F434707

General Info

Members Datasets Scaffolds Average Seq Length
400 296 800 126

Family's Representative Sequence

Representative Sequence 3300053103|Ga0500555_171529|Ga0500555_171529_70_510
Length 146
Sequence VWRAPRTRKGTQQPRKPGHLHRSRVYALLIDTPGPEATAAAAFWSAALGAPAKPVRGEEQFTTLHEAIPGLVTAVQSIDDTNPRFHIDIETDDVESETARLLTLGATQVARWLECRVLRAPGGHLFCVLPVHSAPEIFNAQARTWS

Samples

Sample ID Description Type Environment
1 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
123 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
124 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
138 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
139 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
140 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
141 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
142 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
146 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
161 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
162 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
163 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
164 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
167 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
168 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
191 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
216 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
217 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
225 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
228 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
229 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
257 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
260 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
261 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
262 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
263 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
264 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
265 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
266 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
267 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
268 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
269 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
270 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
271 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
272 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
273 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
274 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
275 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
276 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
277 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
278 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
279 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
280 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
281 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
282 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
283 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
284 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
285 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
286 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
287 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
288 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
289 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
290 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
291 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
292 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
293 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
294 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
295 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
296 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.25
Metatranscriptomes 0.25
Isolates 2.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.75
Nodule 0
Rhizoplane 6
Rhizosphere 77.5
Stem 0
Stem Tuber 0
Unclassified 2.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500555_171529 3300053103 Bacteria 527
2 Ga0070658_11113703 3300005327 Bacteria 687
3 Ga0070683_100018624 3300005329 Bacteria 6154
4 Ga0070683_100157128 3300005329 Bacteria 2157
5 Ga0070690_100615863 3300005330 Bacteria 826
6 Ga0070670_100429040 3300005331 Bacteria 1169
7 Ga0070670_102270315 3300005331 Bacteria 500
8 Ga0068869_100241769 3300005334 Bacteria 1439
9 Ga0070682_100012934 3300005337 Bacteria 4791
10 Ga0068868_100004482 3300005338 Bacteria 9796
11 Ga0068868_100155741 3300005338 Bacteria 1884
12 Ga0070660_100190522 3300005339 Bacteria 1661
13 Ga0070689_101092714 3300005340 Bacteria 713
14 Ga0070691_10350353 3300005341 Bacteria 820
15 Ga0070661_100152200 3300005344 Bacteria 1749
16 Ga0070661_100199130 3300005344 Bacteria 1530
17 Ga0070692_10001764 3300005345 Bacteria 8079
18 Ga0070668_100422956 3300005347 Bacteria 1141
19 Ga0070675_100013893 3300005354 Bacteria 6340
20 Ga0070675_100602255 3300005354 Bacteria 997
21 Ga0070671_100595424 3300005355 Bacteria 955
22 Ga0070667_100828571 3300005367 Bacteria 860
23 Ga0070667_100842985 3300005367 Bacteria 852
24 Ga0070713_100035795 3300005436 Bacteria 4000
25 Ga0070713_102068837 3300005436 Unclassified 552
26 Ga0070710_10182946 3300005437 Bacteria 1313
27 Ga0070710_10188888 3300005437 Bacteria 1294
28 Ga0070711_100218696 3300005439 Bacteria 1479
29 Ga0070711_100399559 3300005439 Bacteria 1115
30 Ga0070700_100498331 3300005441 Bacteria 936
31 Ga0070663_100359124 3300005455 Bacteria 1181
32 Ga0070678_100634957 3300005456 Bacteria 956
33 Ga0070678_100674099 3300005456 Bacteria 929
34 Ga0070662_100103786 3300005457 Bacteria 2156
35 Ga0070681_10289664 3300005458 Bacteria 1547
36 Ga0070679_100298876 3300005530 Bacteria 1561
37 Ga0070684_100008020 3300005535 Bacteria 8243
38 Ga0070684_100120324 3300005535 Bacteria 2362
39 Ga0068853_100305719 3300005539 Bacteria 1471
40 Ga0070686_101491155 3300005544 Bacteria 570
41 Ga0070695_101132513 3300005545 Bacteria 641
42 Ga0070696_100256742 3300005546 Bacteria 1324
43 Ga0070693_100016658 3300005547 Bacteria 3808
44 Ga0070665_101200887 3300005548 Bacteria 769
45 Ga0070665_102363721 3300005548 Bacteria 534
46 Ga0070704_100663709 3300005549 Bacteria 921
47 Ga0070664_100010204 3300005564 Bacteria 7616
48 Ga0070664_100179792 3300005564 Bacteria 1880
49 Ga0068857_100171100 3300005577 Bacteria 1975
50 Ga0068857_100223734 3300005577 Bacteria 1719
51 Ga0068854_100053776 3300005578 Bacteria 2893
52 Ga0068854_100537050 3300005578 Bacteria 990
53 Ga0068856_101508958 3300005614 Bacteria 686
54 Ga0070702_100011389 3300005615 Bacteria 4423
55 Ga0070702_100479958 3300005615 Bacteria 908
56 Ga0068852_100001156 3300005616 Bacteria 17476
57 Ga0068852_100089271 3300005616 Bacteria 2754
58 Ga0068864_100283692 3300005618 Bacteria 1546
59 Ga0068864_100672592 3300005618 Bacteria 1009
60 Ga0068864_101009353 3300005618 Bacteria 826
61 Ga0068866_10727053 3300005718 Bacteria 683
62 Ga0068851_10133215 3300005834 Bacteria 1346
63 Ga0068870_10222105 3300005840 Bacteria 1157
64 Ga0068863_100274459 3300005841 Bacteria 1632
65 Ga0068863_100746384 3300005841 Bacteria 974
66 Ga0068860_100302743 3300005843 Bacteria 1566
67 Ga0068862_100073793 3300005844 Bacteria 2949
68 Ga0068862_100424814 3300005844 Bacteria 1248
69 Ga0070715_10259841 3300006163 Bacteria 911
70 Ga0070716_100366087 3300006173 Bacteria 1025
71 Ga0068871_100182246 3300006358 Bacteria 1805
72 Ga0075428_100109035 3300006844 Bacteria 3017
73 Ga0075434_100195082 3300006871 Bacteria 2045
74 Ga0075435_100783689 3300007076 Bacteria 830
75 Ga0105240_10709325 3300009093 Bacteria 1097
76 Ga0111539_10000437 3300009094 Bacteria 52636
77 Ga0105245_10008695 3300009098 Bacteria 8853
78 Ga0105247_10024138 3300009101 Bacteria 3663
79 Ga0105243_10138572 3300009148 Bacteria 2073
80 Ga0105243_10467511 3300009148 Bacteria 1187
81 Ga0105241_10312321 3300009174 Bacteria 1352
82 Ga0105241_11971569 3300009174 Bacteria 574
83 Ga0105237_10179376 3300009545 Bacteria 2118
84 Ga0105237_11273482 3300009545 Bacteria 742
85 Ga0105238_10430678 3300009551 Bacteria 1315
86 Ga0105249_10167599 3300009553 Bacteria 2127
87 Ga0099796_10161318 3300010159 Bacteria 889
88 Ga0105239_10161516 3300010375 Bacteria 2503
89 Ga0105239_13268656 3300010375 Bacteria 528
90 Ga0157335_1009067 3300012492 Bacteria 775
91 Ga0157373_10697434 3300013100 Bacteria 744
92 Ga0157374_10018398 3300013296 Bacteria 6164
93 Ga0157378_10241958 3300013297 Bacteria 1724
94 Ga0163162_10326991 3300013306 Bacteria 1666
95 Ga0157372_12233222 3300013307 Bacteria 629
96 Ga0157375_10266651 3300013308 Bacteria 1874
97 Ga0163163_10368183 3300014325 Bacteria 1494
98 Ga0157380_10835877 3300014326 Bacteria 941
99 Ga0157380_11478883 3300014326 Bacteria 732
100 Ga0157376_10112346 3300014969 Bacteria 2400
101 Ga0206353_10982414 3300020082 Bacteria 712
102 Ga0207692_10386989 3300025898 Bacteria 869
103 Ga0207642_10058606 3300025899 Bacteria 1777
104 Ga0207710_10005744 3300025900 Bacteria 5325
105 Ga0207688_10031095 3300025901 Bacteria 2946
106 Ga0207685_10537727 3300025905 Bacteria 620
107 Ga0207654_10422325 3300025911 Bacteria 931
108 Ga0207707_10140832 3300025912 Bacteria 2109
109 Ga0207660_10478970 3300025917 Bacteria 1008
110 Ga0207662_10057309 3300025918 Bacteria 2328
111 Ga0207657_10164421 3300025919 Bacteria 1801
112 Ga0207649_10180892 3300025920 Bacteria 1476
113 Ga0207694_10744274 3300025924 Bacteria 827
114 Ga0207687_10027346 3300025927 Bacteria 3827
115 Ga0207700_10007110 3300025928 Bacteria 6817
116 Ga0207700_10251215 3300025928 Bacteria 1511
117 Ga0207664_10008817 3300025929 Bacteria 7053
118 Ga0207664_10072411 3300025929 Bacteria 2778
119 Ga0207644_10550442 3300025931 Bacteria 955
120 Ga0207690_10374302 3300025932 Bacteria 1130
121 Ga0207706_10097556 3300025933 Bacteria 2585
122 Ga0207709_10309353 3300025935 Bacteria 1178
123 Ga0207669_10316329 3300025937 Bacteria 1193
124 Ga0207704_10704691 3300025938 Bacteria 836
125 Ga0207665_10007272 3300025939 Bacteria 7325
126 Ga0207689_10026607 3300025942 Bacteria 4846
127 Ga0207689_10203168 3300025942 Bacteria 1636
128 Ga0207661_10714647 3300025944 Bacteria 922
129 Ga0207679_10134760 3300025945 Bacteria 1987
130 Ga0207667_10336655 3300025949 Bacteria 1540
131 Ga0207712_10381334 3300025961 Bacteria 1180
132 Ga0207712_11030214 3300025961 Bacteria 731
133 Ga0207668_10924861 3300025972 Bacteria 777
134 Ga0207668_11800807 3300025972 Bacteria 552
135 Ga0207640_10484194 3300025981 Bacteria 1027
136 Ga0207640_10698201 3300025981 Bacteria 870
137 Ga0207677_10198371 3300026023 Bacteria 1593
138 Ga0207677_10281566 3300026023 Bacteria 1365
139 Ga0207703_11003550 3300026035 Bacteria 801
140 Ga0207708_10065061 3300026075 Bacteria 2787
141 Ga0207702_10027475 3300026078 Bacteria 4725
142 Ga0207641_11879654 3300026088 Bacteria 600
143 Ga0207676_10350701 3300026095 Bacteria 1365
144 Ga0207676_11566289 3300026095 Bacteria 656
145 Ga0207683_10017327 3300026121 Bacteria 6139
146 Ga0207683_10359934 3300026121 Bacteria 1336
147 Ga0207683_10829844 3300026121 Bacteria 858
148 Ga0207698_10034462 3300026142 Bacteria 3691
149 Ga0207428_10435553 3300027907 Bacteria 957
150 Ga0268266_11208589 3300028379 Bacteria 731
151 Ga0268266_11228314 3300028379 Bacteria 725
152 Ga0268266_11627182 3300028379 Bacteria 621
153 Ga0268264_10055998 3300028381 Bacteria 3295
154 Ga0307517_10038204 3300028786 Bacteria 5328
155 Ga0307517_10131211 3300028786 Bacteria 1803
156 Ga0307515_10001120 3300028794 Bacteria 61255
157 Ga0307515_10302747 3300028794 Bacteria 1282
158 Ga0307511_10014003 3300030521 Bacteria 7813
159 Ga0307511_10043996 3300030521 Bacteria 3718
160 Ga0307513_10674167 3300031456 Bacteria 740
161 Ga0307509_10017785 3300031507 Bacteria 8168
162 Ga0307509_10018075 3300031507 Bacteria 8095
163 Ga0307509_10023449 3300031507 Bacteria 6927
164 Ga0307509_10454495 3300031507 Bacteria 974
165 Ga0307408_100017053 3300031548 Bacteria 4857
166 Ga0307508_10014952 3300031616 Bacteria 7078
167 Ga0307508_10119399 3300031616 Bacteria 2238
168 Ga0307514_10064815 3300031649 Bacteria 2769
169 Ga0307516_10016134 3300031730 Bacteria 7826
170 Ga0307516_10031213 3300031730 Bacteria 5371
171 Ga0307516_10100767 3300031730 Bacteria 2704
172 Ga0307405_10048658 3300031731 Bacteria 2616
173 Ga0307405_11008436 3300031731 Bacteria 711
174 Ga0307413_10075083 3300031824 Bacteria 2144
175 Ga0307518_10058320 3300031838 Bacteria 2804
176 Ga0307518_10073432 3300031838 Bacteria 2475
177 Ga0307518_10112311 3300031838 Bacteria 1940
178 Ga0307518_10183665 3300031838 Bacteria 1410
179 Ga0307410_11387997 3300031852 Bacteria 616
180 Ga0326468_10000580 3300031889 Bacteria 3797
181 Ga0307406_10009049 3300031901 Bacteria 5570
182 Ga0307406_11220160 3300031901 Bacteria 654
183 Ga0307407_10022477 3300031903 Bacteria 3273
184 Ga0307407_11006645 3300031903 Bacteria 644
185 Ga0307412_10052263 3300031911 Bacteria 2705
186 Ga0307409_100039815 3300031995 Bacteria 3492
187 Ga0307409_100057902 3300031995 Bacteria 3006
188 Ga0307416_100734056 3300032002 Bacteria 1079
189 Ga0307411_11463817 3300032005 Bacteria 627
190 Ga0307415_101483109 3300032126 Bacteria 648
191 Ga0307507_10014910 3300033179 Bacteria 9207
192 Ga0307507_10088744 3300033179 Bacteria 2665
193 Ga0307510_10026754 3300033180 Bacteria 6621
194 Ga0307510_10043312 3300033180 Bacteria 4894
195 Ga0307510_10122568 3300033180 Bacteria 2299
196 Ga0307510_10425358 3300033180 Bacteria 770
197 Ga0373958_0071570 3300034819 Bacteria 770
198 Ga0373938_0002819 3300034957 Bacteria 2806
199 Ga0373926_0005183 3300035083 Plasmid 4290
200 Ga0373934_0009823 3300035086 Bacteria 3592
201 Ga0373923_0004923 3300035111 Bacteria 4485
202 Ga0373936_0011229 3300035113 Bacteria 3387
203 Ga0373945_0011876 3300035116 Plasmid 2885
204 Ga0373953_0038089 3300035117 Bacteria 1900
205 Ga0373957_0033095 3300035120 Bacteria 1908
206 Ga0373943_0164079 3300035170 Bacteria 1211
207 Ga0373946_0001136 3300035171 Bacteria 9204
208 Ga0373955_0003589 3300035172 Bacteria 6825
209 Ga0373961_0025059 3300035241 Bacteria 1619
210 Ga0373924_0021207 3300035410 Bacteria 2533
211 Ga0373931_0053451 3300035691 Bacteria 2155
212 Ga0373935_0529582 3300035692 Bacteria 857
213 Ga0373927_0028794 3300035695 Plasmid 3622
214 Ga0373933_0007453 3300035724 Bacteria 5972
215 Ga0373947_0005995 3300035725 Bacteria 7086
216 Ga0373937_0079658 3300036401 Plasmid 3027
217 Ga0373925_0119026 3300037068 Unclassified 2048
218 Ga0439436_0003781 3300041404 Bacteria 4629
219 Ga0439439_0009910 3300041406 Bacteria 2272
220 Ga0451793_0436988 3300041452 Bacteria 609
221 Ga0451795_0118319 3300041456 Bacteria 658
222 Ga0451855_1373297 3300041511 Bacteria 1099
223 Ga0451853_1566690 3300041512 Bacteria 2448
224 Ga0451853_2272188 3300041512 Bacteria 576
225 Ga0439449_0019938 3300042007 Bacteria 2513
226 Ga0439457_001620 3300042014 Bacteria 6716
227 Ga0450907_028163 3300042146 Bacteria 953
228 Ga0466969_0001658 3300044656 Bacteria 11928
229 Ga0466972_0011391 3300044658 Bacteria 4462
230 Ga0466965_0035015 3300044683 Bacteria 2458
231 Ga0466970_0352261 3300044765 Bacteria 835
232 Ga0466957_0288810 3300044842 Bacteria 1099
233 Ga0495592_0072345 3300046454 Plasmid 2508
234 Ga0495592_0607578 3300046454 Bacteria 666
235 Ga0495629_0015058 3300046459 Bacteria 5558
236 Ga0495629_0015270 3300046459 Bacteria 5515
237 Ga0495629_0801072 3300046459 Bacteria 621
238 Ga0495638_0064589 3300046460 Bacteria 2255
239 Ga0495641_0009266 3300046461 Bacteria 5869
240 Ga0495651_0019973 3300046462 Bacteria 5197
241 Ga0495651_0036331 3300046462 Plasmid 3835
242 Ga0495651_0039598 3300046462 Bacteria 3669
243 Ga0495580_0008473 3300046472 Bacteria 8178
244 Ga0495582_0000865 3300046473 Bacteria 16788
245 Ga0495639_0006082 3300046475 Bacteria 5186
246 Ga0495662_0003339 3300046476 Bacteria 8134
247 Ga0495662_0003471 3300046476 Bacteria 7986
248 Ga0495664_0000589 3300046477 Bacteria 18348
249 Ga0495664_0055379 3300046477 Unclassified 2359
250 Ga0495585_0161354 3300046492 Bacteria 1163
251 Ga0495594_0074515 3300046499 Bacteria 1891
252 Ga0495594_0079239 3300046499 Bacteria 1833
253 Ga0495594_0276353 3300046499 Bacteria 957
254 Ga0495608_0050278 3300046511 Plasmid 2765
255 Ga0495618_0002887 3300046514 Bacteria 10894
256 Ga0495628_0038409 3300046516 Bacteria 3832
257 Ga0495628_0125463 3300046516 Bacteria 1967
258 Ga0495630_0014953 3300046517 Bacteria 5660
259 Ga0495630_0089704 3300046517 Unclassified 2322
260 Ga0495643_0003600 3300046522 Bacteria 11258
261 Ga0495666_0002761 3300046526 Bacteria 8767
262 Ga0495652_0017793 3300046529 Bacteria 6342
263 Ga0495652_0121908 3300046529 Bacteria 2077
264 Ga0495665_0000568 3300046531 Bacteria 18777
265 Ga0495640_0039985 3300046533 Bacteria 3287
266 Ga0495640_0071143 3300046533 Unclassified 2334
267 Ga0495586_0029363 3300046535 Plasmid 2942
268 Ga0495587_0002283 3300046536 Bacteria 12843
269 Ga0495587_0155526 3300046536 Bacteria 1302
270 Ga0495645_0050357 3300046543 Plasmid 3032
271 Ga0495645_0067532 3300046543 Bacteria 2582
272 Ga0495645_0237452 3300046543 Bacteria 1218
273 Ga0495622_0272071 3300046557 Unclassified 742
274 Ga0495633_0066323 3300046558 Bacteria 1686
275 Ga0495667_0058524 3300046559 Plasmid 2531
276 Ga0495656_0244252 3300046615 Bacteria 905
277 Ga0495634_0002198 3300046642 Bacteria 16380
278 Ga0495634_0098854 3300046642 Unclassified 1887
279 Ga0495625_0033442 3300046660 Bacteria 3802
280 Ga0495635_0000703 3300046663 Bacteria 21566
281 Ga0495635_0072877 3300046663 Unclassified 2352
282 Ga0495588_0009622 3300046674 Bacteria 4473
283 Ga0495588_0216340 3300046674 Bacteria 1011
284 Ga0495657_0026194 3300046675 Bacteria 4130
285 Ga0495657_0031291 3300046675 Bacteria 3719
286 Ga0495599_0022706 3300046678 Bacteria 3917
287 Ga0495623_0217913 3300046679 Bacteria 1089
288 Ga0495646_0003020 3300046680 Bacteria 10427
289 Ga0495646_0006727 3300046680 Bacteria 7292
290 Ga0495646_0400881 3300046680 Bacteria 713
291 Ga0495647_0038173 3300046681 Bacteria 1815
292 Ga0495658_0011345 3300046683 Bacteria 4480
293 Ga0495613_0000749 3300046689 Bacteria 25488
294 Ga0495613_0033164 3300046689 Bacteria 3837
295 Ga0495613_0621034 3300046689 Bacteria 717
296 Ga0495624_0058064 3300046690 Unclassified 2431
297 Ga0495670_0021248 3300046691 Bacteria 3201
298 Ga0495671_0034937 3300046692 Bacteria 2554
299 Ga0495671_0375688 3300046692 Bacteria 681
300 Ga0495649_0178989 3300046694 Bacteria 1107
301 Ga0495589_0038714 3300046794 Bacteria 2385
302 Ga0495600_0173475 3300046809 Bacteria 1391
303 Ga0495600_0305143 3300046809 Bacteria 1004
304 Ga0495600_0701690 3300046809 Bacteria 608
305 Ga0495660_0493292 3300046810 Bacteria 524
306 Ga0495581_0055878 3300047315 Bacteria 2278
307 Ga0495604_0004131 3300047317 Bacteria 11525
308 Ga0495604_0010587 3300047317 Bacteria 7312
309 Ga0495604_0039678 3300047317 Bacteria 3699
310 Ga0495676_0010915 3300047321 Bacteria 8212
311 Ga0495680_0053244 3300047322 Plasmid 3150
312 Ga0495683_0053972 3300047323 Bacteria 2004
313 Ga0495687_002006 3300047443 Bacteria 17255
314 Ga0495687_070819 3300047443 Bacteria 1399
315 Ga0495675_0021741 3300047444 Plasmid 4087
316 Ga0495679_022843 3300047446 Bacteria 2134
317 Ga0495685_001856 3300047447 Bacteria 6527
318 Ga0495681_0002469 3300047470 Bacteria 13196
319 Ga0495681_0005531 3300047470 Bacteria 8443
320 Ga0495684_0009751 3300047471 Bacteria 7410
321 Ga0495684_0778592 3300047471 Unclassified 627
322 Ga0495686_0095151 3300047472 Bacteria 1804
323 Ga0495593_0029996 3300047673 Plasmid 2978
324 Ga0495593_0552726 3300047673 Bacteria 577
325 Ga0495602_0021639 3300048088 Bacteria 6323
326 Ga0495602_0082872 3300048088 Bacteria 2689
327 Ga0495614_0038626 3300048089 Bacteria 2048
328 Ga0496101_0615689 3300048904 Bacteria 858
329 Ga0496102_0556748 3300048905 Bacteria 1069
330 Ga0496103_0052985 3300048906 Bacteria 2514
331 Ga0496104_0206886 3300048907 Bacteria 1874
332 Ga0496105_0659726 3300048908 Bacteria 806
333 Ga0496106_0717215 3300048909 Bacteria 796
334 Ga0496107_1009926 3300048910 Bacteria 603
335 Ga0496108_0000034 3300048911 Bacteria 157614
336 Ga0496108_0004709 3300048911 Bacteria 11006
337 Ga0496108_0029277 3300048911 Bacteria 4559
338 Ga0496109_0007285 3300048912 Bacteria 9351
339 Ga0496109_0078457 3300048912 Bacteria 3041
340 Ga0496109_0083781 3300048912 Bacteria 2940
341 Ga0496110_0019129 3300048913 Bacteria 5756
342 Ga0496110_0130147 3300048913 Bacteria 2272
343 Ga0496111_0078618 3300048914 Bacteria 2405
344 Ga0496111_0322554 3300048914 Bacteria 1144
345 Ga0496111_0435272 3300048914 Bacteria 968
346 Ga0496112_0644254 3300048915 Bacteria 989
347 Ga0496114_1487526 3300048917 Bacteria 565
348 Ga0496115_0370906 3300048918 Bacteria 1165
349 Ga0496115_0642931 3300048918 Bacteria 839
350 Ga0496126_0300277 3300048929 Bacteria 1325
351 Ga0501037_0181122 3300049573 Bacteria 1495
352 Ga0501047_0376630 3300049581 Bacteria 1254
353 Ga0501077_0109570 3300049593 Bacteria 1749
354 nmdc:mga00v17_342719_c1 3300050491 Bacteria 971
355 nmdc:mga08y16_118137_c1 3300050511 Bacteria 2760
356 Ga0495601_0042947 3300053077 Plasmid 2838
357 Ga0495612_0017727 3300053078 Bacteria 2851
358 Ga0495655_0073131 3300053083 Bacteria 963
359 Ga0495655_0089864 3300053083 Bacteria 893
360 Ga0495619_0024112 3300053085 Bacteria 3901
361 Ga0495619_0054923 3300053085 Bacteria 2637
362 Ga0500578_0032907 3300053086 Bacteria 3332
363 Ga0500644_0009121 3300053088 Bacteria 2643
364 Ga0500646_0000059 3300053090 Bacteria 30591
365 Ga0500583_0068771 3300053092 Bacteria 1689
366 Ga0500640_014720 3300053095 Bacteria 3261
367 Ga0500641_0021583 3300053096 Bacteria 2457
368 Ga0500654_104919 3300053099 Bacteria 1186
369 Ga0500660_136045 3300053100 Bacteria 988
370 Ga0500553_055120 3300053101 Bacteria 1890
371 Ga0500560_001231 3300053107 Bacteria 4298
372 Ga0500560_137206 3300053107 Bacteria 817
373 Ga0500569_139157 3300053109 Bacteria 815
374 Ga0500572_154580 3300053111 Bacteria 750
375 Ga0500594_0213825 3300053118 Bacteria 636
376 Ga0500614_128999 3300053123 Bacteria 750
377 Ga0500628_005396 3300053129 Bacteria 2133
378 Ga0500652_009077 3300053131 Bacteria 3346
379 Ga0500658_0033720 3300053134 Bacteria 2015
380 Ga0500561_0002665 3300053137 Bacteria 3028
381 Ga0500577_0377913 3300053142 Bacteria 620
382 Ga0500588_0256378 3300053146 Bacteria 657
383 Ga0500600_0082332 3300053149 Bacteria 1737
384 Ga0500616_0023851 3300053153 Bacteria 3404
385 Ga0500622_0354585 3300053156 Bacteria 608
386 Ga0500633_0052738 3300053160 Bacteria 1408
387 Ga0500634_0030409 3300053161 Bacteria 2943
388 Ga0500636_0301745 3300053177 Bacteria 788
389 Ga0500656_064244 3300053732 Bacteria 555
390 Ga0500587_014260 3300053739 Bacteria 1007
391 2585313720 2582581314 Bacteria 11452267
392 2729904822 2728369276 Bacteria 5610032
393 2753266057 2751185782 Bacteria 11227053
394 2799182875 2799112218 Bacteria 4315149
395 2832006028 2832004796 Bacteria 6538017
396 2837275593 2837268691 Bacteria 7850704
397 2866070568 2866065130 Bacteria 6518152
398 2884997847 2884994152 Bacteria 4492978
399 2895435998 2895427314 Bacteria 13147766
400 2929230856 2929226422 Bacteria 7248583
401 Ga0500555_171529
402 Ga0070658_11113703
403 Ga0070683_100018624
404 Ga0070683_100157128
405 Ga0070690_100615863
406 Ga0070670_100429040
407 Ga0070670_102270315
408 Ga0068869_100241769
409 Ga0070682_100012934
410 Ga0068868_100004482
411 Ga0068868_100155741
412 Ga0070660_100190522
413 Ga0070689_101092714
414 Ga0070691_10350353
415 Ga0070661_100152200
416 Ga0070661_100199130
417 Ga0070692_10001764
418 Ga0070668_100422956
419 Ga0070675_100013893
420 Ga0070675_100602255
421 Ga0070671_100595424
422 Ga0070667_100828571
423 Ga0070667_100842985
424 Ga0070713_100035795
425 Ga0070713_102068837
426 Ga0070710_10182946
427 Ga0070710_10188888
428 Ga0070711_100218696
429 Ga0070711_100399559
430 Ga0070700_100498331
431 Ga0070663_100359124
432 Ga0070678_100634957
433 Ga0070678_100674099
434 Ga0070662_100103786
435 Ga0070681_10289664
436 Ga0070679_100298876
437 Ga0070684_100008020
438 Ga0070684_100120324
439 Ga0068853_100305719
440 Ga0070686_101491155
441 Ga0070695_101132513
442 Ga0070696_100256742
443 Ga0070693_100016658
444 Ga0070665_101200887
445 Ga0070665_102363721
446 Ga0070704_100663709
447 Ga0070664_100010204
448 Ga0070664_100179792
449 Ga0068857_100171100
450 Ga0068857_100223734
451 Ga0068854_100053776
452 Ga0068854_100537050
453 Ga0068856_101508958
454 Ga0070702_100011389
455 Ga0070702_100479958
456 Ga0068852_100001156
457 Ga0068852_100089271
458 Ga0068864_100283692
459 Ga0068864_100672592
460 Ga0068864_101009353
461 Ga0068866_10727053
462 Ga0068851_10133215
463 Ga0068870_10222105
464 Ga0068863_100274459
465 Ga0068863_100746384
466 Ga0068860_100302743
467 Ga0068862_100073793
468 Ga0068862_100424814
469 Ga0070715_10259841
470 Ga0070716_100366087
471 Ga0068871_100182246
472 Ga0075428_100109035
473 Ga0075434_100195082
474 Ga0075435_100783689
475 Ga0105240_10709325
476 Ga0111539_10000437
477 Ga0105245_10008695
478 Ga0105247_10024138
479 Ga0105243_10138572
480 Ga0105243_10467511
481 Ga0105241_10312321
482 Ga0105241_11971569
483 Ga0105237_10179376
484 Ga0105237_11273482
485 Ga0105238_10430678
486 Ga0105249_10167599
487 Ga0099796_10161318
488 Ga0105239_10161516
489 Ga0105239_13268656
490 Ga0157335_1009067
491 Ga0157373_10697434
492 Ga0157374_10018398
493 Ga0157378_10241958
494 Ga0163162_10326991
495 Ga0157372_12233222
496 Ga0157375_10266651
497 Ga0163163_10368183
498 Ga0157380_10835877
499 Ga0157380_11478883
500 Ga0157376_10112346
501 Ga0206353_10982414
502 Ga0207692_10386989
503 Ga0207642_10058606
504 Ga0207710_10005744
505 Ga0207688_10031095
506 Ga0207685_10537727
507 Ga0207654_10422325
508 Ga0207707_10140832
509 Ga0207660_10478970
510 Ga0207662_10057309
511 Ga0207657_10164421
512 Ga0207649_10180892
513 Ga0207694_10744274
514 Ga0207687_10027346
515 Ga0207700_10007110
516 Ga0207700_10251215
517 Ga0207664_10008817
518 Ga0207664_10072411
519 Ga0207644_10550442
520 Ga0207690_10374302
521 Ga0207706_10097556
522 Ga0207709_10309353
523 Ga0207669_10316329
524 Ga0207704_10704691
525 Ga0207665_10007272
526 Ga0207689_10026607
527 Ga0207689_10203168
528 Ga0207661_10714647
529 Ga0207679_10134760
530 Ga0207667_10336655
531 Ga0207712_10381334
532 Ga0207712_11030214
533 Ga0207668_10924861
534 Ga0207668_11800807
535 Ga0207640_10484194
536 Ga0207640_10698201
537 Ga0207677_10198371
538 Ga0207677_10281566
539 Ga0207703_11003550
540 Ga0207708_10065061
541 Ga0207702_10027475
542 Ga0207641_11879654
543 Ga0207676_10350701
544 Ga0207676_11566289
545 Ga0207683_10017327
546 Ga0207683_10359934
547 Ga0207683_10829844
548 Ga0207698_10034462
549 Ga0207428_10435553
550 Ga0268266_11208589
551 Ga0268266_11228314
552 Ga0268266_11627182
553 Ga0268264_10055998
554 Ga0307517_10038204
555 Ga0307517_10131211
556 Ga0307515_10001120
557 Ga0307515_10302747
558 Ga0307511_10014003
559 Ga0307511_10043996
560 Ga0307513_10674167
561 Ga0307509_10017785
562 Ga0307509_10018075
563 Ga0307509_10023449
564 Ga0307509_10454495
565 Ga0307408_100017053
566 Ga0307508_10014952
567 Ga0307508_10119399
568 Ga0307514_10064815
569 Ga0307516_10016134
570 Ga0307516_10031213
571 Ga0307516_10100767
572 Ga0307405_10048658
573 Ga0307405_11008436
574 Ga0307413_10075083
575 Ga0307518_10058320
576 Ga0307518_10073432
577 Ga0307518_10112311
578 Ga0307518_10183665
579 Ga0307410_11387997
580 Ga0326468_10000580
581 Ga0307406_10009049
582 Ga0307406_11220160
583 Ga0307407_10022477
584 Ga0307407_11006645
585 Ga0307412_10052263
586 Ga0307409_100039815
587 Ga0307409_100057902
588 Ga0307416_100734056
589 Ga0307411_11463817
590 Ga0307415_101483109
591 Ga0307507_10014910
592 Ga0307507_10088744
593 Ga0307510_10026754
594 Ga0307510_10043312
595 Ga0307510_10122568
596 Ga0307510_10425358
597 Ga0373958_0071570
598 Ga0373938_0002819
599 Ga0373926_0005183
600 Ga0373934_0009823
601 Ga0373923_0004923
602 Ga0373936_0011229
603 Ga0373945_0011876
604 Ga0373953_0038089
605 Ga0373957_0033095
606 Ga0373943_0164079
607 Ga0373946_0001136
608 Ga0373955_0003589
609 Ga0373961_0025059
610 Ga0373924_0021207
611 Ga0373931_0053451
612 Ga0373935_0529582
613 Ga0373927_0028794
614 Ga0373933_0007453
615 Ga0373947_0005995
616 Ga0373937_0079658
617 Ga0373925_0119026
618 Ga0439436_0003781
619 Ga0439439_0009910
620 Ga0451793_0436988
621 Ga0451795_0118319
622 Ga0451855_1373297
623 Ga0451853_1566690
624 Ga0451853_2272188
625 Ga0439449_0019938
626 Ga0439457_001620
627 Ga0450907_028163
628 Ga0466969_0001658
629 Ga0466972_0011391
630 Ga0466965_0035015
631 Ga0466970_0352261
632 Ga0466957_0288810
633 Ga0495592_0072345
634 Ga0495592_0607578
635 Ga0495629_0015058
636 Ga0495629_0015270
637 Ga0495629_0801072
638 Ga0495638_0064589
639 Ga0495641_0009266
640 Ga0495651_0019973
641 Ga0495651_0036331
642 Ga0495651_0039598
643 Ga0495580_0008473
644 Ga0495582_0000865
645 Ga0495639_0006082
646 Ga0495662_0003339
647 Ga0495662_0003471
648 Ga0495664_0000589
649 Ga0495664_0055379
650 Ga0495585_0161354
651 Ga0495594_0074515
652 Ga0495594_0079239
653 Ga0495594_0276353
654 Ga0495608_0050278
655 Ga0495618_0002887
656 Ga0495628_0038409
657 Ga0495628_0125463
658 Ga0495630_0014953
659 Ga0495630_0089704
660 Ga0495643_0003600
661 Ga0495666_0002761
662 Ga0495652_0017793
663 Ga0495652_0121908
664 Ga0495665_0000568
665 Ga0495640_0039985
666 Ga0495640_0071143
667 Ga0495586_0029363
668 Ga0495587_0002283
669 Ga0495587_0155526
670 Ga0495645_0050357
671 Ga0495645_0067532
672 Ga0495645_0237452
673 Ga0495622_0272071
674 Ga0495633_0066323
675 Ga0495667_0058524
676 Ga0495656_0244252
677 Ga0495634_0002198
678 Ga0495634_0098854
679 Ga0495625_0033442
680 Ga0495635_0000703
681 Ga0495635_0072877
682 Ga0495588_0009622
683 Ga0495588_0216340
684 Ga0495657_0026194
685 Ga0495657_0031291
686 Ga0495599_0022706
687 Ga0495623_0217913
688 Ga0495646_0003020
689 Ga0495646_0006727
690 Ga0495646_0400881
691 Ga0495647_0038173
692 Ga0495658_0011345
693 Ga0495613_0000749
694 Ga0495613_0033164
695 Ga0495613_0621034
696 Ga0495624_0058064
697 Ga0495670_0021248
698 Ga0495671_0034937
699 Ga0495671_0375688
700 Ga0495649_0178989
701 Ga0495589_0038714
702 Ga0495600_0173475
703 Ga0495600_0305143
704 Ga0495600_0701690
705 Ga0495660_0493292
706 Ga0495581_0055878
707 Ga0495604_0004131
708 Ga0495604_0010587
709 Ga0495604_0039678
710 Ga0495676_0010915
711 Ga0495680_0053244
712 Ga0495683_0053972
713 Ga0495687_002006
714 Ga0495687_070819
715 Ga0495675_0021741
716 Ga0495679_022843
717 Ga0495685_001856
718 Ga0495681_0002469
719 Ga0495681_0005531
720 Ga0495684_0009751
721 Ga0495684_0778592
722 Ga0495686_0095151
723 Ga0495593_0029996
724 Ga0495593_0552726
725 Ga0495602_0021639
726 Ga0495602_0082872
727 Ga0495614_0038626
728 Ga0496101_0615689
729 Ga0496102_0556748
730 Ga0496103_0052985
731 Ga0496104_0206886
732 Ga0496105_0659726
733 Ga0496106_0717215
734 Ga0496107_1009926
735 Ga0496108_0000034
736 Ga0496108_0004709
737 Ga0496108_0029277
738 Ga0496109_0007285
739 Ga0496109_0078457
740 Ga0496109_0083781
741 Ga0496110_0019129
742 Ga0496110_0130147
743 Ga0496111_0078618
744 Ga0496111_0322554
745 Ga0496111_0435272
746 Ga0496112_0644254
747 Ga0496114_1487526
748 Ga0496115_0370906
749 Ga0496115_0642931
750 Ga0496126_0300277
751 Ga0501037_0181122
752 Ga0501047_0376630
753 Ga0501077_0109570
754 nmdc:mga00v17_342719_c1
755 nmdc:mga08y16_118137_c1
756 Ga0495601_0042947
757 Ga0495612_0017727
758 Ga0495655_0073131
759 Ga0495655_0089864
760 Ga0495619_0024112
761 Ga0495619_0054923
762 Ga0500578_0032907
763 Ga0500644_0009121
764 Ga0500646_0000059
765 Ga0500583_0068771
766 Ga0500640_014720
767 Ga0500641_0021583
768 Ga0500654_104919
769 Ga0500660_136045
770 Ga0500553_055120
771 Ga0500560_001231
772 Ga0500560_137206
773 Ga0500569_139157
774 Ga0500572_154580
775 Ga0500594_0213825
776 Ga0500614_128999
777 Ga0500628_005396
778 Ga0500652_009077
779 Ga0500658_0033720
780 Ga0500561_0002665
781 Ga0500577_0377913
782 Ga0500588_0256378
783 Ga0500600_0082332
784 Ga0500616_0023851
785 Ga0500622_0354585
786 Ga0500633_0052738
787 Ga0500634_0030409
788 Ga0500636_0301745
789 Ga0500656_064244
790 Ga0500587_014260
791 2585313720
792 2729904822
793 2753266057
794 2799182875
795 2832006028
796 2837275593
797 2866070568
798 2884997847
799 2895435998
800 2929230856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

27

129

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lqb-assembly1.cif.gz_B crystal structure of uncharacterized protein kfla3161 0.9451 1 126
4lqb-assembly1.cif.gz_B crystal structure of uncharacterized protein kfla3161 0.938 1 126
7ode-assembly1.cif.gz_K e. coli 50s ribosome licl core particle 0.8838 86 109
2hbp-assembly1.cif.gz_A solution structure of sla1 homology domain 1 0.8636 86 108
8qyq-assembly1.cif.gz_A beta-cardiac myosin s1 fragment in the pre-powerstroke state complexed to mavacamten 0.8147 86 110
ID Description Score Start End Superfamily
4lqbB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9437 1 126 3.10.180.10
4lqbB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9365 1 126 3.10.180.10
af_O45110_151_229_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9201 86 109 2.30.30.30
af_E7F8R3_156_236_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9064 86 109 2.30.30.30
af_A0A2R8RPG4_594_663_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8957 86 109 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A560AFB3-F1-model_v4 deleted 0.9904 2 126
AF-L1KI64-F1-model_v4 Glyoxalase-like domain-containing protein 0.9899 2 125
AF-A0A2T0KCP9-F1-model_v4 Glyoxalase-like domain-containing protein 0.9815 1 126
AF-A0A1H5YGU6-F1-model_v4 Glyoxalase-like domain-containing protein 0.9802 2 126
AF-A0A810MQ80-F1-model_v4 deleted 0.9773 1 126

Map