F434786

General Info

Members Datasets Scaffolds Average Seq Length
401 172 802 262

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100338610|Ga0070684_1003386101
Length 289
Sequence MRPSISSTVDMKGCGLMSATSAEQLREEVRRRYAESARAVTEGSSCGCGSGSCCDGETDAAKFGEALYDADQRGQLPKKAALASLGCGNPTAVAEIRAGETVLDLGSGGGIDVILSAKRVGETGYAFGLDMTDEMLALARRNAHEAGVRNAIFLKGVIEEVPLPAGSVDVVISNCVINLSVDKPAVLAEISRVLKPGGRIGISDVVAEDRLSAADRTERGNFVGCIAGALSKGEYEAGLEAAGFEQISVEFTHEVAEGMHGAIVKAVKTSAPERMGLPVIQPASAAGCC

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
36 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
74 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
81 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
105 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
106 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
107 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
108 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
109 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.48
Rhizosphere 91.27
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100338610 3300005535 Bacteria 1383
2 ARcpr5oldR_c001257 3300000041 Unclassified 2587
3 JGI25407J50210_10005117 3300003373 Bacteria 3215
4 Ga0070683_100045162 3300005329 Bacteria 4066
5 Ga0070683_100378478 3300005329 Bacteria 1349
6 Ga0070690_100148994 3300005330 Bacteria 1595
7 Ga0070680_100190568 3300005336 Bacteria 1727
8 Ga0070689_100196821 3300005340 Bacteria 1643
9 Ga0070692_10105557 3300005345 Bacteria 1551
10 Ga0070668_100025176 3300005347 Bacteria 4511
11 Ga0070674_100037448 3300005356 Bacteria 3262
12 Ga0070659_100673850 3300005366 Bacteria 893
13 Ga0070711_100026847 3300005439 Bacteria 3776
14 Ga0070681_10090474 3300005458 Bacteria 3011
15 Ga0068867_100183128 3300005459 Bacteria 1666
16 Ga0070679_100125704 3300005530 Bacteria 2547
17 Ga0070679_100397704 3300005530 Bacteria 1324
18 Ga0070684_100005993 3300005535 Bacteria 9364
19 Ga0070686_100138104 3300005544 Bacteria 1693
20 Ga0068855_100400281 3300005563 Bacteria 1505
21 Ga0070664_100180328 3300005564 Bacteria 1877
22 Ga0068857_100430635 3300005577 Bacteria 1231
23 Ga0068856_100067924 3300005614 Bacteria 3523
24 Ga0068852_100039795 3300005616 Bacteria 3961
25 Ga0068852_100212216 3300005616 Bacteria 1837
26 Ga0068852_100281615 3300005616 Bacteria 1603
27 Ga0081455_10010841 3300005937 Bacteria 9204
28 Ga0081455_10011273 3300005937 Bacteria 8996
29 Ga0081455_10287786 3300005937 Bacteria 1184
30 Ga0081538_10000012 3300005981 Bacteria 153046
31 Ga0081538_10001043 3300005981 Bacteria 29559
32 Ga0081538_10002956 3300005981 Bacteria 16226
33 Ga0081538_10004384 3300005981 Bacteria 13031
34 Ga0081538_10028183 3300005981 Bacteria 3871
35 Ga0081538_10035796 3300005981 Bacteria 3254
36 Ga0081538_10106340 3300005981 Bacteria 1393
37 Ga0070712_100005875 3300006175 Bacteria 7599
38 Ga0068871_100283168 3300006358 Bacteria 1451
39 Ga0075433_10286900 3300006852 Bacteria 1458
40 Ga0105240_10068455 3300009093 Bacteria 4396
41 Ga0105240_10284397 3300009093 Bacteria 1898
42 Ga0111539_10496308 3300009094 Bacteria 1422
43 Ga0105245_10004034 3300009098 Bacteria 13061
44 Ga0105245_10064633 3300009098 Bacteria 3307
45 Ga0105245_10079728 3300009098 Bacteria 2990
46 Ga0114129_10651480 3300009147 Bacteria 1359
47 Ga0114129_10810692 3300009147 Bacteria 1193
48 Ga0105243_10073298 3300009148 Bacteria 2774
49 Ga0105242_10093329 3300009176 Bacteria 2537
50 Ga0105238_10420543 3300009551 Bacteria 1331
51 Ga0105239_10274550 3300010375 Bacteria 1896
52 Ga0105239_10434868 3300010375 Bacteria 1487
53 Ga0157318_1002346 3300012482 Bacteria 1025
54 Ga0157338_1002955 3300012515 Bacteria 1375
55 Ga0157371_10300512 3300013102 Bacteria 1162
56 Ga0157370_10119356 3300013104 Bacteria 2462
57 Ga0157369_10014808 3300013105 Bacteria 8800
58 Ga0157374_10256885 3300013296 Bacteria 1720
59 Ga0157378_10019831 3300013297 Bacteria 5911
60 Ga0163162_10681985 3300013306 Bacteria 1150
61 Ga0163162_10772949 3300013306 Bacteria 1079
62 Ga0157375_10066837 3300013308 Bacteria 3590
63 Ga0157375_10391050 3300013308 Bacteria 1557
64 Ga0157377_10415591 3300014745 Bacteria 920
65 Ga0157379_10211746 3300014968 Bacteria 1755
66 Ga0157379_10397687 3300014968 Bacteria 1266
67 Ga0206354_10530740 3300020081 Bacteria 2729
68 Ga0206353_10707770 3300020082 Bacteria 7881
69 Ga0207695_10339154 3300025913 Bacteria 1391
70 Ga0207695_10410959 3300025913 Bacteria 1238
71 Ga0207693_10059882 3300025915 Bacteria 2983
72 Ga0207693_10418184 3300025915 Bacteria 1048
73 Ga0207663_10006320 3300025916 Bacteria 6050
74 Ga0207660_10177625 3300025917 Bacteria 1652
75 Ga0207652_10122122 3300025921 Bacteria 2318
76 Ga0207681_10259600 3300025923 Bacteria 1360
77 Ga0207687_10002673 3300025927 Bacteria 12065
78 Ga0207687_10064351 3300025927 Bacteria 2600
79 Ga0207706_10056753 3300025933 Bacteria 3452
80 Ga0207686_10022369 3300025934 Bacteria 3641
81 Ga0207709_10540459 3300025935 Bacteria 915
82 Ga0207670_10142514 3300025936 Bacteria 1769
83 Ga0207669_10018115 3300025937 Bacteria 3631
84 Ga0207704_10178131 3300025938 Bacteria 1533
85 Ga0207661_10010979 3300025944 Bacteria 6542
86 Ga0207661_10608482 3300025944 Bacteria 1003
87 Ga0207679_10158411 3300025945 Bacteria 1851
88 Ga0207658_10015418 3300025986 Bacteria 5243
89 Ga0207677_10080014 3300026023 Bacteria 2339
90 Ga0207639_10258944 3300026041 Bacteria 1521
91 Ga0207708_10097912 3300026075 Bacteria 2267
92 Ga0207648_10006781 3300026089 Bacteria 11355
93 Ga0207648_10412281 3300026089 Bacteria 1225
94 Ga0207674_10081688 3300026116 Bacteria 3234
95 Ga0207675_100095814 3300026118 Bacteria 2793
96 Ga0207683_10489737 3300026121 Bacteria 1135
97 Ga0207698_10152150 3300026142 Bacteria 2010
98 Ga0209966_1012989 3300027695 Bacteria 1535
99 Ga0265326_10003913 3300028558 Bacteria 4833
100 Ga0265319_1000776 3300028563 Bacteria 20769
101 Ga0265319_1006609 3300028563 Bacteria 5349
102 Ga0265334_10009217 3300028573 Bacteria 4180
103 Ga0265318_10000633 3300028577 Bacteria 24181
104 Ga0265318_10001338 3300028577 Bacteria 14731
105 Ga0265336_10003217 3300028666 Bacteria 6477
106 Ga0265338_10026550 3300028800 Bacteria 5836
107 Ga0265338_10031813 3300028800 Bacteria 5163
108 Ga0265330_10002570 3300031235 Bacteria 9854
109 Ga0265330_10038564 3300031235 Bacteria 2124
110 Ga0265328_10007941 3300031239 Bacteria 4404
111 Ga0265320_10011297 3300031240 Bacteria 5261
112 Ga0265320_10024306 3300031240 Bacteria 3207
113 Ga0265325_10006204 3300031241 Bacteria 7288
114 Ga0265325_10031642 3300031241 Bacteria 2830
115 Ga0265340_10011167 3300031247 Bacteria 4783
116 Ga0265339_10018734 3300031249 Bacteria 4076
117 Ga0265331_10008506 3300031250 Bacteria 5834
118 Ga0265327_10027647 3300031251 Bacteria 3259
119 Ga0265327_10046501 3300031251 Bacteria 2296
120 Ga0265327_10096074 3300031251 Bacteria 1437
121 Ga0265316_10023644 3300031344 Bacteria 5159
122 Ga0265316_10042775 3300031344 Bacteria 3617
123 Ga0307408_100035597 3300031548 Bacteria 3495
124 Ga0265313_10019544 3300031595 Bacteria 3764
125 Ga0265314_10040694 3300031711 Bacteria 3333
126 Ga0265314_10054653 3300031711 Bacteria 2762
127 Ga0265342_10022749 3300031712 Bacteria 3980
128 Ga0265342_10041258 3300031712 Bacteria 2795
129 Ga0307410_10201712 3300031852 Bacteria 1519
130 Ga0307406_10439807 3300031901 Bacteria 1043
131 Ga0307412_10063419 3300031911 Bacteria 2493
132 Ga0307409_100026122 3300031995 Bacteria 4113
133 Ga0307416_100007838 3300032002 Bacteria 6826
134 Ga0307415_100041496 3300032126 Bacteria 3055
135 Ga0307415_100085392 3300032126 Bacteria 2268
136 Ga0307415_100192995 3300032126 Bacteria 1609
137 Ga0373937_0075073 3300036401 Bacteria 3121
138 Ga0395899_0003425 3300037312 Bacteria 12578
139 Ga0395899_0156153 3300037312 Bacteria 1614
140 Ga0395899_0383550 3300037312 Bacteria 933
141 Ga0395900_0002825 3300037418 Bacteria 18951
142 Ga0395900_0005153 3300037418 Bacteria 13730
143 Ga0395900_0013813 3300037418 Bacteria 8241
144 Ga0395900_0028102 3300037418 Bacteria 5759
145 Ga0395900_0111900 3300037418 Bacteria 2804
146 Ga0395900_0219963 3300037418 Bacteria 1914
147 Ga0395900_0606606 3300037418 Bacteria 1034
148 Ga0395898_0007620 3300037466 Bacteria 11491
149 Ga0395898_0048309 3300037466 Bacteria 4174
150 Ga0395898_0069010 3300037466 Bacteria 3420
151 Ga0395898_0074567 3300037466 Bacteria 3277
152 Ga0395898_0075856 3300037466 Bacteria 3247
153 Ga0395898_0097504 3300037466 Bacteria 2823
154 Ga0395898_0189575 3300037466 Bacteria 1965
155 Ga0395898_0191716 3300037466 Bacteria 1953
156 Ga0395898_0385396 3300037466 Bacteria 1337
157 Ga0395905_0009455 3300037471 Bacteria 9524
158 Ga0395905_0016463 3300037471 Bacteria 7028
159 Ga0395905_0028230 3300037471 Bacteria 5290
160 Ga0395905_0033401 3300037471 Bacteria 4833
161 Ga0395905_0112525 3300037471 Bacteria 2557
162 Ga0395901_0000478 3300038443 Bacteria 46475
163 Ga0395901_0005803 3300038443 Bacteria 12505
164 Ga0395901_0007388 3300038443 Bacteria 11088
165 Ga0395901_0065147 3300038443 Bacteria 3793
166 Ga0395901_0090751 3300038443 Bacteria 3198
167 Ga0395901_0349095 3300038443 Bacteria 1527
168 Ga0395901_0710051 3300038443 Bacteria 1002
169 Ga0439461_0040392 3300041410 Bacteria 1006
170 Ga0451839_0893534 3300041496 Bacteria 896
171 Ga0439448_0023597 3300042005 Bacteria 1920
172 Ga0450920_011126 3300042122 Bacteria 1674
173 Ga0450908_016474 3300042184 Bacteria 1318
174 Ga0439460_0055509 3300042461 Bacteria 1198
175 Ga0466966_0304091 3300044684 Bacteria 958
176 Ga0466961_0146428 3300044693 Bacteria 1477
177 Ga0466963_0205923 3300044694 Bacteria 1376
178 Ga0466968_0036014 3300044735 Bacteria 2072
179 Ga0466968_0038278 3300044735 Bacteria 2015
180 Ga0451576_0226236 3300045051 Bacteria 1953
181 Ga0466967_0152386 3300045976 Bacteria 2162
182 Ga0466967_0252787 3300045976 Bacteria 1684
183 Ga0466967_0268506 3300045976 Bacteria 1634
184 Ga0495603_0011712 3300046455 Bacteria 5308
185 Ga0495582_0030432 3300046473 Bacteria 2964
186 Ga0495594_0217695 3300046499 Bacteria 1089
187 Ga0496100_0021862 3300048903 Bacteria 3860
188 Ga0496100_0257199 3300048903 Bacteria 1294
189 Ga0496101_0000368 3300048904 Bacteria 29928
190 Ga0496102_0002182 3300048905 Bacteria 16809
191 Ga0496102_0169781 3300048905 Bacteria 2054
192 Ga0496102_0204181 3300048905 Bacteria 1863
193 Ga0496102_0289426 3300048905 Bacteria 1544
194 Ga0496103_0002604 3300048906 Bacteria 11299
195 Ga0496104_0003277 3300048907 Bacteria 13964
196 Ga0496104_0114778 3300048907 Bacteria 2583
197 Ga0496104_0162039 3300048907 Bacteria 2145
198 Ga0496105_0005803 3300048908 Bacteria 9414
199 Ga0496106_0001208 3300048909 Bacteria 19304
200 Ga0496106_0168532 3300048909 Bacteria 1735
201 Ga0496106_0275762 3300048909 Bacteria 1347
202 Ga0496107_0001413 3300048910 Bacteria 14810
203 Ga0496108_0014812 3300048911 Bacteria 6363
204 Ga0496108_0040653 3300048911 Bacteria 3878
205 Ga0496109_0001364 3300048912 Bacteria 20245
206 Ga0496109_0046335 3300048912 Bacteria 3949
207 Ga0496109_0093616 3300048912 Bacteria 2781
208 Ga0496109_0737215 3300048912 Bacteria 923
209 Ga0496110_0001168 3300048913 Bacteria 18638
210 Ga0496110_0304965 3300048913 Bacteria 1450
211 Ga0496111_0082131 3300048914 Bacteria 2353
212 Ga0496111_0104279 3300048914 Bacteria 2086
213 Ga0496112_0040921 3300048915 Bacteria 4533
214 Ga0496113_0111327 3300048916 Bacteria 2132
215 Ga0496114_0000644 3300048917 Bacteria 25695
216 Ga0496114_0033307 3300048917 Bacteria 4245
217 Ga0496114_0230153 3300048917 Bacteria 1628
218 Ga0496114_0238333 3300048917 Bacteria 1599
219 Ga0496115_0003353 3300048918 Bacteria 11494
220 Ga0496115_0397629 3300048918 Bacteria 1118
221 Ga0501031_0001629 3300049568 Bacteria 14064
222 Ga0501031_0033726 3300049568 Bacteria 3341
223 Ga0501031_0070511 3300049568 Bacteria 2276
224 Ga0501031_0134806 3300049568 Bacteria 1613
225 Ga0501032_0003375 3300049569 Bacteria 12253
226 Ga0501032_0186856 3300049569 Bacteria 1355
227 Ga0501033_0001614 3300049570 Bacteria 19815
228 Ga0501034_0009663 3300049571 Bacteria 10088
229 Ga0501034_0194870 3300049571 Bacteria 1987
230 Ga0501036_0000653 3300049572 Bacteria 25437
231 Ga0501036_0017825 3300049572 Bacteria 5943
232 Ga0501036_0053479 3300049572 Bacteria 3419
233 Ga0501036_0093537 3300049572 Bacteria 2540
234 Ga0501036_0116809 3300049572 Bacteria 2253
235 Ga0501037_0000694 3300049573 Bacteria 25664
236 Ga0501037_0029302 3300049573 Bacteria 4067
237 Ga0501037_0036810 3300049573 Bacteria 3606
238 Ga0501038_0001961 3300049574 Bacteria 18980
239 Ga0501038_0034834 3300049574 Bacteria 4424
240 Ga0501038_0119602 3300049574 Bacteria 2174
241 Ga0501038_0139974 3300049574 Bacteria 1980
242 Ga0501038_0472206 3300049574 Bacteria 962
243 Ga0501039_0002914 3300049575 Bacteria 12802
244 Ga0501039_0004572 3300049575 Bacteria 10453
245 Ga0501039_0019935 3300049575 Bacteria 5140
246 Ga0501039_0046390 3300049575 Bacteria 3356
247 Ga0501039_0213251 3300049575 Bacteria 1518
248 Ga0501040_0001674 3300049576 Bacteria 14183
249 Ga0501040_0018603 3300049576 Bacteria 4613
250 Ga0501040_0022571 3300049576 Bacteria 4213
251 Ga0501040_0203488 3300049576 Bacteria 1406
252 Ga0501040_0319431 3300049576 Bacteria 1110
253 Ga0501040_0409914 3300049576 Bacteria 974
254 Ga0501041_0001421 3300049577 Bacteria 13227
255 Ga0501041_0054118 3300049577 Bacteria 2448
256 Ga0501041_0060734 3300049577 Bacteria 2313
257 Ga0501041_0080022 3300049577 Bacteria 2011
258 Ga0501041_0249317 3300049577 Bacteria 1116
259 Ga0501042_0000126 3300049578 Bacteria 32991
260 Ga0501042_0016568 3300049578 Bacteria 5062
261 Ga0501042_0016862 3300049578 Bacteria 5025
262 Ga0501042_0020608 3300049578 Bacteria 4590
263 Ga0501042_0028227 3300049578 Bacteria 3951
264 Ga0501042_0070989 3300049578 Bacteria 2491
265 Ga0501042_0173106 3300049578 Bacteria 1558
266 Ga0501042_0208247 3300049578 Bacteria 1410
267 Ga0501043_0000857 3300049579 Bacteria 26953
268 Ga0501043_0165609 3300049579 Bacteria 1726
269 Ga0501043_0421880 3300049579 Bacteria 1006
270 Ga0501046_0001627 3300049580 Bacteria 21512
271 Ga0501046_0015849 3300049580 Bacteria 6325
272 Ga0501046_0086125 3300049580 Bacteria 2422
273 Ga0501046_0626214 3300049580 Bacteria 762
274 Ga0501047_0002253 3300049581 Bacteria 18470
275 Ga0501047_0164349 3300049581 Bacteria 2091
276 Ga0501048_0000297 3300049582 Bacteria 33839
277 Ga0501048_0016478 3300049582 Bacteria 5448
278 Ga0501048_0017554 3300049582 Bacteria 5270
279 Ga0501048_0034689 3300049582 Bacteria 3638
280 Ga0501048_0047054 3300049582 Bacteria 3078
281 Ga0501048_0452534 3300049582 Bacteria 919
282 Ga0501067_0025061 3300049583 Bacteria 3308
283 Ga0501067_0218145 3300049583 Bacteria 1062
284 Ga0501068_0000155 3300049584 Bacteria 31536
285 Ga0501068_0014770 3300049584 Bacteria 4469
286 Ga0501068_0077311 3300049584 Bacteria 2038
287 Ga0501068_0204465 3300049584 Bacteria 1253
288 Ga0501069_0000473 3300049585 Bacteria 18320
289 Ga0501069_0039850 3300049585 Bacteria 2596
290 Ga0501069_0080900 3300049585 Bacteria 1830
291 Ga0501069_0209064 3300049585 Bacteria 1132
292 Ga0501070_0002711 3300049586 Bacteria 15458
293 Ga0501070_0015169 3300049586 Bacteria 6485
294 Ga0501070_0083022 3300049586 Bacteria 2652
295 Ga0501070_0158403 3300049586 Bacteria 1867
296 Ga0501070_0584893 3300049586 Bacteria 891
297 Ga0501071_0000161 3300049587 Bacteria 28733
298 Ga0501071_0009357 3300049587 Bacteria 6524
299 Ga0501071_0011979 3300049587 Bacteria 5859
300 Ga0501071_0015207 3300049587 Bacteria 5279
301 Ga0501071_0038327 3300049587 Bacteria 3425
302 Ga0501072_0000589 3300049588 Bacteria 26184
303 Ga0501072_0001116 3300049588 Bacteria 19977
304 Ga0501072_0014646 3300049588 Bacteria 6011
305 Ga0501072_0024297 3300049588 Bacteria 4713
306 Ga0501072_0028766 3300049588 Bacteria 4338
307 Ga0501072_0032364 3300049588 Bacteria 4095
308 Ga0501072_0039574 3300049588 Bacteria 3701
309 Ga0501072_0055632 3300049588 Bacteria 3118
310 Ga0501072_0072363 3300049588 Bacteria 2724
311 Ga0501072_0089341 3300049588 Bacteria 2445
312 Ga0501072_0105187 3300049588 Bacteria 2244
313 Ga0501072_0140170 3300049588 Bacteria 1928
314 Ga0501072_0249470 3300049588 Bacteria 1413
315 Ga0501073_0000708 3300049589 Bacteria 23563
316 Ga0501073_0023351 3300049589 Bacteria 4441
317 Ga0501073_0055491 3300049589 Bacteria 2772
318 Ga0501074_0000232 3300049590 Bacteria 31046
319 Ga0501074_0014767 3300049590 Bacteria 5681
320 Ga0501074_0031994 3300049590 Bacteria 3813
321 Ga0501074_0047000 3300049590 Bacteria 3120
322 Ga0501074_0065810 3300049590 Bacteria 2608
323 Ga0501075_0001644 3300049591 Bacteria 14682
324 Ga0501075_0001861 3300049591 Bacteria 13917
325 Ga0501075_0004917 3300049591 Bacteria 9109
326 Ga0501075_0022857 3300049591 Bacteria 4572
327 Ga0501075_0033339 3300049591 Bacteria 3831
328 Ga0501075_0081606 3300049591 Bacteria 2448
329 Ga0501075_0164920 3300049591 Bacteria 1690
330 Ga0501075_0255966 3300049591 Bacteria 1334
331 Ga0501076_0003482 3300049592 Bacteria 11056
332 Ga0501076_0018556 3300049592 Bacteria 5305
333 Ga0501076_0026558 3300049592 Bacteria 4486
334 Ga0501076_0034658 3300049592 Bacteria 3947
335 Ga0501076_0094408 3300049592 Bacteria 2408
336 Ga0501076_0220296 3300049592 Bacteria 1551
337 Ga0501076_0630391 3300049592 Bacteria 884
338 Ga0501077_0000797 3300049593 Bacteria 19085
339 Ga0501077_0004191 3300049593 Bacteria 8713
340 Ga0501077_0072965 3300049593 Bacteria 2174
341 Ga0501077_0083978 3300049593 Bacteria 2018
342 Ga0501077_0110792 3300049593 Bacteria 1739
343 Ga0501079_0000774 3300049741 Bacteria 21905
344 Ga0501079_0002848 3300049741 Bacteria 12616
345 Ga0501079_0014493 3300049741 Bacteria 6011
346 Ga0501079_0020604 3300049741 Bacteria 5041
347 Ga0501079_0050553 3300049741 Bacteria 3209
348 Ga0501079_0052956 3300049741 Bacteria 3131
349 Ga0501079_0069153 3300049741 Bacteria 2725
350 Ga0501079_0072588 3300049741 Bacteria 2660
351 Ga0501079_0102843 3300049741 Bacteria 2215
352 Ga0501079_0141575 3300049741 Bacteria 1873
353 Ga0501079_0543471 3300049741 Bacteria 914
354 Ga0501080_0000888 3300049742 Bacteria 24482
355 Ga0501080_0057848 3300049742 Bacteria 3609
356 Ga0501080_0169461 3300049742 Bacteria 2014
357 Ga0501080_0182853 3300049742 Bacteria 1928
358 Ga0501081_0002364 3300049743 Bacteria 11889
359 Ga0501081_0003766 3300049743 Bacteria 9711
360 Ga0501081_0006557 3300049743 Bacteria 7564
361 Ga0501081_0023554 3300049743 Bacteria 4127
362 Ga0501081_0024562 3300049743 Bacteria 4047
363 Ga0501081_0176477 3300049743 Bacteria 1544
364 Ga0501083_0001023 3300049744 Bacteria 18628
365 Ga0501083_0136838 3300049744 Bacteria 1605
366 Ga0501083_0314870 3300049744 Bacteria 1018
367 Ga0501083_0418502 3300049744 Bacteria 872
368 Ga0501035_0007118 3300049822 Bacteria 10457
369 Ga0501035_0364270 3300049822 Bacteria 1208
370 Ga0501044_0002361 3300049823 Bacteria 21516
371 Ga0501044_0080846 3300049823 Bacteria 3291
372 Ga0501044_0110270 3300049823 Bacteria 2761
373 Ga0501045_0002545 3300049824 Bacteria 12430
374 Ga0501045_0009255 3300049824 Bacteria 6890
375 Ga0501045_0011946 3300049824 Bacteria 6105
376 Ga0501045_0016319 3300049824 Bacteria 5273
377 Ga0501045_0019675 3300049824 Bacteria 4816
378 Ga0501045_0031005 3300049824 Bacteria 3871
379 Ga0501045_0195493 3300049824 Bacteria 1507
380 nmdc:mga08y16_208199_c1 3300050511 Bacteria 2026
381 nmdc:mga0n895_496376_c1 3300050512 Bacteria 1230
382 Ga0501084_0003786 3300054114 Bacteria 12302
383 Ga0501084_0015564 3300054114 Bacteria 6308
384 Ga0501084_0051212 3300054114 Bacteria 3455
385 Ga0501084_0081558 3300054114 Bacteria 2713
386 Ga0501084_0144468 3300054114 Bacteria 2004
387 Ga0501082_0000798 3300060353 Bacteria 27727
388 Ga0501082_0001638 3300060353 Bacteria 19734
389 Ga0501082_0017630 3300060353 Bacteria 6150
390 Ga0501082_0020469 3300060353 Bacteria 5706
391 Ga0501082_0084823 3300060353 Bacteria 2732
392 Ga0501082_0092940 3300060353 Bacteria 2606
393 Ga0501082_0382381 3300060353 Bacteria 1228
394 Ga0501082_0469882 3300060353 Bacteria 1099
395 Ga0530510_0000350 3300061734 Bacteria 29808
396 Ga0530510_0018442 3300061734 Bacteria 4948
397 Ga0530510_0018730 3300061734 Bacteria 4910
398 Ga0530510_0041820 3300061734 Bacteria 3309
399 Ga0530510_0051563 3300061734 Bacteria 2973
400 Ga0530510_0120486 3300061734 Bacteria 1926
401 Ga0530510_0321483 3300061734 Bacteria 1160
402 Ga0070684_100338610
403 ARcpr5oldR_c001257
404 JGI25407J50210_10005117
405 Ga0070683_100045162
406 Ga0070683_100378478
407 Ga0070690_100148994
408 Ga0070680_100190568
409 Ga0070689_100196821
410 Ga0070692_10105557
411 Ga0070668_100025176
412 Ga0070674_100037448
413 Ga0070659_100673850
414 Ga0070711_100026847
415 Ga0070681_10090474
416 Ga0068867_100183128
417 Ga0070679_100125704
418 Ga0070679_100397704
419 Ga0070684_100005993
420 Ga0070686_100138104
421 Ga0068855_100400281
422 Ga0070664_100180328
423 Ga0068857_100430635
424 Ga0068856_100067924
425 Ga0068852_100039795
426 Ga0068852_100212216
427 Ga0068852_100281615
428 Ga0081455_10010841
429 Ga0081455_10011273
430 Ga0081455_10287786
431 Ga0081538_10000012
432 Ga0081538_10001043
433 Ga0081538_10002956
434 Ga0081538_10004384
435 Ga0081538_10028183
436 Ga0081538_10035796
437 Ga0081538_10106340
438 Ga0070712_100005875
439 Ga0068871_100283168
440 Ga0075433_10286900
441 Ga0105240_10068455
442 Ga0105240_10284397
443 Ga0111539_10496308
444 Ga0105245_10004034
445 Ga0105245_10064633
446 Ga0105245_10079728
447 Ga0114129_10651480
448 Ga0114129_10810692
449 Ga0105243_10073298
450 Ga0105242_10093329
451 Ga0105238_10420543
452 Ga0105239_10274550
453 Ga0105239_10434868
454 Ga0157318_1002346
455 Ga0157338_1002955
456 Ga0157371_10300512
457 Ga0157370_10119356
458 Ga0157369_10014808
459 Ga0157374_10256885
460 Ga0157378_10019831
461 Ga0163162_10681985
462 Ga0163162_10772949
463 Ga0157375_10066837
464 Ga0157375_10391050
465 Ga0157377_10415591
466 Ga0157379_10211746
467 Ga0157379_10397687
468 Ga0206354_10530740
469 Ga0206353_10707770
470 Ga0207695_10339154
471 Ga0207695_10410959
472 Ga0207693_10059882
473 Ga0207693_10418184
474 Ga0207663_10006320
475 Ga0207660_10177625
476 Ga0207652_10122122
477 Ga0207681_10259600
478 Ga0207687_10002673
479 Ga0207687_10064351
480 Ga0207706_10056753
481 Ga0207686_10022369
482 Ga0207709_10540459
483 Ga0207670_10142514
484 Ga0207669_10018115
485 Ga0207704_10178131
486 Ga0207661_10010979
487 Ga0207661_10608482
488 Ga0207679_10158411
489 Ga0207658_10015418
490 Ga0207677_10080014
491 Ga0207639_10258944
492 Ga0207708_10097912
493 Ga0207648_10006781
494 Ga0207648_10412281
495 Ga0207674_10081688
496 Ga0207675_100095814
497 Ga0207683_10489737
498 Ga0207698_10152150
499 Ga0209966_1012989
500 Ga0265326_10003913
501 Ga0265319_1000776
502 Ga0265319_1006609
503 Ga0265334_10009217
504 Ga0265318_10000633
505 Ga0265318_10001338
506 Ga0265336_10003217
507 Ga0265338_10026550
508 Ga0265338_10031813
509 Ga0265330_10002570
510 Ga0265330_10038564
511 Ga0265328_10007941
512 Ga0265320_10011297
513 Ga0265320_10024306
514 Ga0265325_10006204
515 Ga0265325_10031642
516 Ga0265340_10011167
517 Ga0265339_10018734
518 Ga0265331_10008506
519 Ga0265327_10027647
520 Ga0265327_10046501
521 Ga0265327_10096074
522 Ga0265316_10023644
523 Ga0265316_10042775
524 Ga0307408_100035597
525 Ga0265313_10019544
526 Ga0265314_10040694
527 Ga0265314_10054653
528 Ga0265342_10022749
529 Ga0265342_10041258
530 Ga0307410_10201712
531 Ga0307406_10439807
532 Ga0307412_10063419
533 Ga0307409_100026122
534 Ga0307416_100007838
535 Ga0307415_100041496
536 Ga0307415_100085392
537 Ga0307415_100192995
538 Ga0373937_0075073
539 Ga0395899_0003425
540 Ga0395899_0156153
541 Ga0395899_0383550
542 Ga0395900_0002825
543 Ga0395900_0005153
544 Ga0395900_0013813
545 Ga0395900_0028102
546 Ga0395900_0111900
547 Ga0395900_0219963
548 Ga0395900_0606606
549 Ga0395898_0007620
550 Ga0395898_0048309
551 Ga0395898_0069010
552 Ga0395898_0074567
553 Ga0395898_0075856
554 Ga0395898_0097504
555 Ga0395898_0189575
556 Ga0395898_0191716
557 Ga0395898_0385396
558 Ga0395905_0009455
559 Ga0395905_0016463
560 Ga0395905_0028230
561 Ga0395905_0033401
562 Ga0395905_0112525
563 Ga0395901_0000478
564 Ga0395901_0005803
565 Ga0395901_0007388
566 Ga0395901_0065147
567 Ga0395901_0090751
568 Ga0395901_0349095
569 Ga0395901_0710051
570 Ga0439461_0040392
571 Ga0451839_0893534
572 Ga0439448_0023597
573 Ga0450920_011126
574 Ga0450908_016474
575 Ga0439460_0055509
576 Ga0466966_0304091
577 Ga0466961_0146428
578 Ga0466963_0205923
579 Ga0466968_0036014
580 Ga0466968_0038278
581 Ga0451576_0226236
582 Ga0466967_0152386
583 Ga0466967_0252787
584 Ga0466967_0268506
585 Ga0495603_0011712
586 Ga0495582_0030432
587 Ga0495594_0217695
588 Ga0496100_0021862
589 Ga0496100_0257199
590 Ga0496101_0000368
591 Ga0496102_0002182
592 Ga0496102_0169781
593 Ga0496102_0204181
594 Ga0496102_0289426
595 Ga0496103_0002604
596 Ga0496104_0003277
597 Ga0496104_0114778
598 Ga0496104_0162039
599 Ga0496105_0005803
600 Ga0496106_0001208
601 Ga0496106_0168532
602 Ga0496106_0275762
603 Ga0496107_0001413
604 Ga0496108_0014812
605 Ga0496108_0040653
606 Ga0496109_0001364
607 Ga0496109_0046335
608 Ga0496109_0093616
609 Ga0496109_0737215
610 Ga0496110_0001168
611 Ga0496110_0304965
612 Ga0496111_0082131
613 Ga0496111_0104279
614 Ga0496112_0040921
615 Ga0496113_0111327
616 Ga0496114_0000644
617 Ga0496114_0033307
618 Ga0496114_0230153
619 Ga0496114_0238333
620 Ga0496115_0003353
621 Ga0496115_0397629
622 Ga0501031_0001629
623 Ga0501031_0033726
624 Ga0501031_0070511
625 Ga0501031_0134806
626 Ga0501032_0003375
627 Ga0501032_0186856
628 Ga0501033_0001614
629 Ga0501034_0009663
630 Ga0501034_0194870
631 Ga0501036_0000653
632 Ga0501036_0017825
633 Ga0501036_0053479
634 Ga0501036_0093537
635 Ga0501036_0116809
636 Ga0501037_0000694
637 Ga0501037_0029302
638 Ga0501037_0036810
639 Ga0501038_0001961
640 Ga0501038_0034834
641 Ga0501038_0119602
642 Ga0501038_0139974
643 Ga0501038_0472206
644 Ga0501039_0002914
645 Ga0501039_0004572
646 Ga0501039_0019935
647 Ga0501039_0046390
648 Ga0501039_0213251
649 Ga0501040_0001674
650 Ga0501040_0018603
651 Ga0501040_0022571
652 Ga0501040_0203488
653 Ga0501040_0319431
654 Ga0501040_0409914
655 Ga0501041_0001421
656 Ga0501041_0054118
657 Ga0501041_0060734
658 Ga0501041_0080022
659 Ga0501041_0249317
660 Ga0501042_0000126
661 Ga0501042_0016568
662 Ga0501042_0016862
663 Ga0501042_0020608
664 Ga0501042_0028227
665 Ga0501042_0070989
666 Ga0501042_0173106
667 Ga0501042_0208247
668 Ga0501043_0000857
669 Ga0501043_0165609
670 Ga0501043_0421880
671 Ga0501046_0001627
672 Ga0501046_0015849
673 Ga0501046_0086125
674 Ga0501046_0626214
675 Ga0501047_0002253
676 Ga0501047_0164349
677 Ga0501048_0000297
678 Ga0501048_0016478
679 Ga0501048_0017554
680 Ga0501048_0034689
681 Ga0501048_0047054
682 Ga0501048_0452534
683 Ga0501067_0025061
684 Ga0501067_0218145
685 Ga0501068_0000155
686 Ga0501068_0014770
687 Ga0501068_0077311
688 Ga0501068_0204465
689 Ga0501069_0000473
690 Ga0501069_0039850
691 Ga0501069_0080900
692 Ga0501069_0209064
693 Ga0501070_0002711
694 Ga0501070_0015169
695 Ga0501070_0083022
696 Ga0501070_0158403
697 Ga0501070_0584893
698 Ga0501071_0000161
699 Ga0501071_0009357
700 Ga0501071_0011979
701 Ga0501071_0015207
702 Ga0501071_0038327
703 Ga0501072_0000589
704 Ga0501072_0001116
705 Ga0501072_0014646
706 Ga0501072_0024297
707 Ga0501072_0028766
708 Ga0501072_0032364
709 Ga0501072_0039574
710 Ga0501072_0055632
711 Ga0501072_0072363
712 Ga0501072_0089341
713 Ga0501072_0105187
714 Ga0501072_0140170
715 Ga0501072_0249470
716 Ga0501073_0000708
717 Ga0501073_0023351
718 Ga0501073_0055491
719 Ga0501074_0000232
720 Ga0501074_0014767
721 Ga0501074_0031994
722 Ga0501074_0047000
723 Ga0501074_0065810
724 Ga0501075_0001644
725 Ga0501075_0001861
726 Ga0501075_0004917
727 Ga0501075_0022857
728 Ga0501075_0033339
729 Ga0501075_0081606
730 Ga0501075_0164920
731 Ga0501075_0255966
732 Ga0501076_0003482
733 Ga0501076_0018556
734 Ga0501076_0026558
735 Ga0501076_0034658
736 Ga0501076_0094408
737 Ga0501076_0220296
738 Ga0501076_0630391
739 Ga0501077_0000797
740 Ga0501077_0004191
741 Ga0501077_0072965
742 Ga0501077_0083978
743 Ga0501077_0110792
744 Ga0501079_0000774
745 Ga0501079_0002848
746 Ga0501079_0014493
747 Ga0501079_0020604
748 Ga0501079_0050553
749 Ga0501079_0052956
750 Ga0501079_0069153
751 Ga0501079_0072588
752 Ga0501079_0102843
753 Ga0501079_0141575
754 Ga0501079_0543471
755 Ga0501080_0000888
756 Ga0501080_0057848
757 Ga0501080_0169461
758 Ga0501080_0182853
759 Ga0501081_0002364
760 Ga0501081_0003766
761 Ga0501081_0006557
762 Ga0501081_0023554
763 Ga0501081_0024562
764 Ga0501081_0176477
765 Ga0501083_0001023
766 Ga0501083_0136838
767 Ga0501083_0314870
768 Ga0501083_0418502
769 Ga0501035_0007118
770 Ga0501035_0364270
771 Ga0501044_0002361
772 Ga0501044_0080846
773 Ga0501044_0110270
774 Ga0501045_0002545
775 Ga0501045_0009255
776 Ga0501045_0011946
777 Ga0501045_0016319
778 Ga0501045_0019675
779 Ga0501045_0031005
780 Ga0501045_0195493
781 nmdc:mga08y16_208199_c1
782 nmdc:mga0n895_496376_c1
783 Ga0501084_0003786
784 Ga0501084_0015564
785 Ga0501084_0051212
786 Ga0501084_0081558
787 Ga0501084_0144468
788 Ga0501082_0000798
789 Ga0501082_0001638
790 Ga0501082_0017630
791 Ga0501082_0020469
792 Ga0501082_0084823
793 Ga0501082_0092940
794 Ga0501082_0382381
795 Ga0501082_0469882
796 Ga0530510_0000350
797 Ga0530510_0018442
798 Ga0530510_0018730
799 Ga0530510_0041820
800 Ga0530510_0051563
801 Ga0530510_0120486
802 Ga0530510_0321483

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

103

202

0.95

PF13649

Methyltransf_25

Methyltransferase domain

102

198

0.94

PF08242

Methyltransf_12

Methyltransferase domain

103

200

0.9

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

90

210

0.89

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

87

224

0.88

PF13847

Methyltransf_31

Methyltransferase domain

96

243

0.88

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

91

227

0.81

PF13489

Methyltransf_23

Methyltransferase domain

76

249

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kpc-assembly1.cif.gz_B pavine n-methyltransferase h206a mutant in complex with s-adenosylmethionine ph 6 0.8667 66 183
6uv6-assembly2.cif.gz_B atmm with bound rebeccamycin analogue 0.8656 65 244
3bus-assembly2.cif.gz_B crystal structure of rebm 0.8577 67 243
5wp4-assembly1.cif.gz_A arabidopsis thaliana phosphoethanolamine n-methyltransferase 1 (atpmt1, xioptl) in complex with sah and phosphocholine 0.8548 69 226
5gm2-assembly2.cif.gz_L crystal structure of methyltransferase tled complexed with sah and teleocidin a1 0.8533 66 226
ID Description Score Start End Superfamily
af_B7ZXR6_266_358_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9371 66 131 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.934 69 134 3.40.50.150
af_C0H5A2_481_622_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9173 74 135 3.40.50.150
af_Q6EQW4_99_328_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9007 66 143 3.40.50.150
af_Q0JCB3_13_161_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8995 72 131 3.40.50.150
ID Description Score Start End GO Terms
AF-J7T967-F1-model_v4 deleted 0.9678 59 189
AF-A0A838J840-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.9628 49 151 GO:0008168
GO:0032259
AF-A0A2H0AUX0-F1-model_v4 Methyltransferase domain-containing protein 0.9573 70 129 GO:0016020
AF-A0A7V8W9R5-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.9514 2 244 GO:0008168
GO:0032259
AF-A0A2Z5JPE9-F1-model_v4 Methyltransferase domain-containing protein 0.9472 66 168 GO:0008168
GO:0009058

Map