Ga0307405_10001680
684 Ga0307413_10234320
685 Ga0307407_10033545
686 Ga0307412_10111388
687 Ga0307409_100115375
688 Ga0307416_100005332
689 Ga0307416_100505199
690 Ga0307411_10010121
691 Ga0307411_10226810
692 Ga0307415_100074051
693 Ga0373957_0066002
694 Ga0373943_0014125
695 Ga0373946_0006003
696 Ga0373955_0050609
697 Ga0373924_0002776
698 Ga0373935_0004844
699 Ga0373933_0271326
700 Ga0373947_0008481
701 Ga0373937_0089783
702 Ga0373925_0010592
703 Ga0436365_0776017
704 Ga0451807_0145880
705 Ga0451853_1490853
706 Ga0439450_011127
707 Ga0450923_011609
708 Ga0450908_007317
709 Ga0495603_0045228
710 Ga0495580_0070976
711 Ga0495608_0109374
712 Ga0495628_0025807
713 Ga0495630_0142008
714 Ga0495630_0281330
715 Ga0495643_0000608
716 Ga0495652_0069264
717 Ga0495586_0023122
718 Ga0495587_0058229
719 Ga0495598_0012336
720 Ga0495645_0033279
721 Ga0495667_0036513
722 Ga0495634_0177260
723 Ga0495634_0177506
724 Ga0495634_0180142
725 Ga0495599_0131753
726 Ga0495658_0073454
727 Ga0495658_0201952
728 Ga0495613_0004099
729 Ga0495613_0235038
730 Ga0495670_0075819
731 Ga0495600_0017588
732 Ga0495581_0064918
733 Ga0495684_0000089
734 Ga0496100_0048167
735 Ga0496101_0000588
736 Ga0496104_0019783
737 Ga0496104_0142594
738 Ga0496105_0204932
739 Ga0496106_0050909
740 Ga0496106_0430672
741 Ga0496107_0016162
742 Ga0496114_0000328
743 Ga0496114_0003823
744 Ga0501033_0055487
745 Ga0501033_0154979
746 Ga0501036_0014691
747 Ga0501038_0023985
748 Ga0501039_0040880
749 Ga0501039_0163630
750 Ga0501040_0003484
751 Ga0501041_0006500
752 Ga0501041_0104731
753 Ga0501042_0001045
754 Ga0501042_0112360
755 Ga0501042_0146231
756 Ga0501042_0305343
757 Ga0501046_0042244
758 Ga0501046_0246476
759 Ga0501048_0020589
760 Ga0501072_0063787
761 Ga0501072_0067410
762 Ga0501072_0129964
763 Ga0501074_0122724
764 Ga0501074_0134392
765 Ga0501075_0001668
766 Ga0501075_0004775
767 Ga0501075_0200803
768 Ga0501076_0002656
769 Ga0501079_0000794
770 Ga0501081_0004582
771 Ga0501083_0047937
772 Ga0501045_0040986
773 nmdc:mga05p37_130774_c1
774 nmdc:mga05p37_509018_c1
775 nmdc:mga05p37_51512_c1
776 nmdc:mga09592_15363_c1
777 nmdc:mga09592_2991_c1
778 nmdc:mga0qj67_149875_c1
779 nmdc:mga0qj67_66545_c1
780 nmdc:mga06r32_129036_c1
781 nmdc:mga06r32_165263_c1
782 nmdc:mga06r32_18527_c1
783 nmdc:mga06r32_62679_c1
784 nmdc:mga08y16_166709_c1
785 nmdc:mga08y16_2930_c1
786 nmdc:mga08y16_416408_c1
787 nmdc:mga08y16_491119_c1
788 nmdc:mga0n895_224024_c1
789 nmdc:mga0n895_3565_c1
790 nmdc:mga0rr50_35555_c1
791 nmdc:mga0a205_27646_c1
792 nmdc:mga0a205_4225_c1
793 nmdc:mga0a205_57552_c1
794 Ga0495601_0040008
795 Ga0495601_0061039
796 Ga0495601_0177413
797 Ga0495619_0001749
798 Ga0501084_0016086
799 Ga0501084_0052085
800 Ga0501082_0002781
801 Ga0530510_0002013
802 Ga0530510_0018990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i1r-assembly1.cif.gz_A-2 human malt1 (caspase-ig3) in complex with thioridazine 0.7688 257 279
6xux-assembly1.cif.gz_A crystal structure of megabody mb-nb207-cygjk_no 0.7466 231 280
5ca3-assembly1.cif.gz_A crystal structure of the glycosynthase mutant d324n of escherichia coli gh63 glycosidase in complex with glucose and lactose 0.7446 231 280
8t7z-assembly1.cif.gz_F crystal structure of alpha-glucosidase (yici) from klebsiella aerogenes 0.7342 233 279
1we5-assembly1.cif.gz_B crystal structure of alpha-xylosidase from escherichia coli 0.73 233 279
ID Description Score Start End Superfamily
af_A0A0R0JB42_286_384_2.60.40.1170 Mainly Beta;Sandwich;Immunoglobulin-like;Mu homology domain, subdomain B 0.9163 258 280 2.60.40.1170
5cn1C00 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.8057 258 280 2.60.40.1230
2czrA01 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1;TBP-interacting protein, N-terminal domain 0.7954 189 213 3.40.1350.70
af_E9PTR6_25_177_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7605 259 307 2.40.128.20
af_Q9UMX2_89_224_3.40.630.60 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase; 0.7514 235 280 3.40.630.60
ID Description Score Start End GO Terms
AF-A0A382ZM17-F1-model_v4 YkuD domain-containing protein 0.9104 189 297
AF-A0A2V8EJY4-F1-model_v4 Uncharacterized protein 0.8941 187 299
AF-A0A2V8KPN4-F1-model_v4 Uncharacterized protein 0.8778 209 300
AF-A0A2V8L7Y4-F1-model_v4 DUF2169 domain-containing protein 0.8755 189 300
AF-A0A2V8I4L1-F1-model_v4 Uncharacterized protein 0.873 184 296

Map