F434740

General Info

Members Datasets Scaffolds Average Seq Length
401 223 802 273

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10181770|Ga0065712_101817701
Length 292
Sequence VGQVGLPAPTCPIYQTHMNAVPLVLYVCALGAYSWHFAQRNPAIGRSATTLLVAAALSHTFVIGMQTMEVGHVPVAGATSAISTFVWLLALSYLYVEMTTDERAMGVFILPLLVALQAIPGFRPGVEDRAAVLQGPLFGVHVSSLLFAYASFALACVIGITYVLLFKEIKAKHLGFFYARLPSLQVLDGMNQRAIIIGWVFLTIGIIVGGIWAAQARAGYGAADPRVQAISLEDPKIFVALLCWFVYSFELFAARRIGWGGRRAAYLSALGFVIVLFNFVPITYFFSKSHNF

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
138 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
139 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
140 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
141 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
142 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
143 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
153 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
160 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
161 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.49
Rhizosphere 96.26
Stem 0
Stem Tuber 0
Unclassified 7.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10181770 3300005290 Bacteria 1184
2 Ga0058861_11336912 3300004800 Bacteria 1825
3 Ga0065712_10000469 3300005290 Bacteria 10930
4 Ga0065712_10074533 3300005290 Bacteria 4072
5 Ga0065707_10180937 3300005295 Bacteria 1418
6 Ga0070658_10093985 3300005327 Bacteria 2473
7 Ga0070676_10021619 3300005328 Unclassified 3602
8 Ga0070683_100108279 3300005329 Unclassified 2621
9 Ga0070690_100313331 3300005330 Bacteria 1128
10 Ga0070670_100025415 3300005331 Bacteria 5096
11 Ga0070670_100158753 3300005331 Bacteria 1959
12 Ga0070670_100176678 3300005331 Bacteria 1853
13 Ga0070677_10026810 3300005333 Bacteria 2164
14 Ga0068869_100075293 3300005334 Bacteria 2508
15 Ga0070666_10017629 3300005335 Bacteria 4581
16 Ga0070666_10077436 3300005335 Bacteria 2270
17 Ga0070680_100314500 3300005336 Bacteria 1329
18 Ga0070682_100394404 3300005337 Bacteria 1045
19 Ga0070660_100004094 3300005339 Bacteria 10060
20 Ga0070660_100103026 3300005339 Bacteria 2263
21 Ga0070689_100082032 3300005340 Bacteria 2532
22 Ga0070691_10011418 3300005341 Bacteria 4056
23 Ga0070668_100044012 3300005347 Bacteria 3423
24 Ga0070668_100344739 3300005347 Bacteria 1259
25 Ga0070669_100008124 3300005353 Bacteria 7497
26 Ga0070669_100024208 3300005353 Bacteria 4353
27 Ga0070669_100052785 3300005353 Bacteria 2975
28 Ga0070675_100000896 3300005354 Bacteria 21182
29 Ga0070675_100164092 3300005354 Bacteria 1912
30 Ga0070671_100013867 3300005355 Bacteria 6502
31 Ga0070671_100119542 3300005355 Bacteria 2217
32 Ga0070674_100002488 3300005356 Bacteria 10205
33 Ga0070673_100008964 3300005364 Bacteria 6690
34 Ga0070688_100023293 3300005365 Bacteria 3641
35 Ga0070659_100366282 3300005366 Bacteria 1212
36 Ga0070667_100034399 3300005367 Bacteria 4239
37 Ga0070709_10036826 3300005434 Bacteria 2984
38 Ga0070713_100008511 3300005436 Bacteria 7280
39 Ga0070710_10140006 3300005437 Bacteria 1483
40 Ga0070701_10005961 3300005438 Bacteria 5089
41 Ga0070711_100597920 3300005439 Unclassified 920
42 Ga0070705_100007085 3300005440 Bacteria 5513
43 Ga0070705_100153146 3300005440 Bacteria 1532
44 Ga0070694_100049860 3300005444 Bacteria 2820
45 Ga0070708_100568903 3300005445 Bacteria 1069
46 Ga0070678_100023066 3300005456 Bacteria 4140
47 Ga0070678_100372082 3300005456 Bacteria 1234
48 Ga0070681_10001072 3300005458 Bacteria 23292
49 Ga0070681_10114700 3300005458 Bacteria 2633
50 Ga0070681_10184033 3300005458 Bacteria 2010
51 Ga0068867_100041985 3300005459 Bacteria 3343
52 Ga0068867_100320489 3300005459 Bacteria 1284
53 Ga0070698_100171467 3300005471 Bacteria 2110
54 Ga0070699_100010132 3300005518 Bacteria 8159
55 Ga0070679_100048291 3300005530 Bacteria 4241
56 Ga0070679_100486791 3300005530 Bacteria 1178
57 Ga0070684_100054882 3300005535 Bacteria 3472
58 Ga0070697_100546069 3300005536 Unclassified 1016
59 Ga0070686_100048384 3300005544 Bacteria 2693
60 Ga0070686_100455462 3300005544 Bacteria 984
61 Ga0070696_100055899 3300005546 Bacteria 2753
62 Ga0070693_100269939 3300005547 Bacteria 1135
63 Ga0070665_100072045 3300005548 Bacteria 3463
64 Ga0070665_100077009 3300005548 Bacteria 3341
65 Ga0070665_100082335 3300005548 Unclassified 3223
66 Ga0070665_100487571 3300005548 Bacteria 1243
67 Ga0068855_100007514 3300005563 Bacteria 13193
68 Ga0068855_100365916 3300005563 Bacteria 1586
69 Ga0070664_100424137 3300005564 Unclassified 1219
70 Ga0068854_100493808 3300005578 Bacteria 1030
71 Ga0068852_100766270 3300005616 Bacteria 978
72 Ga0068859_100006201 3300005617 Bacteria 12147
73 Ga0068864_100004916 3300005618 Bacteria 10948
74 Ga0068864_100021184 3300005618 Bacteria 5444
75 Ga0068864_100176154 3300005618 Bacteria 1953
76 Ga0068864_100507170 3300005618 Unclassified 1161
77 Ga0068866_10009691 3300005718 Bacteria 4100
78 Ga0068866_10075987 3300005718 Bacteria 1790
79 Ga0068861_100017287 3300005719 Bacteria 5116
80 Ga0068863_100024470 3300005841 Bacteria 5758
81 Ga0068863_100072380 3300005841 Bacteria 3261
82 Ga0068863_100169770 3300005841 Bacteria 2092
83 Ga0068863_100464060 3300005841 Unclassified 1244
84 Ga0068858_100000616 3300005842 Bacteria 37281
85 Ga0068858_100116369 3300005842 Bacteria 2499
86 Ga0068858_100384617 3300005842 Bacteria 1347
87 Ga0068858_100541541 3300005842 Bacteria 1127
88 Ga0068860_100108390 3300005843 Bacteria 2654
89 Ga0068860_100205697 3300005843 Bacteria 1909
90 Ga0068860_100273828 3300005843 Unclassified 1648
91 Ga0068862_100517561 3300005844 Unclassified 1135
92 Ga0068862_100587572 3300005844 Bacteria 1067
93 Ga0068862_100598067 3300005844 Bacteria 1058
94 Ga0081455_10084117 3300005937 Bacteria 2598
95 Ga0097621_100005478 3300006237 Bacteria 8937
96 Ga0097621_100067386 3300006237 Bacteria 2950
97 Ga0097621_100217949 3300006237 Bacteria 1662
98 Ga0068871_100000646 3300006358 Bacteria 23974
99 Ga0068871_100001797 3300006358 Bacteria 14469
100 Ga0068871_100008530 3300006358 Bacteria 7366
101 Ga0068871_100165550 3300006358 Bacteria 1893
102 Ga0068871_100388385 3300006358 Bacteria 1241
103 Ga0075428_100721449 3300006844 Bacteria 1061
104 Ga0075433_10025574 3300006852 Bacteria 4991
105 Ga0075433_10055780 3300006852 Bacteria 3450
106 Ga0075433_10199953 3300006852 Unclassified 1777
107 Ga0075433_10258676 3300006852 Bacteria 1544
108 Ga0075434_100001702 3300006871 Bacteria 18830
109 Ga0075434_100017845 3300006871 Bacteria 6845
110 Ga0075434_100141312 3300006871 Bacteria 2428
111 Ga0075434_100272206 3300006871 Bacteria 1713
112 Ga0068865_100025421 3300006881 Bacteria 3895
113 Ga0075436_100000461 3300006914 Bacteria 26318
114 Ga0075436_100062696 3300006914 Bacteria 2569
115 Ga0075436_100149846 3300006914 Unclassified 1641
116 Ga0097620_100006201 3300006931 Bacteria 12147
117 Ga0075435_100000062 3300007076 Bacteria 55669
118 Ga0075435_100002785 3300007076 Bacteria 11683
119 Ga0075435_100003998 3300007076 Bacteria 10075
120 Ga0075435_100028930 3300007076 Bacteria 4348
121 Ga0075435_100105031 3300007076 Bacteria 2344
122 Ga0099794_10096590 3300007265 Bacteria 1471
123 Ga0105240_10537729 3300009093 Bacteria 1295
124 Ga0111539_10000586 3300009094 Bacteria 46881
125 Ga0111539_10015763 3300009094 Bacteria 9389
126 Ga0111539_10122839 3300009094 Bacteria 3043
127 Ga0111539_10455642 3300009094 Bacteria 1489
128 Ga0105247_10040166 3300009101 Unclassified 2859
129 Ga0105247_10101739 3300009101 Bacteria 1838
130 Ga0105247_10226152 3300009101 Bacteria 1269
131 Ga0114129_10001999 3300009147 Bacteria 27921
132 Ga0114129_10027653 3300009147 Bacteria 8030
133 Ga0114129_10029471 3300009147 Bacteria 7774
134 Ga0114129_10031325 3300009147 Bacteria 7519
135 Ga0114129_10073712 3300009147 Bacteria 4756
136 Ga0114129_10248362 3300009147 Bacteria 2389
137 Ga0105243_10032716 3300009148 Bacteria 4020
138 Ga0105243_10062653 3300009148 Bacteria 2978
139 Ga0105243_10276784 3300009148 Bacteria 1510
140 Ga0105241_10429366 3300009174 Bacteria 1165
141 Ga0105242_10005136 3300009176 Bacteria 10096
142 Ga0105242_10007220 3300009176 Bacteria 8566
143 Ga0105248_10014477 3300009177 Bacteria 8683
144 Ga0105248_10016407 3300009177 Bacteria 8151
145 Ga0105248_10022714 3300009177 Bacteria 6962
146 Ga0105248_10039880 3300009177 Bacteria 5264
147 Ga0105248_10121919 3300009177 Bacteria 2941
148 Ga0105248_10157392 3300009177 Bacteria 2563
149 Ga0105248_10301934 3300009177 Bacteria 1803
150 Ga0105237_10384386 3300009545 Bacteria 1409
151 Ga0105238_10273208 3300009551 Bacteria 1671
152 Ga0105246_10397807 3300011119 Bacteria 1143
153 Ga0157374_10584180 3300013296 Bacteria 1126
154 Ga0157378_10024826 3300013297 Bacteria 5278
155 Ga0157378_10192867 3300013297 Bacteria 1923
156 Ga0163162_10045930 3300013306 Bacteria 4377
157 Ga0163162_10289669 3300013306 Bacteria 1769
158 Ga0157375_10426437 3300013308 Bacteria 1492
159 Ga0163163_10037182 3300014325 Bacteria 4735
160 Ga0163163_10099232 3300014325 Bacteria 2934
161 Ga0163163_10300594 3300014325 Bacteria 1657
162 Ga0157377_10002534 3300014745 Bacteria 8101
163 Ga0157379_10014020 3300014968 Bacteria 7023
164 Ga0157379_10048285 3300014968 Bacteria 3799
165 Ga0157376_10016431 3300014969 Bacteria 5619
166 Ga0157376_10027451 3300014969 Bacteria 4513
167 Ga0157376_10091345 3300014969 Bacteria 2637
168 Ga0163161_10301626 3300017792 Bacteria 1262
169 Ga0207682_10065088 3300025893 Bacteria 1534
170 Ga0207682_10164413 3300025893 Bacteria 1007
171 Ga0207692_10108670 3300025898 Bacteria 1535
172 Ga0207642_10038305 3300025899 Bacteria 2074
173 Ga0207642_10164840 3300025899 Bacteria 1193
174 Ga0207710_10054646 3300025900 Bacteria 1799
175 Ga0207680_10029737 3300025903 Bacteria 3073
176 Ga0207680_10055870 3300025903 Bacteria 2381
177 Ga0207699_10029415 3300025906 Bacteria 3064
178 Ga0207645_10000630 3300025907 Bacteria 29240
179 Ga0207705_10026735 3300025909 Bacteria 4113
180 Ga0207707_10103130 3300025912 Bacteria 2493
181 Ga0207707_10213683 3300025912 Bacteria 1680
182 Ga0207660_10132654 3300025917 Bacteria 1897
183 Ga0207662_10005935 3300025918 Bacteria 6557
184 Ga0207657_10002909 3300025919 Bacteria 18389
185 Ga0207657_10097611 3300025919 Bacteria 2443
186 Ga0207652_10050146 3300025921 Bacteria 3575
187 Ga0207681_10005575 3300025923 Bacteria 7731
188 Ga0207681_10008723 3300025923 Bacteria 6193
189 Ga0207681_10021204 3300025923 Bacteria 4127
190 Ga0207681_10052284 3300025923 Bacteria 2770
191 Ga0207694_10214917 3300025924 Bacteria 1567
192 Ga0207650_10035374 3300025925 Bacteria 3626
193 Ga0207659_10000548 3300025926 Bacteria 22447
194 Ga0207659_10113982 3300025926 Bacteria 2060
195 Ga0207687_10075887 3300025927 Bacteria 2413
196 Ga0207700_10007165 3300025928 Bacteria 6798
197 Ga0207706_10236288 3300025933 Bacteria 1598
198 Ga0207686_10020786 3300025934 Bacteria 3755
199 Ga0207686_10039256 3300025934 Bacteria 2872
200 Ga0207709_10021627 3300025935 Bacteria 3642
201 Ga0207709_10026591 3300025935 Bacteria 3326
202 Ga0207670_10080348 3300025936 Bacteria 2279
203 Ga0207669_10059520 3300025937 Bacteria 2337
204 Ga0207704_10056799 3300025938 Bacteria 2400
205 Ga0207691_10007685 3300025940 Bacteria 10379
206 Ga0207711_10007745 3300025941 Bacteria 8973
207 Ga0207711_10067454 3300025941 Bacteria 3097
208 Ga0207711_10166580 3300025941 Bacteria 1998
209 Ga0207711_10280165 3300025941 Bacteria 1535
210 Ga0207711_10441409 3300025941 Bacteria 1211
211 Ga0207689_10278572 3300025942 Bacteria 1385
212 Ga0207679_10061888 3300025945 Bacteria 2788
213 Ga0207667_10078804 3300025949 Bacteria 3414
214 Ga0207667_10425116 3300025949 Bacteria 1351
215 Ga0207651_10015299 3300025960 Bacteria 4455
216 Ga0207651_10398025 3300025960 Bacteria 1171
217 Ga0207668_10072496 3300025972 Bacteria 2464
218 Ga0207668_10116970 3300025972 Bacteria 2011
219 Ga0207640_10237320 3300025981 Bacteria 1407
220 Ga0207640_10362524 3300025981 Unclassified 1168
221 Ga0207658_10049826 3300025986 Bacteria 3079
222 Ga0207703_10006628 3300026035 Bacteria 9239
223 Ga0207703_10021226 3300026035 Bacteria 5083
224 Ga0207703_10063925 3300026035 Bacteria 3019
225 Ga0207703_10095701 3300026035 Bacteria 2505
226 Ga0207703_10308283 3300026035 Bacteria 1446
227 Ga0207639_10620899 3300026041 Bacteria 998
228 Ga0207708_10013678 3300026075 Bacteria 6064
229 Ga0207708_10144282 3300026075 Bacteria 1870
230 Ga0207702_10448423 3300026078 Bacteria 1251
231 Ga0207641_10004863 3300026088 Bacteria 11561
232 Ga0207641_10123083 3300026088 Bacteria 2318
233 Ga0207641_10459975 3300026088 Bacteria 1231
234 Ga0207648_10017427 3300026089 Bacteria 6536
235 Ga0207648_10251753 3300026089 Bacteria 1575
236 Ga0207676_10054458 3300026095 Bacteria 3136
237 Ga0207674_10118217 3300026116 Bacteria 2621
238 Ga0207675_100002071 3300026118 Bacteria 19965
239 Ga0207675_100019224 3300026118 Bacteria 6374
240 Ga0207675_100496346 3300026118 Bacteria 1215
241 Ga0207675_100751548 3300026118 Bacteria 986
242 Ga0207683_10041670 3300026121 Bacteria 4010
243 Ga0207428_10010394 3300027907 Bacteria 8316
244 Ga0207428_10017926 3300027907 Bacteria 6067
245 Ga0207428_10072658 3300027907 Bacteria 2700
246 Ga0207428_10221104 3300027907 Bacteria 1419
247 Ga0268265_10012233 3300028380 Bacteria 5812
248 Ga0268265_10040476 3300028380 Bacteria 3442
249 Ga0268265_10060559 3300028380 Bacteria 2901
250 Ga0268265_10284629 3300028380 Bacteria 1481
251 Ga0268265_10313728 3300028380 Bacteria 1417
252 Ga0268264_10112297 3300028381 Bacteria 2389
253 Ga0268264_10121093 3300028381 Unclassified 2306
254 Ga0268264_10501066 3300028381 Bacteria 1184
255 Ga0307412_10482182 3300031911 Unclassified 1029
256 Ga0373958_0001574 3300034819 Bacteria 3089
257 Ga0373959_0006022 3300034820 Bacteria 2000
258 Ga0373938_0001476 3300034957 Bacteria 3768
259 Ga0373929_0002426 3300035085 Bacteria 3422
260 Ga0373940_0001022 3300035088 Bacteria 4805
261 Ga0373949_0000620 3300035090 Bacteria 11604
262 Ga0373951_0001255 3300035091 Bacteria 6712
263 Ga0373932_0000405 3300035112 Bacteria 13256
264 Ga0373936_0123314 3300035113 Bacteria 1109
265 Ga0373939_0000522 3300035114 Bacteria 9653
266 Ga0373939_0010200 3300035114 Bacteria 2343
267 Ga0373945_0046931 3300035116 Bacteria 1578
268 Ga0373953_0118185 3300035117 Bacteria 1125
269 Ga0373957_0090496 3300035120 Bacteria 1216
270 Ga0373960_0000106 3300035121 Bacteria 13291
271 Ga0373943_0132944 3300035170 Unclassified 1333
272 Ga0373942_0000131 3300035207 Bacteria 17649
273 Ga0373961_0001061 3300035241 Bacteria 8844
274 Ga0373962_0000857 3300035242 Bacteria 6937
275 Ga0373931_0002905 3300035691 Bacteria 7643
276 Ga0373947_0021588 3300035725 Bacteria 3727
277 Ga0373947_0150428 3300035725 Bacteria 1499
278 Ga0373947_0296948 3300035725 Unclassified 1076
279 Ga0373937_0084364 3300036401 Bacteria 2939
280 Ga0373937_0100318 3300036401 Bacteria 2687
281 Ga0373937_0204308 3300036401 Bacteria 1858
282 Ga0373937_0353894 3300036401 Bacteria 1391
283 Ga0451853_0662596 3300041512 Bacteria 1561
284 Ga0439450_031277 3300042008 Unclassified 1198
285 Ga0439435_0017954 3300042436 Unclassified 1795
286 Ga0439435_0033663 3300042436 Bacteria 1404
287 Ga0439460_0016491 3300042461 Bacteria 1968
288 Ga0451577_0012114 3300042876 Bacteria 8111
289 Ga0466963_0091703 3300044694 Bacteria 2070
290 Ga0453684_0103661 3300044712 Bacteria 3475
291 Ga0451576_0061869 3300045051 Bacteria 3903
292 Ga0451576_0192733 3300045051 Bacteria 2129
293 Ga0495592_0365923 3300046454 Bacteria 921
294 Ga0495603_0083961 3300046455 Bacteria 1865
295 Ga0495580_0192452 3300046472 Bacteria 1407
296 Ga0495582_0056221 3300046473 Bacteria 2169
297 Ga0495628_0432554 3300046516 Bacteria 958
298 Ga0495630_0337977 3300046517 Bacteria 1152
299 Ga0495640_0256103 3300046533 Unclassified 1095
300 Ga0495645_0022567 3300046543 Bacteria 4554
301 Ga0495656_0175729 3300046615 Bacteria 1050
302 Ga0495656_0196436 3300046615 Bacteria 999
303 Ga0495634_0052595 3300046642 Bacteria 2730
304 Ga0495634_0328130 3300046642 Unclassified 920
305 Ga0495658_0076493 3300046683 Bacteria 1956
306 Ga0495658_0089751 3300046683 Bacteria 1818
307 Ga0495658_0109080 3300046683 Bacteria 1662
308 Ga0495613_0121280 3300046689 Bacteria 1877
309 Ga0495680_0124896 3300047322 Bacteria 1897
310 Ga0495684_0368501 3300047471 Unclassified 1016
311 Ga0496101_0001786 3300048904 Bacteria 12936
312 Ga0496104_0003527 3300048907 Bacteria 13490
313 Ga0496104_0098916 3300048907 Bacteria 2793
314 Ga0496104_0388025 3300048907 Bacteria 1309
315 Ga0496105_0216455 3300048908 Bacteria 1560
316 Ga0496108_0024115 3300048911 Bacteria 5008
317 Ga0496109_0090255 3300048912 Bacteria 2834
318 Ga0496110_0145537 3300048913 Bacteria 2143
319 Ga0496111_0058417 3300048914 Bacteria 2793
320 Ga0496111_0174877 3300048914 Bacteria 1596
321 Ga0496112_0008000 3300048915 Bacteria 9431
322 Ga0496113_0369507 3300048916 Bacteria 1151
323 Ga0496114_0000405 3300048917 Bacteria 31894
324 Ga0496115_0494861 3300048918 Bacteria 983
325 Ga0501033_0039392 3300049570 Bacteria 3530
326 Ga0501034_0015914 3300049571 Bacteria 7720
327 Ga0501038_0035686 3300049574 Bacteria 4365
328 Ga0501038_0090293 3300049574 Bacteria 2568
329 Ga0501039_0033302 3300049575 Bacteria 3974
330 Ga0501040_0002974 3300049576 Bacteria 10966
331 Ga0501041_0004309 3300049577 Bacteria 8233
332 Ga0501041_0017746 3300049577 Bacteria 4236
333 Ga0501042_0004718 3300049578 Bacteria 8700
334 Ga0501042_0168676 3300049578 Bacteria 1580
335 Ga0501043_0046307 3300049579 Unclassified 3420
336 Ga0501046_0008680 3300049580 Bacteria 8833
337 Ga0501047_0210860 3300049581 Bacteria 1801
338 Ga0501048_0074352 3300049582 Bacteria 2398
339 Ga0501048_0565919 3300049582 Bacteria 816
340 Ga0501069_0235696 3300049585 Bacteria 1066
341 Ga0501070_0242062 3300049586 Unclassified 1477
342 Ga0501071_0004250 3300049587 Bacteria 9073
343 Ga0501072_0005832 3300049588 Bacteria 9384
344 Ga0501072_0202340 3300049588 Bacteria 1583
345 Ga0501074_0011098 3300049590 Bacteria 6543
346 Ga0501075_0000537 3300049591 Bacteria 22963
347 Ga0501075_0114701 3300049591 Bacteria 2048
348 Ga0501075_0290164 3300049591 Bacteria 1246
349 Ga0501076_0002420 3300049592 Bacteria 12793
350 Ga0501076_0011322 3300049592 Bacteria 6640
351 Ga0501076_0140469 3300049592 Bacteria 1962
352 Ga0501079_0007273 3300049741 Bacteria 8360
353 Ga0501079_0220123 3300049741 Bacteria 1483
354 Ga0501080_0022319 3300049742 Bacteria 5863
355 Ga0501081_0111240 3300049743 Unclassified 1944
356 Ga0501044_0022306 3300049823 Bacteria 6747
357 Ga0501045_0000849 3300049824 Bacteria 19812
358 Ga0501045_0024620 3300049824 Bacteria 4323
359 Ga0501045_0135045 3300049824 Unclassified 1834
360 nmdc:mga05p37_14038_c1 3300050507 Bacteria 9609
361 nmdc:mga05p37_154099_c1 3300050507 Bacteria 2809
362 nmdc:mga05p37_21451_c1 3300050507 Bacteria 7823
363 nmdc:mga05p37_227010_c1 3300050507 Bacteria 2251
364 nmdc:mga05p37_25338_c1 3300050507 Bacteria 7214
365 nmdc:mga05p37_325192_c1 3300050507 Bacteria 1819
366 nmdc:mga05p37_34497_c1 3300050507 Bacteria 6199
367 nmdc:mga05p37_61099_c1 3300050507 Bacteria 4639
368 nmdc:mga05p37_63280_c1 3300050507 Bacteria 4552
369 nmdc:mga05p37_702665_c1 3300050507 Bacteria 1123
370 nmdc:mga08y16_1466_c1 3300050511 Bacteria 23669
371 nmdc:mga08y16_199198_c1 3300050511 Bacteria 2075
372 nmdc:mga08y16_254122_c1 3300050511 Bacteria 1816
373 nmdc:mga08y16_4533_c1 3300050511 Bacteria 14481
374 nmdc:mga0n895_198384_c1 3300050512 Bacteria 2038
375 nmdc:mga0n895_20136_c1 3300050512 Bacteria 6215
376 nmdc:mga0n895_237597_c1 3300050512 Bacteria 1849
377 nmdc:mga0n895_252160_c1 3300050512 Bacteria 1791
378 nmdc:mga0n895_264_c1 3300050512 Bacteria 34123
379 nmdc:mga0n895_28102_c2 3300050512 Bacteria 3112
380 nmdc:mga0n895_323121_c1 3300050512 Bacteria 1564
381 nmdc:mga0n895_426983_c1 3300050512 Bacteria 1339
382 nmdc:mga0n895_94180_c1 3300050512 Bacteria 2999
383 nmdc:mga0rr50_189081_c1 3300050513 Unclassified 1687
384 nmdc:mga0rr50_395840_c1 3300050513 Bacteria 1166
385 nmdc:mga0rr50_77142_c1 3300050513 Bacteria 2560
386 nmdc:mga0rr50_77_c1 3300050513 Bacteria 55683
387 nmdc:mga0rr50_917_c1 3300050513 Bacteria 15946
388 nmdc:mga08x19_224093_c1 3300050514 Bacteria 1293
389 nmdc:mga08x19_289_c1 3300050514 Bacteria 37059
390 nmdc:mga08x19_48543_c1 3300050514 Bacteria 2720
391 nmdc:mga0a205_10460_c1 3300050515 Bacteria 8523
392 nmdc:mga0a205_5231_c1 3300050515 Bacteria 11672
393 Ga0495619_0074315 3300053085 Bacteria 2279
394 Ga0501084_0014631 3300054114 Bacteria 6504
395 Ga0501084_0060427 3300054114 Bacteria 3173
396 Ga0501084_0177915 3300054114 Bacteria 1796
397 Ga0501082_0009955 3300060353 Bacteria 8198
398 Ga0530510_0009994 3300061734 Bacteria 6657
399 Ga0530510_0166904 3300061734 Bacteria 1630
400 Ga0530510_0470584 3300061734 Unclassified 951
401 Ga0530510_0495321 3300061734 Bacteria 926
402 Ga0065712_10181770
403 Ga0058861_11336912
404 Ga0065712_10000469
405 Ga0065712_10074533
406 Ga0065707_10180937
407 Ga0070658_10093985
408 Ga0070676_10021619
409 Ga0070683_100108279
410 Ga0070690_100313331
411 Ga0070670_100025415
412 Ga0070670_100158753
413 Ga0070670_100176678
414 Ga0070677_10026810
415 Ga0068869_100075293
416 Ga0070666_10017629
417 Ga0070666_10077436
418 Ga0070680_100314500
419 Ga0070682_100394404
420 Ga0070660_100004094
421 Ga0070660_100103026
422 Ga0070689_100082032
423 Ga0070691_10011418
424 Ga0070668_100044012
425 Ga0070668_100344739
426 Ga0070669_100008124
427 Ga0070669_100024208
428 Ga0070669_100052785
429 Ga0070675_100000896
430 Ga0070675_100164092
431 Ga0070671_100013867
432 Ga0070671_100119542
433 Ga0070674_100002488
434 Ga0070673_100008964
435 Ga0070688_100023293
436 Ga0070659_100366282
437 Ga0070667_100034399
438 Ga0070709_10036826
439 Ga0070713_100008511
440 Ga0070710_10140006
441 Ga0070701_10005961
442 Ga0070711_100597920
443 Ga0070705_100007085
444 Ga0070705_100153146
445 Ga0070694_100049860
446 Ga0070708_100568903
447 Ga0070678_100023066
448 Ga0070678_100372082
449 Ga0070681_10001072
450 Ga0070681_10114700
451 Ga0070681_10184033
452 Ga0068867_100041985
453 Ga0068867_100320489
454 Ga0070698_100171467
455 Ga0070699_100010132
456 Ga0070679_100048291
457 Ga0070679_100486791
458 Ga0070684_100054882
459 Ga0070697_100546069
460 Ga0070686_100048384
461 Ga0070686_100455462
462 Ga0070696_100055899
463 Ga0070693_100269939
464 Ga0070665_100072045
465 Ga0070665_100077009
466 Ga0070665_100082335
467 Ga0070665_100487571
468 Ga0068855_100007514
469 Ga0068855_100365916
470 Ga0070664_100424137
471 Ga0068854_100493808
472 Ga0068852_100766270
473 Ga0068859_100006201
474 Ga0068864_100004916
475 Ga0068864_100021184
476 Ga0068864_100176154
477 Ga0068864_100507170
478 Ga0068866_10009691
479 Ga0068866_10075987
480 Ga0068861_100017287
481 Ga0068863_100024470
482 Ga0068863_100072380
483 Ga0068863_100169770
484 Ga0068863_100464060
485 Ga0068858_100000616
486 Ga0068858_100116369
487 Ga0068858_100384617
488 Ga0068858_100541541
489 Ga0068860_100108390
490 Ga0068860_100205697
491 Ga0068860_100273828
492 Ga0068862_100517561
493 Ga0068862_100587572
494 Ga0068862_100598067
495 Ga0081455_10084117
496 Ga0097621_100005478
497 Ga0097621_100067386
498 Ga0097621_100217949
499 Ga0068871_100000646
500 Ga0068871_100001797
501 Ga0068871_100008530
502 Ga0068871_100165550
503 Ga0068871_100388385
504 Ga0075428_100721449
505 Ga0075433_10025574
506 Ga0075433_10055780
507 Ga0075433_10199953
508 Ga0075433_10258676
509 Ga0075434_100001702
510 Ga0075434_100017845
511 Ga0075434_100141312
512 Ga0075434_100272206
513 Ga0068865_100025421
514 Ga0075436_100000461
515 Ga0075436_100062696
516 Ga0075436_100149846
517 Ga0097620_100006201
518 Ga0075435_100000062
519 Ga0075435_100002785
520 Ga0075435_100003998
521 Ga0075435_100028930
522 Ga0075435_100105031
523 Ga0099794_10096590
524 Ga0105240_10537729
525 Ga0111539_10000586
526 Ga0111539_10015763
527 Ga0111539_10122839
528 Ga0111539_10455642
529 Ga0105247_10040166
530 Ga0105247_10101739
531 Ga0105247_10226152
532 Ga0114129_10001999
533 Ga0114129_10027653
534 Ga0114129_10029471
535 Ga0114129_10031325
536 Ga0114129_10073712
537 Ga0114129_10248362
538 Ga0105243_10032716
539 Ga0105243_10062653
540 Ga0105243_10276784
541 Ga0105241_10429366
542 Ga0105242_10005136
543 Ga0105242_10007220
544 Ga0105248_10014477
545 Ga0105248_10016407
546 Ga0105248_10022714
547 Ga0105248_10039880
548 Ga0105248_10121919
549 Ga0105248_10157392
550 Ga0105248_10301934
551 Ga0105237_10384386
552 Ga0105238_10273208
553 Ga0105246_10397807
554 Ga0157374_10584180
555 Ga0157378_10024826
556 Ga0157378_10192867
557 Ga0163162_10045930
558 Ga0163162_10289669
559 Ga0157375_10426437
560 Ga0163163_10037182
561 Ga0163163_10099232
562 Ga0163163_10300594
563 Ga0157377_10002534
564 Ga0157379_10014020
565 Ga0157379_10048285
566 Ga0157376_10016431
567 Ga0157376_10027451
568 Ga0157376_10091345
569 Ga0163161_10301626
570 Ga0207682_10065088
571 Ga0207682_10164413
572 Ga0207692_10108670
573 Ga0207642_10038305
574 Ga0207642_10164840
575 Ga0207710_10054646
576 Ga0207680_10029737
577 Ga0207680_10055870
578 Ga0207699_10029415
579 Ga0207645_10000630
580 Ga0207705_10026735
581 Ga0207707_10103130
582 Ga0207707_10213683
583 Ga0207660_10132654
584 Ga0207662_10005935
585 Ga0207657_10002909
586 Ga0207657_10097611
587 Ga0207652_10050146
588 Ga0207681_10005575
589 Ga0207681_10008723
590 Ga0207681_10021204
591 Ga0207681_10052284
592 Ga0207694_10214917
593 Ga0207650_10035374
594 Ga0207659_10000548
595 Ga0207659_10113982
596 Ga0207687_10075887
597 Ga0207700_10007165
598 Ga0207706_10236288
599 Ga0207686_10020786
600 Ga0207686_10039256
601 Ga0207709_10021627
602 Ga0207709_10026591
603 Ga0207670_10080348
604 Ga0207669_10059520
605 Ga0207704_10056799
606 Ga0207691_10007685
607 Ga0207711_10007745
608 Ga0207711_10067454
609 Ga0207711_10166580
610 Ga0207711_10280165
611 Ga0207711_10441409
612 Ga0207689_10278572
613 Ga0207679_10061888
614 Ga0207667_10078804
615 Ga0207667_10425116
616 Ga0207651_10015299
617 Ga0207651_10398025
618 Ga0207668_10072496
619 Ga0207668_10116970
620 Ga0207640_10237320
621 Ga0207640_10362524
622 Ga0207658_10049826
623 Ga0207703_10006628
624 Ga0207703_10021226
625 Ga0207703_10063925
626 Ga0207703_10095701
627 Ga0207703_10308283
628 Ga0207639_10620899
629 Ga0207708_10013678
630 Ga0207708_10144282
631 Ga0207702_10448423
632 Ga0207641_10004863
633 Ga0207641_10123083
634 Ga0207641_10459975
635 Ga0207648_10017427
636 Ga0207648_10251753
637 Ga0207676_10054458
638 Ga0207674_10118217
639 Ga0207675_100002071
640 Ga0207675_100019224
641 Ga0207675_100496346
642 Ga0207675_100751548
643 Ga0207683_10041670
644 Ga0207428_10010394
645 Ga0207428_10017926
646 Ga0207428_10072658
647 Ga0207428_10221104
648 Ga0268265_10012233
649 Ga0268265_10040476
650 Ga0268265_10060559
651 Ga0268265_10284629
652 Ga0268265_10313728
653 Ga0268264_10112297
654 Ga0268264_10121093
655 Ga0268264_10501066
656 Ga0307412_10482182
657 Ga0373958_0001574
658 Ga0373959_0006022
659 Ga0373938_0001476
660 Ga0373929_0002426
661 Ga0373940_0001022
662 Ga0373949_0000620
663 Ga0373951_0001255
664 Ga0373932_0000405
665 Ga0373936_0123314
666 Ga0373939_0000522
667 Ga0373939_0010200
668 Ga0373945_0046931
669 Ga0373953_0118185
670 Ga0373957_0090496
671 Ga0373960_0000106
672 Ga0373943_0132944
673 Ga0373942_0000131
674 Ga0373961_0001061
675 Ga0373962_0000857
676 Ga0373931_0002905
677 Ga0373947_0021588
678 Ga0373947_0150428
679 Ga0373947_0296948
680 Ga0373937_0084364
681 Ga0373937_0100318
682 Ga0373937_0204308
683 Ga0373937_0353894
684 Ga0451853_0662596
685 Ga0439450_031277
686 Ga0439435_0017954
687 Ga0439435_0033663
688 Ga0439460_0016491
689 Ga0451577_0012114
690 Ga0466963_0091703
691 Ga0453684_0103661
692 Ga0451576_0061869
693 Ga0451576_0192733
694 Ga0495592_0365923
695 Ga0495603_0083961
696 Ga0495580_0192452
697 Ga0495582_0056221
698 Ga0495628_0432554
699 Ga0495630_0337977
700 Ga0495640_0256103
701 Ga0495645_0022567
702 Ga0495656_0175729
703 Ga0495656_0196436
704 Ga0495634_0052595
705 Ga0495634_0328130
706 Ga0495658_0076493
707 Ga0495658_0089751
708 Ga0495658_0109080
709 Ga0495613_0121280
710 Ga0495680_0124896
711 Ga0495684_0368501
712 Ga0496101_0001786
713 Ga0496104_0003527
714 Ga0496104_0098916
715 Ga0496104_0388025
716 Ga0496105_0216455
717 Ga0496108_0024115
718 Ga0496109_0090255
719 Ga0496110_0145537
720 Ga0496111_0058417
721 Ga0496111_0174877
722 Ga0496112_0008000
723 Ga0496113_0369507
724 Ga0496114_0000405
725 Ga0496115_0494861
726 Ga0501033_0039392
727 Ga0501034_0015914
728 Ga0501038_0035686
729 Ga0501038_0090293
730 Ga0501039_0033302
731 Ga0501040_0002974
732 Ga0501041_0004309
733 Ga0501041_0017746
734 Ga0501042_0004718
735 Ga0501042_0168676
736 Ga0501043_0046307
737 Ga0501046_0008680
738 Ga0501047_0210860
739 Ga0501048_0074352
740 Ga0501048_0565919
741 Ga0501069_0235696
742 Ga0501070_0242062
743 Ga0501071_0004250
744 Ga0501072_0005832
745 Ga0501072_0202340
746 Ga0501074_0011098
747 Ga0501075_0000537
748 Ga0501075_0114701
749 Ga0501075_0290164
750 Ga0501076_0002420
751 Ga0501076_0011322
752 Ga0501076_0140469
753 Ga0501079_0007273
754 Ga0501079_0220123
755 Ga0501080_0022319
756 Ga0501081_0111240
757 Ga0501044_0022306
758 Ga0501045_0000849
759 Ga0501045_0024620
760 Ga0501045_0135045
761 nmdc:mga05p37_14038_c1
762 nmdc:mga05p37_154099_c1
763 nmdc:mga05p37_21451_c1
764 nmdc:mga05p37_227010_c1
765 nmdc:mga05p37_25338_c1
766 nmdc:mga05p37_325192_c1
767 nmdc:mga05p37_34497_c1
768 nmdc:mga05p37_61099_c1
769 nmdc:mga05p37_63280_c1
770 nmdc:mga05p37_702665_c1
771 nmdc:mga08y16_1466_c1
772 nmdc:mga08y16_199198_c1
773 nmdc:mga08y16_254122_c1
774 nmdc:mga08y16_4533_c1
775 nmdc:mga0n895_198384_c1
776 nmdc:mga0n895_20136_c1
777 nmdc:mga0n895_237597_c1
778 nmdc:mga0n895_252160_c1
779 nmdc:mga0n895_264_c1
780 nmdc:mga0n895_28102_c2
781 nmdc:mga0n895_323121_c1
782 nmdc:mga0n895_426983_c1
783 nmdc:mga0n895_94180_c1
784 nmdc:mga0rr50_189081_c1
785 nmdc:mga0rr50_395840_c1
786 nmdc:mga0rr50_77142_c1
787 nmdc:mga0rr50_77_c1
788 nmdc:mga0rr50_917_c1
789 nmdc:mga08x19_224093_c1
790 nmdc:mga08x19_289_c1
791 nmdc:mga08x19_48543_c1
792 nmdc:mga0a205_10460_c1
793 nmdc:mga0a205_5231_c1
794 Ga0495619_0074315
795 Ga0501084_0014631
796 Ga0501084_0060427
797 Ga0501084_0177915
798 Ga0501082_0009955
799 Ga0530510_0009994
800 Ga0530510_0166904
801 Ga0530510_0470584
802 Ga0530510_0495321

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01578

Cytochrom_C_asm

Cytochrome C assembly protein

17

292

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7s9y-assembly1.cif.gz_A helicobacter hepaticus ccsba open conformation 0.7223 2 260
6zmq-assembly1.cif.gz_A cytochrome c heme lyase ccmf 0.7054 2 251
7s9y-assembly1.cif.gz_A helicobacter hepaticus ccsba open conformation 0.7054 2 260
6zmq-assembly1.cif.gz_A cytochrome c heme lyase ccmf 0.6684 2 251
3nmi-assembly6.cif.gz_F crystal structure of the phenanthroline-modified cytochrome cb562 variant, mbp-phen2 0.6489 171 251
ID Description Score Start End Superfamily
af_Q8MQA1_463_586_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.7158 3 107 1.20.120.350
af_Q13698_422_545_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.7097 2 109 1.20.120.350
af_C0LU14_432_555_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.7057 3 108 1.20.120.350
3qw1C00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.6494 171 251 1.20.120.10
3hnjA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.6308 171 251 1.20.120.10
ID Description Score Start End GO Terms
AF-A0A382ILU2-F1-model_v4 Cytochrome c assembly protein domain-containing protein 0.9644 1 171 GO:0016020
GO:0017004
GO:0020037
AF-A0A382ILU2-F1-model_v4 Cytochrome c assembly protein domain-containing protein 0.9589 1 171 GO:0016020
GO:0017004
GO:0020037
AF-A0A3N5Q2D6-F1-model_v4 Cytochrome c assembly protein domain-containing protein 0.953 1 265 GO:0005886
GO:0017004
GO:0020037
AF-A0A7C7VBJ9-F1-model_v4 Cytochrome c assembly protein domain-containing protein 0.9504 2 263 GO:0005886
GO:0017004
GO:0020037
AF-A0A3N5Q2D6-F1-model_v4 Cytochrome c assembly protein domain-containing protein 0.9496 1 265 GO:0005886
GO:0017004
GO:0020037

Map