F434749

General Info

Members Datasets Scaffolds Average Seq Length
401 224 802 248

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100197092|Ga0068869_1001970921
Length 261
Sequence MQGAAIGAEGGTMSGHSKWATIKRKKGALDAKRGKTFTKWIKEITVAARNGGGDPAGNPRLRTAILGAKGVNMPADNIDRAIKKGTGELEGTSYEEITYEGYGPGGIAILMESLTDNRNRTTGELRHILTKNGGRMAEAGAVQWMFHSKGILAVPRSAVDEDTLITLVLDAGAEDVDTEDPETYEITTSPQQFEAVRAALAEKGIATTSAEVAKVPQNVISLSEKDAEAALKLMEVLEDHDDVQKVSSNLDISSDLLAKLQ

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
106 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
107 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
108 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
109 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
110 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
111 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
112 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
116 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
119 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
132 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
133 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
140 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
141 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
142 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
143 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
144 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
145 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
146 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
147 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
219 2857472729 Cohnella sp. R-74144 Isolate Unclassified
220 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
221 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
222 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
223 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere
224 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.76
Metatranscriptomes 1.5
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 3.49
Rhizosphere 91.77
Stem 0
Stem Tuber 0
Unclassified 4.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100197092 3300005334 Bacteria 1586
2 JGI24736J21556_1018880 3300001904 Bacteria 1090
3 rootH2_10210983 3300003320 Bacteria 1754
4 rootL2_10072584 3300003322 Bacteria 9262
5 rootL2_10180304 3300003322 Bacteria 8931
6 rootH1_10011702 3300003323 Bacteria 7253
7 Ga0065712_10216238 3300005290 Bacteria 1056
8 Ga0070683_100001469 3300005329 Bacteria 18147
9 Ga0070689_100065408 3300005340 Bacteria 2831
10 Ga0070687_100170902 3300005343 Bacteria 1294
11 Ga0070692_10243988 3300005345 Bacteria 1072
12 Ga0070675_100108001 3300005354 Bacteria 2350
13 Ga0070688_100030595 3300005365 Bacteria 3232
14 Ga0070709_10012040 3300005434 Bacteria 4836
15 Ga0070710_10078493 3300005437 Bacteria 1921
16 Ga0070711_100070383 3300005439 Bacteria 2463
17 Ga0070711_100079688 3300005439 Unclassified 2330
18 Ga0070711_100639111 3300005439 Bacteria 891
19 Ga0070705_100130354 3300005440 Bacteria 1639
20 Ga0070705_100153359 3300005440 Bacteria 1531
21 Ga0070694_100111015 3300005444 Bacteria 1953
22 Ga0070694_100176863 3300005444 Unclassified 1576
23 Ga0070694_100372964 3300005444 Bacteria 1111
24 Ga0070708_100158485 3300005445 Bacteria 2108
25 Ga0070708_100633317 3300005445 Bacteria 1008
26 Ga0070663_100081681 3300005455 Bacteria 2376
27 Ga0070662_100689545 3300005457 Bacteria 863
28 Ga0070706_100004261 3300005467 Bacteria 13883
29 Ga0070698_100080063 3300005471 Bacteria 3262
30 Ga0070698_100190298 3300005471 Bacteria 1990
31 Ga0070698_100215105 3300005471 Bacteria 1856
32 Ga0070679_100035938 3300005530 Bacteria 4916
33 Ga0070697_100193111 3300005536 Bacteria 1728
34 Ga0070697_100286411 3300005536 Unclassified 1414
35 Ga0068853_100131130 3300005539 Bacteria 2244
36 Ga0070695_100093239 3300005545 Bacteria 2015
37 Ga0070695_100230892 3300005545 Bacteria 1337
38 Ga0070695_100239074 3300005545 Unclassified 1317
39 Ga0070696_100391936 3300005546 Bacteria 1085
40 Ga0070665_100215581 3300005548 Bacteria 1920
41 Ga0070704_100075471 3300005549 Bacteria 2463
42 Ga0068855_100052129 3300005563 Bacteria 4817
43 Ga0068856_100180152 3300005614 Bacteria 2126
44 Ga0068856_100294671 3300005614 Bacteria 1639
45 Ga0068859_100000015 3300005617 Bacteria 271458
46 Ga0068859_100025126 3300005617 Bacteria 5978
47 Ga0068859_100148949 3300005617 Bacteria 2416
48 Ga0068864_100017439 3300005618 Bacteria 5986
49 Ga0068863_100376521 3300005841 Bacteria 1386
50 Ga0068858_100005489 3300005842 Bacteria 12417
51 Ga0068860_100343008 3300005843 Bacteria 1469
52 Ga0068862_100032701 3300005844 Bacteria 4394
53 Ga0068862_100440619 3300005844 Bacteria 1226
54 Ga0081540_1044149 3300005983 Bacteria 2278
55 Ga0075432_10087079 3300006058 Bacteria 1139
56 Ga0070715_10003104 3300006163 Bacteria 5213
57 Ga0070716_100020671 3300006173 Bacteria 3458
58 Ga0070716_100039947 3300006173 Bacteria 2607
59 Ga0070712_100459516 3300006175 Bacteria 1061
60 Ga0075428_100443603 3300006844 Bacteria 1390
61 Ga0075433_10001499 3300006852 Bacteria 17248
62 Ga0075433_10151297 3300006852 Unclassified 2064
63 Ga0075434_100011777 3300006871 Bacteria 8263
64 Ga0075434_100211126 3300006871 Unclassified 1961
65 Ga0075434_100228729 3300006871 Bacteria 1879
66 Ga0075429_100062474 3300006880 Bacteria 3245
67 Ga0075429_100580513 3300006880 Bacteria 982
68 Ga0068865_100691375 3300006881 Bacteria 871
69 Ga0075436_100006339 3300006914 Bacteria 8105
70 Ga0075436_100045616 3300006914 Bacteria 3023
71 Ga0075436_100153048 3300006914 Bacteria 1624
72 Ga0097620_100000015 3300006931 Bacteria 271458
73 Ga0097620_100025125 3300006931 Bacteria 5978
74 Ga0097620_100148948 3300006931 Bacteria 2416
75 Ga0075435_100001245 3300007076 Bacteria 16296
76 Ga0075435_100076425 3300007076 Bacteria 2744
77 Ga0105240_10006520 3300009093 Bacteria 17136
78 Ga0105240_10012987 3300009093 Bacteria 11472
79 Ga0111539_10018057 3300009094 Bacteria 8737
80 Ga0111539_10200851 3300009094 Bacteria 2325
81 Ga0105245_10855717 3300009098 Bacteria 949
82 Ga0114129_10058563 3300009147 Bacteria 5388
83 Ga0105241_10024181 3300009174 Bacteria 4512
84 Ga0105248_10043102 3300009177 Bacteria 5061
85 Ga0105237_10037823 3300009545 Bacteria 4876
86 Ga0105238_10003751 3300009551 Bacteria 15098
87 Ga0105239_10023045 3300010375 Bacteria 6864
88 Ga0105239_10081794 3300010375 Bacteria 3555
89 Ga0157370_10474821 3300013104 Unclassified 1149
90 Ga0157369_10248913 3300013105 Bacteria 1855
91 Ga0157374_10095744 3300013296 Bacteria 2839
92 Ga0157378_10720194 3300013297 Bacteria 1019
93 Ga0157372_10528111 3300013307 Bacteria 1376
94 Ga0163163_10069329 3300014325 Bacteria 3511
95 Ga0163163_10456874 3300014325 Bacteria 1337
96 Ga0163163_10505580 3300014325 Unclassified 1270
97 Ga0163163_10691514 3300014325 Bacteria 1083
98 Ga0157379_10001570 3300014968 Bacteria 18816
99 Ga0157379_10452471 3300014968 Bacteria 1186
100 Ga0157376_10775009 3300014969 Bacteria 970
101 Ga0157376_10887943 3300014969 Bacteria 909
102 Ga0197907_10076236 3300020069 Bacteria 2353
103 Ga0206356_11798851 3300020070 Bacteria 1230
104 Ga0206356_11841100 3300020070 Bacteria 1363
105 Ga0206352_11224283 3300020078 Bacteria 1921
106 Ga0213875_10003458 3300021388 Bacteria 8991
107 Ga0224712_10024015 3300022467 Bacteria 2124
108 Ga0224712_10268390 3300022467 Bacteria 792
109 Ga0207692_10082564 3300025898 Bacteria 1722
110 Ga0207710_10093802 3300025900 Bacteria 1408
111 Ga0207647_10007169 3300025904 Bacteria 8081
112 Ga0207699_10000694 3300025906 Bacteria 16116
113 Ga0207699_10004759 3300025906 Bacteria 6486
114 Ga0207684_10003985 3300025910 Bacteria 14129
115 Ga0207654_10020176 3300025911 Bacteria 3529
116 Ga0207695_10002744 3300025913 Bacteria 25682
117 Ga0207695_10056993 3300025913 Bacteria 4062
118 Ga0207671_10000482 3300025914 Bacteria 54151
119 Ga0207693_10023606 3300025915 Bacteria 4882
120 Ga0207663_10043209 3300025916 Bacteria 2758
121 Ga0207663_10052939 3300025916 Unclassified 2534
122 Ga0207663_10059818 3300025916 Bacteria 2412
123 Ga0207652_10024748 3300025921 Bacteria 4982
124 Ga0207646_10663233 3300025922 Bacteria 934
125 Ga0207694_10101390 3300025924 Bacteria 2281
126 Ga0207700_10042537 3300025928 Bacteria 3331
127 Ga0207700_10269914 3300025928 Bacteria 1460
128 Ga0207664_10001833 3300025929 Bacteria 14021
129 Ga0207709_10075485 3300025935 Unclassified 2155
130 Ga0207670_10050919 3300025936 Bacteria 2778
131 Ga0207704_10213692 3300025938 Bacteria 1422
132 Ga0207665_10003653 3300025939 Bacteria 10272
133 Ga0207665_10044949 3300025939 Bacteria 2956
134 Ga0207689_10206833 3300025942 Bacteria 1621
135 Ga0207661_10010070 3300025944 Bacteria 6795
136 Ga0207667_10029756 3300025949 Bacteria 5917
137 Ga0207667_10394561 3300025949 Bacteria 1409
138 Ga0207668_10575855 3300025972 Bacteria 978
139 Ga0207703_10002375 3300026035 Bacteria 16376
140 Ga0207703_10061516 3300026035 Bacteria 3074
141 Ga0207639_10107110 3300026041 Bacteria 2270
142 Ga0207678_10086713 3300026067 Bacteria 2675
143 Ga0207702_10154201 3300026078 Bacteria 2092
144 Ga0207702_10187279 3300026078 Bacteria 1910
145 Ga0207641_10107490 3300026088 Bacteria 2468
146 Ga0207676_10582809 3300026095 Bacteria 1072
147 Ga0207675_100032055 3300026118 Bacteria 4894
148 Ga0207428_10035532 3300027907 Bacteria 4073
149 Ga0207428_10106927 3300027907 Bacteria 2156
150 Ga0268265_10423286 3300028380 Bacteria 1237
151 Ga0268265_10850907 3300028380 Bacteria 892
152 Ga0265337_1001010 3300028556 Bacteria 14630
153 Ga0265337_1003407 3300028556 Bacteria 6900
154 Ga0265337_1018528 3300028556 Unclassified 2209
155 Ga0265337_1036961 3300028556 Bacteria 1422
156 Ga0265326_10017423 3300028558 Bacteria 2072
157 Ga0265319_1000024 3300028563 Bacteria 144981
158 Ga0265319_1000657 3300028563 Bacteria 22768
159 Ga0265319_1005808 3300028563 Bacteria 5831
160 Ga0265319_1008700 3300028563 Bacteria 4414
161 Ga0265319_1025317 3300028563 Bacteria 2125
162 Ga0265319_1032172 3300028563 Unclassified 1821
163 Ga0265334_10002242 3300028573 Bacteria 9086
164 Ga0265334_10006088 3300028573 Bacteria 5232
165 Ga0265334_10010090 3300028573 Bacteria 3989
166 Ga0265318_10000022 3300028577 Bacteria 162885
167 Ga0265318_10000157 3300028577 Bacteria 60876
168 Ga0265318_10005419 3300028577 Bacteria 5991
169 Ga0265318_10007295 3300028577 Bacteria 5011
170 Ga0265318_10034386 3300028577 Bacteria 1954
171 Ga0265318_10047053 3300028577 Bacteria 1628
172 Ga0265323_10000004 3300028653 Bacteria 197761
173 Ga0265323_10001121 3300028653 Bacteria 13829
174 Ga0265323_10004867 3300028653 Bacteria 5743
175 Ga0265323_10036053 3300028653 Bacteria 1820
176 Ga0265323_10068809 3300028653 Bacteria 1214
177 Ga0265322_10006496 3300028654 Bacteria 3440
178 Ga0265322_10007599 3300028654 Bacteria 3160
179 Ga0265336_10006690 3300028666 Bacteria 4134
180 Ga0265336_10007991 3300028666 Bacteria 3734
181 Ga0265336_10038461 3300028666 Bacteria 1468
182 Ga0265336_10057636 3300028666 Bacteria 1166
183 Ga0307515_10080808 3300028794 Unclassified 4232
184 Ga0265338_10000678 3300028800 Bacteria 58665
185 Ga0265338_10001254 3300028800 Bacteria 41835
186 Ga0265338_10007281 3300028800 Bacteria 13807
187 Ga0265338_10014448 3300028800 Bacteria 8788
188 Ga0265338_10014844 3300028800 Bacteria 8618
189 Ga0265338_10324034 3300028800 Bacteria 1115
190 Ga0265324_10001378 3300029957 Bacteria 14064
191 Ga0265324_10021047 3300029957 Bacteria 2340
192 Ga0265324_10063365 3300029957 Bacteria 1262
193 Ga0265330_10051175 3300031235 Bacteria 1811
194 Ga0265330_10163480 3300031235 Bacteria 945
195 Ga0265330_10193960 3300031235 Bacteria 859
196 Ga0265332_10020633 3300031238 Bacteria 2909
197 Ga0265332_10061234 3300031238 Bacteria 1609
198 Ga0265332_10071004 3300031238 Bacteria 1483
199 Ga0265332_10146246 3300031238 Bacteria 989
200 Ga0265328_10010411 3300031239 Bacteria 3746
201 Ga0265320_10000309 3300031240 Bacteria 39981
202 Ga0265320_10002691 3300031240 Bacteria 12290
203 Ga0265320_10008469 3300031240 Bacteria 6294
204 Ga0265320_10010602 3300031240 Bacteria 5473
205 Ga0265320_10013383 3300031240 Bacteria 4721
206 Ga0265320_10017211 3300031240 Bacteria 4022
207 Ga0265320_10019544 3300031240 Bacteria 3700
208 Ga0265320_10024781 3300031240 Bacteria 3166
209 Ga0265320_10067821 3300031240 Bacteria 1687
210 Ga0265325_10002540 3300031241 Bacteria 12287
211 Ga0265325_10042325 3300031241 Bacteria 2382
212 Ga0265340_10002100 3300031247 Bacteria 11416
213 Ga0265339_10020781 3300031249 Bacteria 3829
214 Ga0265339_10060564 3300031249 Bacteria 2040
215 Ga0265331_10087557 3300031250 Bacteria 1442
216 Ga0265327_10000061 3300031251 Bacteria 234364
217 Ga0265327_10000450 3300031251 Bacteria 74345
218 Ga0265327_10005466 3300031251 Bacteria 10599
219 Ga0265327_10019526 3300031251 Bacteria 4162
220 Ga0265327_10028450 3300031251 Bacteria 3198
221 Ga0265327_10030114 3300031251 Bacteria 3074
222 Ga0265316_10016271 3300031344 Bacteria 6455
223 Ga0265316_10016820 3300031344 Bacteria 6331
224 Ga0265316_10025137 3300031344 Bacteria 4973
225 Ga0265316_10026614 3300031344 Bacteria 4806
226 Ga0265316_10046700 3300031344 Bacteria 3429
227 Ga0265316_10100515 3300031344 Bacteria 2198
228 Ga0265316_10103549 3300031344 Bacteria 2161
229 Ga0265316_10116542 3300031344 Bacteria 2019
230 Ga0265316_10147160 3300031344 Bacteria 1766
231 Ga0307509_10033544 3300031507 Bacteria 5650
232 Ga0265313_10000971 3300031595 Bacteria 28364
233 Ga0265313_10004436 3300031595 Bacteria 10799
234 Ga0265313_10006472 3300031595 Bacteria 8277
235 Ga0265313_10009040 3300031595 Bacteria 6524
236 Ga0265313_10038652 3300031595 Bacteria 2375
237 Ga0265313_10053676 3300031595 Bacteria 1917
238 Ga0307508_10000554 3300031616 Bacteria 44420
239 Ga0265314_10001225 3300031711 Bacteria 29425
240 Ga0265314_10003672 3300031711 Bacteria 14731
241 Ga0265314_10008487 3300031711 Bacteria 8791
242 Ga0265314_10009302 3300031711 Bacteria 8315
243 Ga0265314_10050381 3300031711 Bacteria 2909
244 Ga0265314_10273457 3300031711 Bacteria 959
245 Ga0265342_10003580 3300031712 Bacteria 12677
246 Ga0265342_10017871 3300031712 Bacteria 4604
247 Ga0265342_10158576 3300031712 Bacteria 1252
248 Ga0265342_10192196 3300031712 Unclassified 1113
249 Ga0316578_10026643 3300031728 Bacteria 3262
250 Ga0316577_10008335 3300031733 Bacteria 5552
251 Ga0316583_10012724 3300032133 Bacteria 3036
252 Ga0316583_10041165 3300032133 Bacteria 1636
253 Ga0373931_0095361 3300035691 Bacteria 1665
254 Ga0373937_0564518 3300036401 Bacteria 1081
255 Ga0316584_0000303 3300036712 Bacteria 25230
256 Ga0395905_0000026 3300037471 Bacteria 315051
257 Ga0436364_1479397 3300037853 Bacteria 37250
258 Ga0439436_0001979 3300041404 Bacteria 6080
259 Ga0439439_0001533 3300041406 Bacteria 4636
260 Ga0451837_0755298 3300041494 Bacteria 1239
261 Ga0451837_1776499 3300041494 Bacteria 1075
262 Ga0451841_0626265 3300041498 Bacteria 983
263 Ga0439433_0010718 3300041999 Bacteria 2003
264 Ga0439448_0058864 3300042005 Bacteria 1268
265 Ga0439449_0000028 3300042007 Bacteria 43602
266 Ga0439449_0002082 3300042007 Bacteria 7864
267 Ga0439457_003805 3300042014 Bacteria 4048
268 Ga0439462_0000125 3300042015 Bacteria 12008
269 Ga0439462_0026513 3300042015 Bacteria 1528
270 Ga0451577_0000023 3300042876 Bacteria 419051
271 Ga0451577_0044233 3300042876 Bacteria 3987
272 Ga0451577_0212361 3300042876 Bacteria 1748
273 Ga0453683_0000371 3300044673 Bacteria 53836
274 Ga0453684_0000036 3300044712 Bacteria 711481
275 Ga0453684_0000518 3300044712 Bacteria 147557
276 Ga0453684_0005534 3300044712 Bacteria 24928
277 Ga0453684_0008429 3300044712 Bacteria 18465
278 Ga0453684_0017639 3300044712 Bacteria 11037
279 Ga0453684_0025085 3300044712 Bacteria 8674
280 Ga0453684_0026507 3300044712 Bacteria 8364
281 Ga0453684_0061992 3300044712 Bacteria 4794
282 Ga0453684_0282787 3300044712 Bacteria 1891
283 Ga0466968_0051587 3300044735 Bacteria 1758
284 Ga0451576_0001463 3300045051 Bacteria 40109
285 Ga0451576_0010334 3300045051 Bacteria 10718
286 Ga0451576_0012400 3300045051 Bacteria 9573
287 Ga0451576_0023326 3300045051 Bacteria 6700
288 Ga0451576_0366712 3300045051 Bacteria 1508
289 Ga0451576_0472355 3300045051 Bacteria 1317
290 Ga0451576_0690744 3300045051 Bacteria 1072
291 Ga0495592_0231459 3300046454 Bacteria 1230
292 Ga0495651_0000539 3300046462 Bacteria 29212
293 Ga0495651_0004148 3300046462 Bacteria 11098
294 Ga0495651_0087362 3300046462 Bacteria 2345
295 Ga0495580_0443910 3300046472 Bacteria 871
296 Ga0495618_0158576 3300046514 Bacteria 1443
297 Ga0495628_0007168 3300046516 Bacteria 9654
298 Ga0495628_0183795 3300046516 Bacteria 1580
299 Ga0495630_0132306 3300046517 Bacteria 1895
300 Ga0495652_0000312 3300046529 Bacteria 57814
301 Ga0495652_0002485 3300046529 Bacteria 18928
302 Ga0495652_0241598 3300046529 Bacteria 1343
303 Ga0495586_0254046 3300046535 Bacteria 1003
304 Ga0495586_0313715 3300046535 Bacteria 899
305 Ga0495645_0001656 3300046543 Bacteria 15127
306 Ga0495645_0157034 3300046543 Bacteria 1575
307 Ga0495634_0020758 3300046642 Bacteria 4654
308 Ga0495635_0003448 3300046663 Bacteria 10934
309 Ga0495623_0058026 3300046679 Bacteria 2434
310 Ga0495623_0233148 3300046679 Bacteria 1043
311 Ga0495646_0177251 3300046680 Bacteria 1171
312 Ga0495600_0002719 3300046809 Bacteria 10230
313 Ga0495600_0039897 3300046809 Bacteria 3057
314 Ga0495604_0023367 3300047317 Bacteria 4931
315 Ga0495604_0197748 3300047317 Bacteria 1397
316 Ga0495674_0199397 3300047319 Bacteria 1661
317 Ga0495602_0124282 3300048088 Bacteria 2070
318 Ga0496100_0445489 3300048903 Bacteria 992
319 Ga0496101_0069208 3300048904 Bacteria 2582
320 Ga0496104_0000697 3300048907 Bacteria 28910
321 Ga0496104_0071647 3300048907 Bacteria 3295
322 Ga0496105_0007905 3300048908 Bacteria 8261
323 Ga0496106_0445522 3300048909 Bacteria 1040
324 Ga0496107_0174412 3300048910 Bacteria 1596
325 Ga0496108_0011089 3300048911 Bacteria 7320
326 Ga0496109_0038967 3300048912 Bacteria 4300
327 Ga0496110_0670755 3300048913 Bacteria 937
328 Ga0496112_0009212 3300048915 Bacteria 8873
329 Ga0496113_0125672 3300048916 Bacteria 2008
330 Ga0496115_0152424 3300048918 Bacteria 1909
331 Ga0496115_0395461 3300048918 Bacteria 1122
332 Ga0496116_0051501 3300048919 Bacteria 2734
333 Ga0501031_0020455 3300049568 Bacteria 4314
334 Ga0501032_0000458 3300049569 Bacteria 32900
335 Ga0501032_0000793 3300049569 Bacteria 25609
336 Ga0501033_0004889 3300049570 Bacteria 10667
337 Ga0501033_0017396 3300049570 Bacteria 5430
338 Ga0501034_0036612 3300049571 Bacteria 4969
339 Ga0501036_0005683 3300049572 Bacteria 10116
340 Ga0501036_0046786 3300049572 Bacteria 3664
341 Ga0501037_0004912 3300049573 Bacteria 9731
342 Ga0501038_0000927 3300049574 Bacteria 26060
343 Ga0501038_0322018 3300049574 Bacteria 1209
344 Ga0501039_0012081 3300049575 Bacteria 6585
345 Ga0501042_0000205 3300049578 Bacteria 28001
346 Ga0501043_0063762 3300049579 Bacteria 2893
347 Ga0501043_0064732 3300049579 Bacteria 2871
348 Ga0501043_0152126 3300049579 Bacteria 1811
349 Ga0501043_0236511 3300049579 Bacteria 1410
350 Ga0501046_0001224 3300049580 Bacteria 24859
351 Ga0501046_0002762 3300049580 Bacteria 16335
352 Ga0501046_0047819 3300049580 Unclassified 3390
353 Ga0501046_0338141 3300049580 Bacteria 1094
354 Ga0501047_0007795 3300049581 Bacteria 10080
355 Ga0501047_0027069 3300049581 Bacteria 5522
356 Ga0501047_0086126 3300049581 Bacteria 3019
357 Ga0501047_0373221 3300049581 Bacteria 1261
358 Ga0501048_0049213 3300049582 Bacteria 3004
359 Ga0501070_0151554 3300049586 Bacteria 1913
360 Ga0501070_0587242 3300049586 Bacteria 889
361 Ga0501073_0360218 3300049589 Bacteria 1004
362 Ga0501076_0081726 3300049592 Bacteria 2594
363 Ga0501076_0365973 3300049592 Bacteria 1185
364 Ga0501080_0134641 3300049742 Bacteria 2287
365 Ga0501083_0000961 3300049744 Bacteria 19059
366 Ga0501035_0009152 3300049822 Bacteria 9209
367 Ga0501035_0013873 3300049822 Bacteria 7436
368 Ga0501035_0057314 3300049822 Bacteria 3473
369 Ga0501035_0218135 3300049822 Bacteria 1630
370 Ga0501044_0001069 3300049823 Bacteria 32893
371 Ga0501044_0008690 3300049823 Bacteria 11114
372 Ga0501044_0255662 3300049823 Bacteria 1691
373 Ga0501045_0027777 3300049824 Bacteria 4080
374 nmdc:mga05p37_50649_c1 3300050507 Bacteria 5108
375 nmdc:mga09592_177949_c1 3300050508 Bacteria 1840
376 nmdc:mga09592_297515_c1 3300050508 Bacteria 1399
377 nmdc:mga06r32_989060_c1 3300050510 Bacteria 794
378 nmdc:mga08y16_39106_c1 3300050511 Bacteria 4978
379 nmdc:mga08y16_82528_c1 3300050511 Bacteria 3351
380 nmdc:mga0n895_168870_c1 3300050512 Unclassified 2220
381 nmdc:mga0n895_811_c1 3300050512 Bacteria 22369
382 nmdc:mga0rr50_115901_c1 3300050513 Bacteria 2126
383 nmdc:mga0rr50_122937_c1 3300050513 Bacteria 2068
384 nmdc:mga0rr50_989_c1 3300050513 Bacteria 15446
385 nmdc:mga08x19_174205_c1 3300050514 Bacteria 1466
386 nmdc:mga08x19_38133_c1 3300050514 Bacteria 3052
387 nmdc:mga0a205_237_c1 3300050515 Bacteria 38953
388 nmdc:mga0a205_268636_c1 3300050515 Unclassified 1583
389 Ga0495601_0042045 3300053077 Bacteria 2866
390 Ga0495612_0014497 3300053078 Bacteria 3169
391 Ga0495619_0017290 3300053085 Bacteria 4567
392 Ga0500616_0152325 3300053153 Bacteria 1069
393 Ga0501084_0551128 3300054114 Bacteria 974
394 Ga0501082_0144501 3300060353 Bacteria 2065
395 2788435437 2786546940 Bacteria 6396474
396 2857473293 2857472729 Bacteria 6568124
397 2873319271 2873314349 Bacteria 8512634
398 2895429142 2895427314 Bacteria 13147766
399 2904118021 2904113452 Bacteria 7796941
400 8057568754 8057568493 Bacteria 7221719
401 8057978457 8057977335 Bacteria 5694872
402 Ga0068869_100197092
403 JGI24736J21556_1018880
404 rootH2_10210983
405 rootL2_10072584
406 rootL2_10180304
407 rootH1_10011702
408 Ga0065712_10216238
409 Ga0070683_100001469
410 Ga0070689_100065408
411 Ga0070687_100170902
412 Ga0070692_10243988
413 Ga0070675_100108001
414 Ga0070688_100030595
415 Ga0070709_10012040
416 Ga0070710_10078493
417 Ga0070711_100070383
418 Ga0070711_100079688
419 Ga0070711_100639111
420 Ga0070705_100130354
421 Ga0070705_100153359
422 Ga0070694_100111015
423 Ga0070694_100176863
424 Ga0070694_100372964
425 Ga0070708_100158485
426 Ga0070708_100633317
427 Ga0070663_100081681
428 Ga0070662_100689545
429 Ga0070706_100004261
430 Ga0070698_100080063
431 Ga0070698_100190298
432 Ga0070698_100215105
433 Ga0070679_100035938
434 Ga0070697_100193111
435 Ga0070697_100286411
436 Ga0068853_100131130
437 Ga0070695_100093239
438 Ga0070695_100230892
439 Ga0070695_100239074
440 Ga0070696_100391936
441 Ga0070665_100215581
442 Ga0070704_100075471
443 Ga0068855_100052129
444 Ga0068856_100180152
445 Ga0068856_100294671
446 Ga0068859_100000015
447 Ga0068859_100025126
448 Ga0068859_100148949
449 Ga0068864_100017439
450 Ga0068863_100376521
451 Ga0068858_100005489
452 Ga0068860_100343008
453 Ga0068862_100032701
454 Ga0068862_100440619
455 Ga0081540_1044149
456 Ga0075432_10087079
457 Ga0070715_10003104
458 Ga0070716_100020671
459 Ga0070716_100039947
460 Ga0070712_100459516
461 Ga0075428_100443603
462 Ga0075433_10001499
463 Ga0075433_10151297
464 Ga0075434_100011777
465 Ga0075434_100211126
466 Ga0075434_100228729
467 Ga0075429_100062474
468 Ga0075429_100580513
469 Ga0068865_100691375
470 Ga0075436_100006339
471 Ga0075436_100045616
472 Ga0075436_100153048
473 Ga0097620_100000015
474 Ga0097620_100025125
475 Ga0097620_100148948
476 Ga0075435_100001245
477 Ga0075435_100076425
478 Ga0105240_10006520
479 Ga0105240_10012987
480 Ga0111539_10018057
481 Ga0111539_10200851
482 Ga0105245_10855717
483 Ga0114129_10058563
484 Ga0105241_10024181
485 Ga0105248_10043102
486 Ga0105237_10037823
487 Ga0105238_10003751
488 Ga0105239_10023045
489 Ga0105239_10081794
490 Ga0157370_10474821
491 Ga0157369_10248913
492 Ga0157374_10095744
493 Ga0157378_10720194
494 Ga0157372_10528111
495 Ga0163163_10069329
496 Ga0163163_10456874
497 Ga0163163_10505580
498 Ga0163163_10691514
499 Ga0157379_10001570
500 Ga0157379_10452471
501 Ga0157376_10775009
502 Ga0157376_10887943
503 Ga0197907_10076236
504 Ga0206356_11798851
505 Ga0206356_11841100
506 Ga0206352_11224283
507 Ga0213875_10003458
508 Ga0224712_10024015
509 Ga0224712_10268390
510 Ga0207692_10082564
511 Ga0207710_10093802
512 Ga0207647_10007169
513 Ga0207699_10000694
514 Ga0207699_10004759
515 Ga0207684_10003985
516 Ga0207654_10020176
517 Ga0207695_10002744
518 Ga0207695_10056993
519 Ga0207671_10000482
520 Ga0207693_10023606
521 Ga0207663_10043209
522 Ga0207663_10052939
523 Ga0207663_10059818
524 Ga0207652_10024748
525 Ga0207646_10663233
526 Ga0207694_10101390
527 Ga0207700_10042537
528 Ga0207700_10269914
529 Ga0207664_10001833
530 Ga0207709_10075485
531 Ga0207670_10050919
532 Ga0207704_10213692
533 Ga0207665_10003653
534 Ga0207665_10044949
535 Ga0207689_10206833
536 Ga0207661_10010070
537 Ga0207667_10029756
538 Ga0207667_10394561
539 Ga0207668_10575855
540 Ga0207703_10002375
541 Ga0207703_10061516
542 Ga0207639_10107110
543 Ga0207678_10086713
544 Ga0207702_10154201
545 Ga0207702_10187279
546 Ga0207641_10107490
547 Ga0207676_10582809
548 Ga0207675_100032055
549 Ga0207428_10035532
550 Ga0207428_10106927
551 Ga0268265_10423286
552 Ga0268265_10850907
553 Ga0265337_1001010
554 Ga0265337_1003407
555 Ga0265337_1018528
556 Ga0265337_1036961
557 Ga0265326_10017423
558 Ga0265319_1000024
559 Ga0265319_1000657
560 Ga0265319_1005808
561 Ga0265319_1008700
562 Ga0265319_1025317
563 Ga0265319_1032172
564 Ga0265334_10002242
565 Ga0265334_10006088
566 Ga0265334_10010090
567 Ga0265318_10000022
568 Ga0265318_10000157
569 Ga0265318_10005419
570 Ga0265318_10007295
571 Ga0265318_10034386
572 Ga0265318_10047053
573 Ga0265323_10000004
574 Ga0265323_10001121
575 Ga0265323_10004867
576 Ga0265323_10036053
577 Ga0265323_10068809
578 Ga0265322_10006496
579 Ga0265322_10007599
580 Ga0265336_10006690
581 Ga0265336_10007991
582 Ga0265336_10038461
583 Ga0265336_10057636
584 Ga0307515_10080808
585 Ga0265338_10000678
586 Ga0265338_10001254
587 Ga0265338_10007281
588 Ga0265338_10014448
589 Ga0265338_10014844
590 Ga0265338_10324034
591 Ga0265324_10001378
592 Ga0265324_10021047
593 Ga0265324_10063365
594 Ga0265330_10051175
595 Ga0265330_10163480
596 Ga0265330_10193960
597 Ga0265332_10020633
598 Ga0265332_10061234
599 Ga0265332_10071004
600 Ga0265332_10146246
601 Ga0265328_10010411
602 Ga0265320_10000309
603 Ga0265320_10002691
604 Ga0265320_10008469
605 Ga0265320_10010602
606 Ga0265320_10013383
607 Ga0265320_10017211
608 Ga0265320_10019544
609 Ga0265320_10024781
610 Ga0265320_10067821
611 Ga0265325_10002540
612 Ga0265325_10042325
613 Ga0265340_10002100
614 Ga0265339_10020781
615 Ga0265339_10060564
616 Ga0265331_10087557
617 Ga0265327_10000061
618 Ga0265327_10000450
619 Ga0265327_10005466
620 Ga0265327_10019526
621 Ga0265327_10028450
622 Ga0265327_10030114
623 Ga0265316_10016271
624 Ga0265316_10016820
625 Ga0265316_10025137
626 Ga0265316_10026614
627 Ga0265316_10046700
628 Ga0265316_10100515
629 Ga0265316_10103549
630 Ga0265316_10116542
631 Ga0265316_10147160
632 Ga0307509_10033544
633 Ga0265313_10000971
634 Ga0265313_10004436
635 Ga0265313_10006472
636 Ga0265313_10009040
637 Ga0265313_10038652
638 Ga0265313_10053676
639 Ga0307508_10000554
640 Ga0265314_10001225
641 Ga0265314_10003672
642 Ga0265314_10008487
643 Ga0265314_10009302
644 Ga0265314_10050381
645 Ga0265314_10273457
646 Ga0265342_10003580
647 Ga0265342_10017871
648 Ga0265342_10158576
649 Ga0265342_10192196
650 Ga0316578_10026643
651 Ga0316577_10008335
652 Ga0316583_10012724
653 Ga0316583_10041165
654 Ga0373931_0095361
655 Ga0373937_0564518
656 Ga0316584_0000303
657 Ga0395905_0000026
658 Ga0436364_1479397
659 Ga0439436_0001979
660 Ga0439439_0001533
661 Ga0451837_0755298
662 Ga0451837_1776499
663 Ga0451841_0626265
664 Ga0439433_0010718
665 Ga0439448_0058864
666 Ga0439449_0000028
667 Ga0439449_0002082
668 Ga0439457_003805
669 Ga0439462_0000125
670 Ga0439462_0026513
671 Ga0451577_0000023
672 Ga0451577_0044233
673 Ga0451577_0212361
674 Ga0453683_0000371
675 Ga0453684_0000036
676 Ga0453684_0000518
677 Ga0453684_0005534
678 Ga0453684_0008429
679 Ga0453684_0017639
680 Ga0453684_0025085
681 Ga0453684_0026507
682 Ga0453684_0061992
683 Ga0453684_0282787
684 Ga0466968_0051587
685 Ga0451576_0001463
686 Ga0451576_0010334
687 Ga0451576_0012400
688 Ga0451576_0023326
689 Ga0451576_0366712
690 Ga0451576_0472355
691 Ga0451576_0690744
692 Ga0495592_0231459
693 Ga0495651_0000539
694 Ga0495651_0004148
695 Ga0495651_0087362
696 Ga0495580_0443910
697 Ga0495618_0158576
698 Ga0495628_0007168
699 Ga0495628_0183795
700 Ga0495630_0132306
701 Ga0495652_0000312
702 Ga0495652_0002485
703 Ga0495652_0241598
704 Ga0495586_0254046
705 Ga0495586_0313715
706 Ga0495645_0001656
707 Ga0495645_0157034
708 Ga0495634_0020758
709 Ga0495635_0003448
710 Ga0495623_0058026
711 Ga0495623_0233148
712 Ga0495646_0177251
713 Ga0495600_0002719
714 Ga0495600_0039897
715 Ga0495604_0023367
716 Ga0495604_0197748
717 Ga0495674_0199397
718 Ga0495602_0124282
719 Ga0496100_0445489
720 Ga0496101_0069208
721 Ga0496104_0000697
722 Ga0496104_0071647
723 Ga0496105_0007905
724 Ga0496106_0445522
725 Ga0496107_0174412
726 Ga0496108_0011089
727 Ga0496109_0038967
728 Ga0496110_0670755
729 Ga0496112_0009212
730 Ga0496113_0125672
731 Ga0496115_0152424
732 Ga0496115_0395461
733 Ga0496116_0051501
734 Ga0501031_0020455
735 Ga0501032_0000458
736 Ga0501032_0000793
737 Ga0501033_0004889
738 Ga0501033_0017396
739 Ga0501034_0036612
740 Ga0501036_0005683
741 Ga0501036_0046786
742 Ga0501037_0004912
743 Ga0501038_0000927
744 Ga0501038_0322018
745 Ga0501039_0012081
746 Ga0501042_0000205
747 Ga0501043_0063762
748 Ga0501043_0064732
749 Ga0501043_0152126
750 Ga0501043_0236511
751 Ga0501046_0001224
752 Ga0501046_0002762
753 Ga0501046_0047819
754 Ga0501046_0338141
755 Ga0501047_0007795
756 Ga0501047_0027069
757 Ga0501047_0086126
758 Ga0501047_0373221
759 Ga0501048_0049213
760 Ga0501070_0151554
761 Ga0501070_0587242
762 Ga0501073_0360218
763 Ga0501076_0081726
764 Ga0501076_0365973
765 Ga0501080_0134641
766 Ga0501083_0000961
767 Ga0501035_0009152
768 Ga0501035_0013873
769 Ga0501035_0057314
770 Ga0501035_0218135
771 Ga0501044_0001069
772 Ga0501044_0008690
773 Ga0501044_0255662
774 Ga0501045_0027777
775 nmdc:mga05p37_50649_c1
776 nmdc:mga09592_177949_c1
777 nmdc:mga09592_297515_c1
778 nmdc:mga06r32_989060_c1
779 nmdc:mga08y16_39106_c1
780 nmdc:mga08y16_82528_c1
781 nmdc:mga0n895_168870_c1
782 nmdc:mga0n895_811_c1
783 nmdc:mga0rr50_115901_c1
784 nmdc:mga0rr50_122937_c1
785 nmdc:mga0rr50_989_c1
786 nmdc:mga08x19_174205_c1
787 nmdc:mga08x19_38133_c1
788 nmdc:mga0a205_237_c1
789 nmdc:mga0a205_268636_c1
790 Ga0495601_0042045
791 Ga0495612_0014497
792 Ga0495619_0017290
793 Ga0500616_0152325
794 Ga0501084_0551128
795 Ga0501082_0144501
796 2788435437
797 2857473293
798 2873319271
799 2895429142
800 2904118021
801 8057568754
802 8057978457

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

17

88

0.98

PF01709

Transcrip_reg

TACO1/YebC second and third domain

94

250

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.9267 17 243
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.8947 27 240
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.8682 27 240
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.8612 17 243
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.8242 3 245
ID Description Score Start End Superfamily
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9805 25 74 1.10.10.200
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9603 84 243 3.30.70.980
1lfpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9305 19 79 1.10.10.200
1mw7A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9278 84 240 3.30.70.980
1mw7A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9178 84 240 3.30.70.980
ID Description Score Start End GO Terms
AF-A0A7K2IHG8-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9919 23 251 GO:0003677
GO:0005829
GO:0006355
AF-A0A7K2IHG8-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9833 23 251 GO:0003677
GO:0005829
GO:0006355
AF-A0A3E2D882-F1-model_v4 deleted 0.9758 35 250
AF-A0A1H7RJW0-F1-model_v4 Probable transcriptional regulatory protein SAMN05444354_10776 0.9629 21 249 GO:0003677
GO:0005829
GO:0006355
AF-A0A7W4MPV7-F1-model_v4 deleted 0.9598 25 251

Map