F434699

General Info

Members Datasets Scaffolds Average Seq Length
400 199 800 147

Family's Representative Sequence

Representative Sequence 3300049824|Ga0501045_0117925|Ga0501045_0117925_313_783
Length 133
Sequence MGAVVALEELRLPPGLRLPYKTLKRGKFSADAPILDNIISEEGVGALVVGLPLNMDGSDGPSAQSARAFARNWAARSPIPLCFQDERLSTSAVTRTLIEADASRRRRSEVVDKMAAAYILQGALDRLRNLRGG

Samples

Sample ID Description Type Environment
1 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
118 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
154 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
195 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
196 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
197 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2
Nodule 0
Rhizoplane 0.25
Rhizosphere 96.5
Stem 0
Stem Tuber 0
Unclassified 4.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501045_0117925 3300049824 Bacteria 1970
2 JGI25165J46597_1000300 3300003214 Bacteria 62270
3 Ga0070658_10063822 3300005327 Unclassified 3003
4 Ga0070676_10102303 3300005328 Bacteria 1772
5 Ga0070676_10344708 3300005328 Bacteria 1023
6 Ga0070683_100465134 3300005329 Bacteria 1207
7 Ga0070690_100042545 3300005330 Bacteria 2877
8 Ga0070670_100506783 3300005331 Unclassified 1074
9 Ga0070670_101235594 3300005331 Bacteria 683
10 Ga0068869_100003383 3300005334 Bacteria 9737
11 Ga0068869_100046903 3300005334 Bacteria 3118
12 Ga0070666_10001195 3300005335 Bacteria 15704
13 Ga0070666_10005611 3300005335 Bacteria 7699
14 Ga0070666_10083161 3300005335 Bacteria 2190
15 Ga0070680_100075447 3300005336 Bacteria 2776
16 Ga0068868_100125058 3300005338 Bacteria 2100
17 Ga0068868_100415730 3300005338 Bacteria 1163
18 Ga0068868_100599492 3300005338 Bacteria 976
19 Ga0070660_100049381 3300005339 Bacteria 3234
20 Ga0070661_100112606 3300005344 Bacteria 2033
21 Ga0070661_100705031 3300005344 Bacteria 823
22 Ga0070668_101526023 3300005347 Bacteria 611
23 Ga0070675_100155399 3300005354 Bacteria 1964
24 Ga0070675_100407319 3300005354 Bacteria 1214
25 Ga0070671_100249841 3300005355 Bacteria 1506
26 Ga0070671_100369831 3300005355 Unclassified 1224
27 Ga0070673_100327265 3300005364 Bacteria 1355
28 Ga0070659_100004447 3300005366 Bacteria 10014
29 Ga0070667_100140536 3300005367 Bacteria 2114
30 Ga0070667_100620608 3300005367 Bacteria 997
31 Ga0070678_100012676 3300005456 Bacteria 5254
32 Ga0070678_100067716 3300005456 Bacteria 2659
33 Ga0070678_100135078 3300005456 Bacteria 1966
34 Ga0070662_100145114 3300005457 Bacteria 1843
35 Ga0070681_10843396 3300005458 Bacteria 834
36 Ga0068867_100007843 3300005459 Bacteria 7543
37 Ga0068867_100068100 3300005459 Bacteria 2656
38 Ga0068867_100453919 3300005459 Bacteria 1093
39 Ga0070685_10075930 3300005466 Unclassified 2003
40 Ga0070679_100032939 3300005530 Bacteria 5129
41 Ga0070679_100369172 3300005530 Bacteria 1382
42 Ga0070684_100063751 3300005535 Bacteria 3231
43 Ga0068853_100147202 3300005539 Bacteria 2117
44 Ga0068853_100487635 3300005539 Bacteria 1162
45 Ga0070693_100292640 3300005547 Bacteria 1095
46 Ga0070665_100060598 3300005548 Bacteria 3793
47 Ga0070665_100307229 3300005548 Bacteria 1589
48 Ga0070665_100399544 3300005548 Bacteria 1382
49 Ga0070665_100728286 3300005548 Bacteria 1005
50 Ga0070665_100796427 3300005548 Bacteria 958
51 Ga0070665_101754963 3300005548 Bacteria 627
52 Ga0068855_100000131 3300005563 Bacteria 95330
53 Ga0068855_100034952 3300005563 Bacteria 5989
54 Ga0068855_100135159 3300005563 Bacteria 2813
55 Ga0068855_100157055 3300005563 Bacteria 2584
56 Ga0068855_100700453 3300005563 Bacteria 1084
57 Ga0068857_100071864 3300005577 Bacteria 3083
58 Ga0068857_101447235 3300005577 Bacteria 669
59 Ga0068856_100259091 3300005614 Bacteria 1754
60 Ga0070702_100421399 3300005615 Unclassified 961
61 Ga0068852_100039099 3300005616 Bacteria 3992
62 Ga0068852_100069809 3300005616 Bacteria 3081
63 Ga0068852_100863225 3300005616 Bacteria 921
64 Ga0068859_100885129 3300005617 Bacteria 978
65 Ga0068859_101016850 3300005617 Bacteria 910
66 Ga0068864_100059836 3300005618 Bacteria 3297
67 Ga0068866_10136876 3300005718 Bacteria 1401
68 Ga0068861_101630656 3300005719 Bacteria 636
69 Ga0068851_10616880 3300005834 Bacteria 661
70 Ga0068870_10224234 3300005840 Bacteria 1152
71 Ga0068863_100041977 3300005841 Bacteria 4347
72 Ga0068858_100016193 3300005842 Bacteria 7003
73 Ga0068858_100310724 3300005842 Bacteria 1505
74 Ga0068860_100325228 3300005843 Bacteria 1510
75 Ga0068860_100447134 3300005843 Bacteria 1285
76 Ga0068862_102419458 3300005844 Bacteria 537
77 Ga0097621_100164193 3300006237 Bacteria 1911
78 Ga0097621_100730483 3300006237 Bacteria 913
79 Ga0068871_100014625 3300006358 Bacteria 5854
80 Ga0068871_100027227 3300006358 Bacteria 4468
81 Ga0068871_100053830 3300006358 Bacteria 3263
82 Ga0068865_100019701 3300006881 Bacteria 4368
83 Ga0068865_100207439 3300006881 Bacteria 1525
84 Ga0097620_100885113 3300006931 Bacteria 978
85 Ga0097620_101016817 3300006931 Bacteria 910
86 Ga0105240_10000400 3300009093 Bacteria 80751
87 Ga0105240_10073206 3300009093 Bacteria 4231
88 Ga0105240_10404849 3300009093 Bacteria 1536
89 Ga0105240_10461653 3300009093 Bacteria 1419
90 Ga0105245_10006698 3300009098 Bacteria 10105
91 Ga0105245_10447268 3300009098 Bacteria 1300
92 Ga0105247_10031604 3300009101 Bacteria 3213
93 Ga0105247_10052668 3300009101 Bacteria 2510
94 Ga0105243_10005664 3300009148 Bacteria 9723
95 Ga0105241_10032684 3300009174 Bacteria 3902
96 Ga0105241_10101608 3300009174 Bacteria 2286
97 Ga0105241_10185130 3300009174 Bacteria 1730
98 Ga0105241_10562570 3300009174 Bacteria 1025
99 Ga0105241_11558944 3300009174 Bacteria 638
100 Ga0105242_10066507 3300009176 Bacteria 2977
101 Ga0105242_10076271 3300009176 Bacteria 2794
102 Ga0105242_10219538 3300009176 Bacteria 1698
103 Ga0105242_10452472 3300009176 Bacteria 1211
104 Ga0105242_10833973 3300009176 Bacteria 916
105 Ga0105248_10000013 3300009177 Bacteria 328864
106 Ga0105248_10013643 3300009177 Bacteria 8944
107 Ga0105248_10140300 3300009177 Bacteria 2726
108 Ga0105237_10075120 3300009545 Bacteria 3371
109 Ga0105237_10096643 3300009545 Bacteria 2944
110 Ga0105237_10117688 3300009545 Bacteria 2651
111 Ga0105237_10309897 3300009545 Bacteria 1582
112 Ga0105237_11087244 3300009545 Bacteria 806
113 Ga0105238_10124394 3300009551 Bacteria 2558
114 Ga0105238_10179130 3300009551 Bacteria 2096
115 Ga0105238_11112868 3300009551 Bacteria 813
116 Ga0105249_10976290 3300009553 Bacteria 915
117 Ga0105029_108952 3300009984 Bacteria 742
118 Ga0105239_10006956 3300010375 Bacteria 13038
119 Ga0105239_10011087 3300010375 Bacteria 10060
120 Ga0105239_10049331 3300010375 Bacteria 4616
121 Ga0105239_10081326 3300010375 Bacteria 3565
122 Ga0105239_10309999 3300010375 Bacteria 1779
123 Ga0105239_10855859 3300010375 Bacteria 1043
124 Ga0105246_10038415 3300011119 Bacteria 3219
125 Ga0157373_10640523 3300013100 Bacteria 776
126 Ga0157370_10194169 3300013104 Bacteria 1884
127 Ga0157370_10783584 3300013104 Bacteria 868
128 Ga0157369_10051024 3300013105 Bacteria 4478
129 Ga0157374_10109750 3300013296 Unclassified 2652
130 Ga0157378_10004593 3300013297 Bacteria 12114
131 Ga0157378_10186683 3300013297 Bacteria 1953
132 Ga0157378_10216419 3300013297 Bacteria 1819
133 Ga0157378_10466258 3300013297 Unclassified 1256
134 Ga0163162_10066962 3300013306 Bacteria 3641
135 Ga0163162_10072574 3300013306 Bacteria 3497
136 Ga0157372_10109997 3300013307 Bacteria 3156
137 Ga0157372_12459773 3300013307 Bacteria 598
138 Ga0157375_10033027 3300013308 Bacteria 4913
139 Ga0157375_10976527 3300013308 Bacteria 988
140 Ga0157375_11421209 3300013308 Bacteria 818
141 Ga0157375_11559458 3300013308 Bacteria 780
142 Ga0163163_10000408 3300014325 Bacteria 40524
143 Ga0163163_10022071 3300014325 Bacteria 6020
144 Ga0163163_10168743 3300014325 Bacteria 2235
145 Ga0163163_11267876 3300014325 Bacteria 799
146 Ga0163163_12049748 3300014325 Bacteria 632
147 Ga0157380_11722963 3300014326 Bacteria 684
148 Ga0157377_10331184 3300014745 Bacteria 1015
149 Ga0157379_10001140 3300014968 Bacteria 21760
150 Ga0157379_10036905 3300014968 Bacteria 4358
151 Ga0157379_10412579 3300014968 Bacteria 1243
152 Ga0157379_11132711 3300014968 Bacteria 750
153 Ga0157379_11254037 3300014968 Bacteria 714
154 Ga0157379_11673019 3300014968 Bacteria 623
155 Ga0157376_10023591 3300014969 Bacteria 4817
156 Ga0163161_10033551 3300017792 Bacteria 3668
157 Ga0209233_1000013 3300025261 Bacteria 1013785
158 Ga0209233_1017913 3300025261 Bacteria 1919
159 Ga0207656_10181736 3300025321 Bacteria 1010
160 Ga0207656_10410137 3300025321 Bacteria 682
161 Ga0207710_10141455 3300025900 Unclassified 1162
162 Ga0207680_10000663 3300025903 Bacteria 16270
163 Ga0207680_10036112 3300025903 Bacteria 2844
164 Ga0207680_10076813 3300025903 Bacteria 2087
165 Ga0207645_10020347 3300025907 Bacteria 4344
166 Ga0207645_10439355 3300025907 Bacteria 880
167 Ga0207705_10266279 3300025909 Unclassified 1310
168 Ga0207654_10147129 3300025911 Bacteria 1508
169 Ga0207654_10154092 3300025911 Bacteria 1478
170 Ga0207654_10471304 3300025911 Unclassified 883
171 Ga0207654_10607537 3300025911 Bacteria 781
172 Ga0207707_10889795 3300025912 Bacteria 737
173 Ga0207695_10000004 3300025913 Bacteria 1288665
174 Ga0207695_10024245 3300025913 Bacteria 6831
175 Ga0207695_10117546 3300025913 Bacteria 2631
176 Ga0207695_10272828 3300025913 Bacteria 1587
177 Ga0207671_10056713 3300025914 Bacteria 2903
178 Ga0207671_10069477 3300025914 Bacteria 2625
179 Ga0207671_10163060 3300025914 Bacteria 1727
180 Ga0207671_10234594 3300025914 Bacteria 1440
181 Ga0207693_10014652 3300025915 Bacteria 6300
182 Ga0207663_10118947 3300025916 Bacteria 1805
183 Ga0207657_10012173 3300025919 Bacteria 8501
184 Ga0207657_10335096 3300025919 Bacteria 1195
185 Ga0207649_10462853 3300025920 Unclassified 959
186 Ga0207694_10244994 3300025924 Bacteria 1465
187 Ga0207694_10935613 3300025924 Bacteria 733
188 Ga0207650_10395243 3300025925 Unclassified 1143
189 Ga0207659_10242183 3300025926 Bacteria 1460
190 Ga0207659_10894125 3300025926 Bacteria 763
191 Ga0207687_10011251 3300025927 Bacteria 5845
192 Ga0207687_10400897 3300025927 Bacteria 1128
193 Ga0207644_10335988 3300025931 Unclassified 1224
194 Ga0207644_10506666 3300025931 Bacteria 996
195 Ga0207706_10039587 3300025933 Bacteria 4179
196 Ga0207686_10037574 3300025934 Bacteria 2923
197 Ga0207686_10933143 3300025934 Bacteria 702
198 Ga0207669_10784643 3300025937 Bacteria 789
199 Ga0207704_10010801 3300025938 Bacteria 4469
200 Ga0207704_10039894 3300025938 Bacteria 2739
201 Ga0207711_10000003 3300025941 Bacteria 1042791
202 Ga0207711_10013296 3300025941 Bacteria 6837
203 Ga0207711_10069592 3300025941 Bacteria 3051
204 Ga0207711_10190303 3300025941 Bacteria 1870
205 Ga0207689_10038663 3300025942 Bacteria 3951
206 Ga0207689_10488591 3300025942 Bacteria 1031
207 Ga0207661_10117109 3300025944 Bacteria 2263
208 Ga0207661_10712490 3300025944 Bacteria 923
209 Ga0207667_10000200 3300025949 Bacteria 86644
210 Ga0207667_10091024 3300025949 Bacteria 3152
211 Ga0207667_10109312 3300025949 Bacteria 2851
212 Ga0207667_10541267 3300025949 Bacteria 1178
213 Ga0207667_10649417 3300025949 Bacteria 1061
214 Ga0207651_11719134 3300025960 Bacteria 565
215 Ga0207658_10398251 3300025986 Bacteria 1209
216 Ga0207677_10076035 3300026023 Bacteria 2389
217 Ga0207677_10467966 3300026023 Bacteria 1083
218 Ga0207677_10844453 3300026023 Bacteria 822
219 Ga0207703_10013751 3300026035 Bacteria 6309
220 Ga0207703_10032267 3300026035 Bacteria 4145
221 Ga0207703_10257174 3300026035 Bacteria 1577
222 Ga0207639_10088425 3300026041 Unclassified 2472
223 Ga0207639_10121459 3300026041 Bacteria 2147
224 Ga0207639_10369257 3300026041 Bacteria 1286
225 Ga0207639_10412719 3300026041 Bacteria 1219
226 Ga0207639_10656049 3300026041 Bacteria 971
227 Ga0207702_10052585 3300026078 Bacteria 3447
228 Ga0207702_10752797 3300026078 Bacteria 962
229 Ga0207641_10050415 3300026088 Bacteria 3521
230 Ga0207648_10010650 3300026089 Bacteria 8692
231 Ga0207648_10023269 3300026089 Bacteria 5556
232 Ga0207648_10297884 3300026089 Bacteria 1446
233 Ga0207676_10096077 3300026095 Bacteria 2445
234 Ga0207674_10101704 3300026116 Bacteria 2854
235 Ga0207674_10295639 3300026116 Bacteria 1568
236 Ga0207674_10819603 3300026116 Bacteria 898
237 Ga0207674_11101373 3300026116 Bacteria 764
238 Ga0207683_10007703 3300026121 Bacteria 9224
239 Ga0207683_10035891 3300026121 Bacteria 4313
240 Ga0207683_10167068 3300026121 Bacteria 1991
241 Ga0207698_10113424 3300026142 Unclassified 2277
242 Ga0207698_10828092 3300026142 Bacteria 929
243 Ga0268266_10046147 3300028379 Bacteria 3730
244 Ga0268266_10201978 3300028379 Unclassified 1819
245 Ga0268266_10340090 3300028379 Bacteria 1408
246 Ga0268266_10855421 3300028379 Bacteria 879
247 Ga0268264_10624997 3300028381 Bacteria 1064
248 Ga0268264_11290293 3300028381 Bacteria 740
249 Ga0265337_1002241 3300028556 Bacteria 8990
250 Ga0265334_10004033 3300028573 Bacteria 6586
251 Ga0265338_10000017 3300028800 Bacteria 344481
252 Ga0265338_10043541 3300028800 Bacteria 4161
253 Ga0265338_10047457 3300028800 Bacteria 3921
254 Ga0265338_10147828 3300028800 Bacteria 1830
255 Ga0265325_10000016 3300031241 Bacteria 130316
256 Ga0265325_10000524 3300031241 Bacteria 27640
257 Ga0265325_10020793 3300031241 Bacteria 3614
258 Ga0265325_10085013 3300031241 Bacteria 1568
259 Ga0265340_10003391 3300031247 Bacteria 8997
260 Ga0265340_10026439 3300031247 Bacteria 2934
261 Ga0265339_10003299 3300031249 Bacteria 11299
262 Ga0265339_10008760 3300031249 Bacteria 6412
263 Ga0265339_10017591 3300031249 Bacteria 4230
264 Ga0265339_10031931 3300031249 Bacteria 2972
265 Ga0265331_10003090 3300031250 Bacteria 10919
266 Ga0265331_10010837 3300031250 Bacteria 5014
267 Ga0265316_10108937 3300031344 Bacteria 2099
268 Ga0265316_10191021 3300031344 Bacteria 1521
269 Ga0265316_10466084 3300031344 Bacteria 905
270 Ga0265316_10469469 3300031344 Bacteria 901
271 Ga0265316_10797845 3300031344 Bacteria 662
272 Ga0265313_10002634 3300031595 Bacteria 15266
273 Ga0265313_10002760 3300031595 Bacteria 14807
274 Ga0265313_10079489 3300031595 Bacteria 1492
275 Ga0307508_10263760 3300031616 Bacteria 1317
276 Ga0265314_10024137 3300031711 Bacteria 4617
277 Ga0265314_10046461 3300031711 Bacteria 3063
278 Ga0265314_10105835 3300031711 Bacteria 1798
279 Ga0265342_10007329 3300031712 Bacteria 8094
280 Ga0265342_10019841 3300031712 Bacteria 4324
281 Ga0265342_10154410 3300031712 Bacteria 1272
282 Ga0265342_10226271 3300031712 Bacteria 1006
283 Ga0307516_10004590 3300031730 Bacteria 16950
284 Ga0373946_0489162 3300035171 Bacteria 630
285 Ga0373955_0413236 3300035172 Bacteria 820
286 Ga0373931_0549109 3300035691 Bacteria 750
287 Ga0373935_0458026 3300035692 Bacteria 922
288 Ga0373927_0149782 3300035695 Bacteria 1528
289 Ga0373947_0801677 3300035725 Bacteria 643
290 Ga0373937_0000928 3300036401 Bacteria 24838
291 Ga0373925_0433290 3300037068 Bacteria 1075
292 Ga0395899_0159910 3300037312 Bacteria 1592
293 Ga0395900_0042633 3300037418 Bacteria 4676
294 Ga0395898_0024340 3300037466 Bacteria 6106
295 Ga0395901_0038343 3300038443 Bacteria 4956
296 Ga0436365_1169716 3300039437 Unclassified 2218
297 Ga0436363_1273484 3300039450 Bacteria 4222
298 Ga0436362_0353563 3300039453 Bacteria 825
299 Ga0495629_0201230 3300046459 Bacteria 1377
300 Ga0495651_0479000 3300046462 Bacteria 800
301 Ga0495580_0180416 3300046472 Bacteria 1458
302 Ga0495639_0208311 3300046475 Bacteria 959
303 Ga0495662_0291800 3300046476 Bacteria 803
304 Ga0495664_0051017 3300046477 Bacteria 2457
305 Ga0495606_0408895 3300046507 Bacteria 705
306 Ga0495608_0476302 3300046511 Bacteria 758
307 Ga0495616_0330422 3300046513 Bacteria 638
308 Ga0495620_0057189 3300046515 Bacteria 1638
309 Ga0495652_0057723 3300046529 Bacteria 3290
310 Ga0495652_0162622 3300046529 Bacteria 1731
311 Ga0495587_0033173 3300046536 Bacteria 3118
312 Ga0495609_0081127 3300046538 Bacteria 1418
313 Ga0495621_0326807 3300046539 Bacteria 640
314 Ga0495667_0690488 3300046559 Unclassified 633
315 Ga0495611_0431838 3300046648 Bacteria 601
316 Ga0495589_0081073 3300046794 Bacteria 1579
317 Ga0495600_0658164 3300046809 Bacteria 633
318 Ga0495672_0086987 3300047320 Bacteria 1727
319 Ga0495675_0267178 3300047444 Bacteria 1023
320 Ga0495602_0875982 3300048088 Bacteria 599
321 Ga0496115_0914310 3300048918 Bacteria 676
322 Ga0496126_0100086 3300048929 Bacteria 2538
323 Ga0495682_0001300 3300049460 Bacteria 13878
324 Ga0501031_0008522 3300049568 Bacteria 6673
325 Ga0501031_0154977 3300049568 Bacteria 1497
326 Ga0501032_0005105 3300049569 Bacteria 9796
327 Ga0501032_0161394 3300049569 Bacteria 1472
328 Ga0501032_0200251 3300049569 Bacteria 1303
329 Ga0501032_0286052 3300049569 Bacteria 1067
330 Ga0501033_0056313 3300049570 Bacteria 2906
331 Ga0501033_0057096 3300049570 Bacteria 2885
332 Ga0501033_0069371 3300049570 Bacteria 2591
333 Ga0501033_0074719 3300049570 Bacteria 2488
334 Ga0501033_0141221 3300049570 Bacteria 1741
335 Ga0501033_0155248 3300049570 Bacteria 1649
336 Ga0501036_0020815 3300049572 Bacteria 5509
337 Ga0501036_0443763 3300049572 Bacteria 1081
338 Ga0501036_0486579 3300049572 Bacteria 1027
339 Ga0501037_0046814 3300049573 Bacteria 3171
340 Ga0501037_0051175 3300049573 Bacteria 3021
341 Ga0501038_0020263 3300049574 Bacteria 5982
342 Ga0501038_0083542 3300049574 Bacteria 2688
343 Ga0501038_0083758 3300049574 Bacteria 2684
344 Ga0501038_0094113 3300049574 Bacteria 2505
345 Ga0501038_0148561 3300049574 Bacteria 1912
346 Ga0501038_0165560 3300049574 Bacteria 1794
347 Ga0501039_0028995 3300049575 Bacteria 4262
348 Ga0501040_0063213 3300049576 Bacteria 2547
349 Ga0501042_0005978 3300049578 Bacteria 7880
350 Ga0501043_0038738 3300049579 Bacteria 3748
351 Ga0501043_0145722 3300049579 Bacteria 1854
352 Ga0501046_0005870 3300049580 Bacteria 10949
353 Ga0501046_0199669 3300049580 Bacteria 1488
354 Ga0501047_0116435 3300049581 Bacteria 2554
355 Ga0501047_0144528 3300049581 Bacteria 2256
356 Ga0501047_0288876 3300049581 Bacteria 1484
357 Ga0501047_0565887 3300049581 Bacteria 960
358 Ga0501047_0818565 3300049581 Bacteria 746
359 Ga0501048_0006489 3300049582 Bacteria 8890
360 Ga0501067_0034371 3300049583 Bacteria 2813
361 Ga0501068_0043296 3300049584 Bacteria 2708
362 Ga0501069_0007852 3300049585 Bacteria 5601
363 Ga0501070_0000242 3300049586 Bacteria 51302
364 Ga0501070_0019864 3300049586 Bacteria 5633
365 Ga0501070_0218311 3300049586 Bacteria 1564
366 Ga0501070_0291339 3300049586 Bacteria 1330
367 Ga0501072_0023502 3300049588 Bacteria 4789
368 Ga0501073_0014646 3300049589 Bacteria 5697
369 Ga0501073_0120167 3300049589 Bacteria 1821
370 Ga0501073_0283419 3300049589 Bacteria 1143
371 Ga0501076_0655167 3300049592 Bacteria 867
372 Ga0501079_0001660 3300049741 Bacteria 15834
373 Ga0501079_0816261 3300049741 Bacteria 734
374 Ga0501080_0015374 3300049742 Bacteria 7054
375 Ga0501080_0194160 3300049742 Bacteria 1865
376 Ga0501080_0311616 3300049742 Bacteria 1426
377 Ga0501083_0000548 3300049744 Bacteria 23997
378 Ga0501035_0002988 3300049822 Bacteria 16241
379 Ga0501035_0010881 3300049822 Bacteria 8424
380 Ga0501035_0049793 3300049822 Bacteria 3754
381 Ga0501035_0097879 3300049822 Bacteria 2576
382 Ga0501035_0134135 3300049822 Bacteria 2157
383 Ga0501035_0281139 3300049822 Bacteria 1406
384 Ga0501035_0303234 3300049822 Bacteria 1345
385 Ga0501044_0001386 3300049823 Bacteria 28428
386 Ga0501044_0010640 3300049823 Bacteria 9981
387 Ga0501044_0016669 3300049823 Bacteria 7890
388 Ga0501044_0017693 3300049823 Bacteria 7645
389 Ga0501044_0094029 3300049823 Bacteria 3022
390 Ga0501044_0161367 3300049823 Bacteria 2218
391 Ga0501044_0186550 3300049823 Bacteria 2038
392 Ga0501044_0484506 3300049823 Bacteria 1139
393 Ga0501044_0600886 3300049823 Bacteria 993
394 Ga0500595_000734 3300053119 Bacteria 19488
395 Ga0500595_029917 3300053119 Bacteria 1842
396 Ga0500642_0211902 3300053130 Unclassified 899
397 Ga0500655_004209 3300053133 Bacteria 2592
398 Ga0500573_0000050 3300053140 Bacteria 95598
399 Ga0501084_0000873 3300054114 Bacteria 23317
400 Ga0501082_0050752 3300060353 Bacteria 3577
401 Ga0501045_0117925
402 JGI25165J46597_1000300
403 Ga0070658_10063822
404 Ga0070676_10102303
405 Ga0070676_10344708
406 Ga0070683_100465134
407 Ga0070690_100042545
408 Ga0070670_100506783
409 Ga0070670_101235594
410 Ga0068869_100003383
411 Ga0068869_100046903
412 Ga0070666_10001195
413 Ga0070666_10005611
414 Ga0070666_10083161
415 Ga0070680_100075447
416 Ga0068868_100125058
417 Ga0068868_100415730
418 Ga0068868_100599492
419 Ga0070660_100049381
420 Ga0070661_100112606
421 Ga0070661_100705031
422 Ga0070668_101526023
423 Ga0070675_100155399
424 Ga0070675_100407319
425 Ga0070671_100249841
426 Ga0070671_100369831
427 Ga0070673_100327265
428 Ga0070659_100004447
429 Ga0070667_100140536
430 Ga0070667_100620608
431 Ga0070678_100012676
432 Ga0070678_100067716
433 Ga0070678_100135078
434 Ga0070662_100145114
435 Ga0070681_10843396
436 Ga0068867_100007843
437 Ga0068867_100068100
438 Ga0068867_100453919
439 Ga0070685_10075930
440 Ga0070679_100032939
441 Ga0070679_100369172
442 Ga0070684_100063751
443 Ga0068853_100147202
444 Ga0068853_100487635
445 Ga0070693_100292640
446 Ga0070665_100060598
447 Ga0070665_100307229
448 Ga0070665_100399544
449 Ga0070665_100728286
450 Ga0070665_100796427
451 Ga0070665_101754963
452 Ga0068855_100000131
453 Ga0068855_100034952
454 Ga0068855_100135159
455 Ga0068855_100157055
456 Ga0068855_100700453
457 Ga0068857_100071864
458 Ga0068857_101447235
459 Ga0068856_100259091
460 Ga0070702_100421399
461 Ga0068852_100039099
462 Ga0068852_100069809
463 Ga0068852_100863225
464 Ga0068859_100885129
465 Ga0068859_101016850
466 Ga0068864_100059836
467 Ga0068866_10136876
468 Ga0068861_101630656
469 Ga0068851_10616880
470 Ga0068870_10224234
471 Ga0068863_100041977
472 Ga0068858_100016193
473 Ga0068858_100310724
474 Ga0068860_100325228
475 Ga0068860_100447134
476 Ga0068862_102419458
477 Ga0097621_100164193
478 Ga0097621_100730483
479 Ga0068871_100014625
480 Ga0068871_100027227
481 Ga0068871_100053830
482 Ga0068865_100019701
483 Ga0068865_100207439
484 Ga0097620_100885113
485 Ga0097620_101016817
486 Ga0105240_10000400
487 Ga0105240_10073206
488 Ga0105240_10404849
489 Ga0105240_10461653
490 Ga0105245_10006698
491 Ga0105245_10447268
492 Ga0105247_10031604
493 Ga0105247_10052668
494 Ga0105243_10005664
495 Ga0105241_10032684
496 Ga0105241_10101608
497 Ga0105241_10185130
498 Ga0105241_10562570
499 Ga0105241_11558944
500 Ga0105242_10066507
501 Ga0105242_10076271
502 Ga0105242_10219538
503 Ga0105242_10452472
504 Ga0105242_10833973
505 Ga0105248_10000013
506 Ga0105248_10013643
507 Ga0105248_10140300
508 Ga0105237_10075120
509 Ga0105237_10096643
510 Ga0105237_10117688
511 Ga0105237_10309897
512 Ga0105237_11087244
513 Ga0105238_10124394
514 Ga0105238_10179130
515 Ga0105238_11112868
516 Ga0105249_10976290
517 Ga0105029_108952
518 Ga0105239_10006956
519 Ga0105239_10011087
520 Ga0105239_10049331
521 Ga0105239_10081326
522 Ga0105239_10309999
523 Ga0105239_10855859
524 Ga0105246_10038415
525 Ga0157373_10640523
526 Ga0157370_10194169
527 Ga0157370_10783584
528 Ga0157369_10051024
529 Ga0157374_10109750
530 Ga0157378_10004593
531 Ga0157378_10186683
532 Ga0157378_10216419
533 Ga0157378_10466258
534 Ga0163162_10066962
535 Ga0163162_10072574
536 Ga0157372_10109997
537 Ga0157372_12459773
538 Ga0157375_10033027
539 Ga0157375_10976527
540 Ga0157375_11421209
541 Ga0157375_11559458
542 Ga0163163_10000408
543 Ga0163163_10022071
544 Ga0163163_10168743
545 Ga0163163_11267876
546 Ga0163163_12049748
547 Ga0157380_11722963
548 Ga0157377_10331184
549 Ga0157379_10001140
550 Ga0157379_10036905
551 Ga0157379_10412579
552 Ga0157379_11132711
553 Ga0157379_11254037
554 Ga0157379_11673019
555 Ga0157376_10023591
556 Ga0163161_10033551
557 Ga0209233_1000013
558 Ga0209233_1017913
559 Ga0207656_10181736
560 Ga0207656_10410137
561 Ga0207710_10141455
562 Ga0207680_10000663
563 Ga0207680_10036112
564 Ga0207680_10076813
565 Ga0207645_10020347
566 Ga0207645_10439355
567 Ga0207705_10266279
568 Ga0207654_10147129
569 Ga0207654_10154092
570 Ga0207654_10471304
571 Ga0207654_10607537
572 Ga0207707_10889795
573 Ga0207695_10000004
574 Ga0207695_10024245
575 Ga0207695_10117546
576 Ga0207695_10272828
577 Ga0207671_10056713
578 Ga0207671_10069477
579 Ga0207671_10163060
580 Ga0207671_10234594
581 Ga0207693_10014652
582 Ga0207663_10118947
583 Ga0207657_10012173
584 Ga0207657_10335096
585 Ga0207649_10462853
586 Ga0207694_10244994
587 Ga0207694_10935613
588 Ga0207650_10395243
589 Ga0207659_10242183
590 Ga0207659_10894125
591 Ga0207687_10011251
592 Ga0207687_10400897
593 Ga0207644_10335988
594 Ga0207644_10506666
595 Ga0207706_10039587
596 Ga0207686_10037574
597 Ga0207686_10933143
598 Ga0207669_10784643
599 Ga0207704_10010801
600 Ga0207704_10039894
601 Ga0207711_10000003
602 Ga0207711_10013296
603 Ga0207711_10069592
604 Ga0207711_10190303
605 Ga0207689_10038663
606 Ga0207689_10488591
607 Ga0207661_10117109
608 Ga0207661_10712490
609 Ga0207667_10000200
610 Ga0207667_10091024
611 Ga0207667_10109312
612 Ga0207667_10541267
613 Ga0207667_10649417
614 Ga0207651_11719134
615 Ga0207658_10398251
616 Ga0207677_10076035
617 Ga0207677_10467966
618 Ga0207677_10844453
619 Ga0207703_10013751
620 Ga0207703_10032267
621 Ga0207703_10257174
622 Ga0207639_10088425
623 Ga0207639_10121459
624 Ga0207639_10369257
625 Ga0207639_10412719
626 Ga0207639_10656049
627 Ga0207702_10052585
628 Ga0207702_10752797
629 Ga0207641_10050415
630 Ga0207648_10010650
631 Ga0207648_10023269
632 Ga0207648_10297884
633 Ga0207676_10096077
634 Ga0207674_10101704
635 Ga0207674_10295639
636 Ga0207674_10819603
637 Ga0207674_11101373
638 Ga0207683_10007703
639 Ga0207683_10035891
640 Ga0207683_10167068
641 Ga0207698_10113424
642 Ga0207698_10828092
643 Ga0268266_10046147
644 Ga0268266_10201978
645 Ga0268266_10340090
646 Ga0268266_10855421
647 Ga0268264_10624997
648 Ga0268264_11290293
649 Ga0265337_1002241
650 Ga0265334_10004033
651 Ga0265338_10000017
652 Ga0265338_10043541
653 Ga0265338_10047457
654 Ga0265338_10147828
655 Ga0265325_10000016
656 Ga0265325_10000524
657 Ga0265325_10020793
658 Ga0265325_10085013
659 Ga0265340_10003391
660 Ga0265340_10026439
661 Ga0265339_10003299
662 Ga0265339_10008760
663 Ga0265339_10017591
664 Ga0265339_10031931
665 Ga0265331_10003090
666 Ga0265331_10010837
667 Ga0265316_10108937
668 Ga0265316_10191021
669 Ga0265316_10466084
670 Ga0265316_10469469
671 Ga0265316_10797845
672 Ga0265313_10002634
673 Ga0265313_10002760
674 Ga0265313_10079489
675 Ga0307508_10263760
676 Ga0265314_10024137
677 Ga0265314_10046461
678 Ga0265314_10105835
679 Ga0265342_10007329
680 Ga0265342_10019841
681 Ga0265342_10154410
682 Ga0265342_10226271
683 Ga0307516_10004590
684 Ga0373946_0489162
685 Ga0373955_0413236
686 Ga0373931_0549109
687 Ga0373935_0458026
688 Ga0373927_0149782
689 Ga0373947_0801677
690 Ga0373937_0000928
691 Ga0373925_0433290
692 Ga0395899_0159910
693 Ga0395900_0042633
694 Ga0395898_0024340
695 Ga0395901_0038343
696 Ga0436365_1169716
697 Ga0436363_1273484
698 Ga0436362_0353563
699 Ga0495629_0201230
700 Ga0495651_0479000
701 Ga0495580_0180416
702 Ga0495639_0208311
703 Ga0495662_0291800
704 Ga0495664_0051017
705 Ga0495606_0408895
706 Ga0495608_0476302
707 Ga0495616_0330422
708 Ga0495620_0057189
709 Ga0495652_0057723
710 Ga0495652_0162622
711 Ga0495587_0033173
712 Ga0495609_0081127
713 Ga0495621_0326807
714 Ga0495667_0690488
715 Ga0495611_0431838
716 Ga0495589_0081073
717 Ga0495600_0658164
718 Ga0495672_0086987
719 Ga0495675_0267178
720 Ga0495602_0875982
721 Ga0496115_0914310
722 Ga0496126_0100086
723 Ga0495682_0001300
724 Ga0501031_0008522
725 Ga0501031_0154977
726 Ga0501032_0005105
727 Ga0501032_0161394
728 Ga0501032_0200251
729 Ga0501032_0286052
730 Ga0501033_0056313
731 Ga0501033_0057096
732 Ga0501033_0069371
733 Ga0501033_0074719
734 Ga0501033_0141221
735 Ga0501033_0155248
736 Ga0501036_0020815
737 Ga0501036_0443763
738 Ga0501036_0486579
739 Ga0501037_0046814
740 Ga0501037_0051175
741 Ga0501038_0020263
742 Ga0501038_0083542
743 Ga0501038_0083758
744 Ga0501038_0094113
745 Ga0501038_0148561
746 Ga0501038_0165560
747 Ga0501039_0028995
748 Ga0501040_0063213
749 Ga0501042_0005978
750 Ga0501043_0038738
751 Ga0501043_0145722
752 Ga0501046_0005870
753 Ga0501046_0199669
754 Ga0501047_0116435
755 Ga0501047_0144528
756 Ga0501047_0288876
757 Ga0501047_0565887
758 Ga0501047_0818565
759 Ga0501048_0006489
760 Ga0501067_0034371
761 Ga0501068_0043296
762 Ga0501069_0007852
763 Ga0501070_0000242
764 Ga0501070_0019864
765 Ga0501070_0218311
766 Ga0501070_0291339
767 Ga0501072_0023502
768 Ga0501073_0014646
769 Ga0501073_0120167
770 Ga0501073_0283419
771 Ga0501076_0655167
772 Ga0501079_0001660
773 Ga0501079_0816261
774 Ga0501080_0015374
775 Ga0501080_0194160
776 Ga0501080_0311616
777 Ga0501083_0000548
778 Ga0501035_0002988
779 Ga0501035_0010881
780 Ga0501035_0049793
781 Ga0501035_0097879
782 Ga0501035_0134135
783 Ga0501035_0281139
784 Ga0501035_0303234
785 Ga0501044_0001386
786 Ga0501044_0010640
787 Ga0501044_0016669
788 Ga0501044_0017693
789 Ga0501044_0094029
790 Ga0501044_0161367
791 Ga0501044_0186550
792 Ga0501044_0484506
793 Ga0501044_0600886
794 Ga0500595_000734
795 Ga0500595_029917
796 Ga0500642_0211902
797 Ga0500655_004209
798 Ga0500573_0000050
799 Ga0501084_0000873
800 Ga0501082_0050752

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03652

RuvX

Holliday junction resolvase

14

126

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w89-assembly1.cif.gz_A the structure of deinococcus radiodurans yqgf 0.8711 15 147
1nmn-assembly2.cif.gz_B structure of yqgf from escherichia coli, a hypothetical protein 0.8633 16 147
7w89-assembly1.cif.gz_A the structure of deinococcus radiodurans yqgf 0.8448 15 147
1nmn-assembly1.cif.gz_A structure of yqgf from escherichia coli, a hypothetical protein 0.8421 16 148
7ess-assembly1.cif.gz_A structure-guided studies of the holliday junction resolvase ruvx provide novel insights into atp-stimulated cleavage of branched dna and rna substrates 0.8323 12 151
ID Description Score Start End Superfamily
af_P9WGV7_22_163_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.9118 16 148 3.30.420.140
af_Q8GYR7_22_166_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8544 16 151 3.30.420.140
af_P9WGV7_22_163_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8516 16 148 3.30.420.140
af_Q2FXW1_3_142_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8436 15 149 3.30.420.140
af_F4IC62_83_217_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8346 18 148 3.30.420.140
ID Description Score Start End GO Terms
AF-X1G2L9-F1-model_v4 YqgF/RNase H-like domain-containing protein 0.9713 15 102 GO:0000967
GO:0004518
GO:0005829
AF-R7FVT3-F1-model_v4 deleted 0.9638 15 151
AF-A0A1W9VMU1-F1-model_v4 YqgF/RNase H-like domain-containing protein 0.9628 15 98 GO:0000967
GO:0004518
GO:0005829
AF-A0A1G3BGH3-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9615 15 151 GO:0000967
GO:0004386
GO:0004518
GO:0005829
AF-A0A1G2ZP56-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9595 15 151 GO:0000967
GO:0004518
GO:0005829

Map