F434680

General Info

Members Datasets Scaffolds Average Seq Length
400 210 397 161

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_1642161|Ga0496112_1642161_26_526
Length 166
Sequence MMRLMIRLLPFPVVSASVLVVWLLLNQSLSLGQILLGAAIALVGGWGLARLDVPKAHPHRLGAIFHLAAIVLVDIVRSNIAVARIILGLEERRWVSGFVEIPLELRDPYGLATLACIITATPGTLWVAFDATSGTLTIHVLDLLDETQWIRTIKGRYERRLLEIFE

Samples

Sample ID Description Type Environment
1 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
2 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
3 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
146 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
149 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
199 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
203 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
208 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 0.25
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.25
Nodule 0
Rhizoplane 7.5
Rhizosphere 85.75
Stem 0
Stem Tuber 0
Unclassified 1.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10338223 3300003322 Bacteria 1700
2 Ga0070683_100014927 3300005329 Bacteria 6809
3 Ga0070683_100164491 3300005329 Bacteria 2105
4 Ga0070683_100176216 3300005329 Bacteria 2030
5 Ga0070683_100180822 3300005329 Bacteria 2002
6 Ga0070683_100207451 3300005329 Bacteria 1861
7 Ga0070690_100124493 3300005330 Bacteria 1734
8 Ga0068869_100014018 3300005334 Bacteria 5348
9 Ga0070680_100020613 3300005336 Bacteria 5235
10 Ga0070680_100061943 3300005336 Bacteria 3063
11 Ga0070680_100063774 3300005336 Bacteria 3019
12 Ga0070680_101262105 3300005336 Unclassified 639
13 Ga0070682_100089566 3300005337 Bacteria 2010
14 Ga0070682_100623547 3300005337 Unclassified 855
15 Ga0068868_100491943 3300005338 Bacteria 1073
16 Ga0070691_10015036 3300005341 Bacteria 3554
17 Ga0070691_10152325 3300005341 Bacteria 1186
18 Ga0070687_100100854 3300005343 Bacteria 1616
19 Ga0070687_100224480 3300005343 Bacteria 1152
20 Ga0070687_100422112 3300005343 Bacteria 880
21 Ga0070661_100010269 3300005344 Bacteria 6506
22 Ga0070661_100811387 3300005344 Bacteria 768
23 Ga0070692_10022193 3300005345 Bacteria 3098
24 Ga0070668_100076893 3300005347 Bacteria 2608
25 Ga0070668_100297727 3300005347 Bacteria 1352
26 Ga0070668_100846059 3300005347 Unclassified 815
27 Ga0070669_100089827 3300005353 Bacteria 2302
28 Ga0070671_100359625 3300005355 Bacteria 1243
29 Ga0070674_100375882 3300005356 Bacteria 1155
30 Ga0070659_100028608 3300005366 Bacteria 4306
31 Ga0070659_100127702 3300005366 Bacteria 2063
32 Ga0070667_100101024 3300005367 Bacteria 2491
33 Ga0070703_10019779 3300005406 Bacteria 1954
34 Ga0070705_100000901 3300005440 Bacteria 16586
35 Ga0070705_100124782 3300005440 Bacteria 1669
36 Ga0070700_100001924 3300005441 Bacteria 10504
37 Ga0070694_100001405 3300005444 Bacteria 14089
38 Ga0070708_100016481 3300005445 Bacteria 6134
39 Ga0070663_100038744 3300005455 Bacteria 3326
40 Ga0070663_100065164 3300005455 Bacteria 2636
41 Ga0070663_100198443 3300005455 Bacteria 1565
42 Ga0070663_100260723 3300005455 Bacteria 1375
43 Ga0070678_100054493 3300005456 Bacteria 2914
44 Ga0070678_100078226 3300005456 Bacteria 2498
45 Ga0070678_100574215 3300005456 Bacteria 1004
46 Ga0070662_100136753 3300005457 Bacteria 1895
47 Ga0070681_10060278 3300005458 Bacteria 3772
48 Ga0070681_10107835 3300005458 Bacteria 2725
49 Ga0070681_10161077 3300005458 Bacteria 2168
50 Ga0070681_10174999 3300005458 Bacteria 2068
51 Ga0070681_10259660 3300005458 Bacteria 1649
52 Ga0070681_10284077 3300005458 Bacteria 1565
53 Ga0070681_10303823 3300005458 Bacteria 1505
54 Ga0070681_10741145 3300005458 Bacteria 899
55 Ga0068867_100072516 3300005459 Bacteria 2578
56 Ga0070706_100029463 3300005467 Bacteria 5057
57 Ga0070698_100017908 3300005471 Bacteria 7463
58 Ga0070699_100015194 3300005518 Bacteria 6615
59 Ga0070679_100204142 3300005530 Bacteria 1941
60 Ga0070679_100482859 3300005530 Bacteria 1183
61 Ga0070679_100764175 3300005530 Bacteria 909
62 Ga0070679_100918268 3300005530 Unclassified 819
63 Ga0070684_100004031 3300005535 Bacteria 11116
64 Ga0070684_100602167 3300005535 Bacteria 1022
65 Ga0068853_100570951 3300005539 Bacteria 1073
66 Ga0070672_100098034 3300005543 Bacteria 2374
67 Ga0070672_100152234 3300005543 Bacteria 1914
68 Ga0070695_100000158 3300005545 Bacteria 32227
69 Ga0070696_100233450 3300005546 Bacteria 1385
70 Ga0070693_100155021 3300005547 Bacteria 1454
71 Ga0070665_100081964 3300005548 Bacteria 3231
72 Ga0070665_100724693 3300005548 Bacteria 1007
73 Ga0070704_100008256 3300005549 Bacteria 6233
74 Ga0068855_100408200 3300005563 Bacteria 1487
75 Ga0068855_100777803 3300005563 Unclassified 1019
76 Ga0070664_100118502 3300005564 Bacteria 2316
77 Ga0070664_100373844 3300005564 Bacteria 1300
78 Ga0070664_100881094 3300005564 Unclassified 839
79 Ga0068857_100009560 3300005577 Bacteria 8420
80 Ga0068857_100271570 3300005577 Bacteria 1558
81 Ga0068857_100654587 3300005577 Bacteria 996
82 Ga0068856_100612157 3300005614 Bacteria 1110
83 Ga0070702_100016066 3300005615 Bacteria 3834
84 Ga0068852_100392752 3300005616 Bacteria 1363
85 Ga0068852_101670021 3300005616 Unclassified 659
86 Ga0068859_100003502 3300005617 Bacteria 15988
87 Ga0068859_100194379 3300005617 Bacteria 2113
88 Ga0068864_100025178 3300005618 Bacteria 5009
89 Ga0068864_100299911 3300005618 Bacteria 1504
90 Ga0068864_101206950 3300005618 Bacteria 755
91 Ga0068861_100023390 3300005719 Bacteria 4456
92 Ga0068861_100450526 3300005719 Bacteria 1153
93 Ga0068870_10159334 3300005840 Bacteria 1337
94 Ga0068863_100107338 3300005841 Bacteria 2657
95 Ga0068863_100250601 3300005841 Bacteria 1710
96 Ga0068860_100001841 3300005843 Bacteria 22590
97 Ga0068860_100080379 3300005843 Bacteria 3100
98 Ga0068862_100002731 3300005844 Bacteria 15492
99 Ga0068862_100017501 3300005844 Bacteria 5970
100 Ga0068862_100296142 3300005844 Bacteria 1487
101 Ga0075365_10076577 3300006038 Bacteria 2259
102 Ga0075368_10103147 3300006042 Bacteria 1173
103 Ga0075364_10030113 3300006051 Unclassified 3483
104 Ga0075362_10045679 3300006177 Unclassified 1946
105 Ga0075367_10098355 3300006178 Unclassified 1786
106 Ga0075366_10021454 3300006195 Bacteria 3753
107 Ga0097621_100565015 3300006237 Bacteria 1037
108 Ga0075370_10060801 3300006353 Bacteria 2152
109 Ga0068871_101124101 3300006358 Bacteria 735
110 Ga0075428_100251939 3300006844 Bacteria 1903
111 Ga0075431_100470881 3300006847 Bacteria 1250
112 Ga0097620_100003500 3300006931 Bacteria 15988
113 Ga0097620_100194396 3300006931 Bacteria 2113
114 Ga0105251_10129128 3300009011 Bacteria 1146
115 Ga0105240_10159100 3300009093 Bacteria 2684
116 Ga0105240_10239529 3300009093 Bacteria 2104
117 Ga0105240_10553123 3300009093 Bacteria 1273
118 Ga0105245_10067879 3300009098 Bacteria 3230
119 Ga0105243_10056569 3300009148 Bacteria 3120
120 Ga0105243_10057408 3300009148 Bacteria 3099
121 Ga0105243_11417754 3300009148 Bacteria 716
122 Ga0105242_10205554 3300009176 Bacteria 1751
123 Ga0105248_10555022 3300009177 Bacteria 1296
124 Ga0105237_10130058 3300009545 Bacteria 2512
125 Ga0105238_10317910 3300009551 Bacteria 1542
126 Ga0105238_11030473 3300009551 Bacteria 844
127 Ga0105238_11372983 3300009551 Bacteria 733
128 Ga0105249_10046892 3300009553 Bacteria 3935
129 Ga0105249_10921608 3300009553 Bacteria 941
130 Ga0105249_11736288 3300009553 Bacteria 697
131 Ga0105239_10053150 3300010375 Bacteria 4444
132 Ga0105239_10346368 3300010375 Bacteria 1677
133 Ga0105239_11180782 3300010375 Unclassified 882
134 Ga0105246_10012864 3300011119 Bacteria 5234
135 Ga0105246_10040416 3300011119 Bacteria 3147
136 Ga0105246_10162168 3300011119 Bacteria 1704
137 Ga0105246_10883316 3300011119 Bacteria 800
138 Ga0105246_11231248 3300011119 Bacteria 690
139 Ga0157373_10285492 3300013100 Bacteria 1170
140 Ga0157370_10015905 3300013104 Bacteria 7634
141 Ga0157370_10417584 3300013104 Bacteria 1234
142 Ga0157370_10463279 3300013104 Unclassified 1165
143 Ga0157370_11433915 3300013104 Bacteria 621
144 Ga0157369_10008159 3300013105 Bacteria 12014
145 Ga0157369_10148213 3300013105 Bacteria 2481
146 Ga0157369_10484025 3300013105 Bacteria 1281
147 Ga0157369_10586600 3300013105 Bacteria 1151
148 Ga0157369_10900740 3300013105 Unclassified 907
149 Ga0157374_10716311 3300013296 Bacteria 1014
150 Ga0157378_10099522 3300013297 Bacteria 2653
151 Ga0157378_10595505 3300013297 Bacteria 1116
152 Ga0163162_10214861 3300013306 Bacteria 2053
153 Ga0163162_10528127 3300013306 Bacteria 1309
154 Ga0157372_10051543 3300013307 Bacteria 4581
155 Ga0157372_10215758 3300013307 Bacteria 2224
156 Ga0157372_12316102 3300013307 Unclassified 617
157 Ga0157375_10306008 3300013308 Unclassified 1753
158 Ga0163163_10044059 3300014325 Bacteria 4376
159 Ga0163163_10051486 3300014325 Bacteria 4060
160 Ga0157380_10035122 3300014326 Bacteria 3871
161 Ga0157380_10888827 3300014326 Bacteria 916
162 Ga0157379_11300073 3300014968 Unclassified 702
163 Ga0157376_10222379 3300014969 Bacteria 1749
164 Ga0206353_11258788 3300020082 Bacteria 882
165 Ga0207653_10102885 3300025885 Bacteria 1012
166 Ga0207688_10030603 3300025901 Bacteria 2969
167 Ga0207680_10418292 3300025903 Bacteria 949
168 Ga0207643_10015598 3300025908 Bacteria 4136
169 Ga0207643_10094685 3300025908 Bacteria 1745
170 Ga0207707_10061591 3300025912 Bacteria 3265
171 Ga0207707_10126494 3300025912 Bacteria 2235
172 Ga0207707_10137067 3300025912 Bacteria 2140
173 Ga0207707_10141199 3300025912 Bacteria 2106
174 Ga0207707_10284392 3300025912 Bacteria 1432
175 Ga0207695_10180820 3300025913 Bacteria 2029
176 Ga0207660_10015931 3300025917 Bacteria 4970
177 Ga0207660_10824227 3300025917 Unclassified 757
178 Ga0207649_10099608 3300025920 Bacteria 1920
179 Ga0207652_10664871 3300025921 Bacteria 931
180 Ga0207652_10837897 3300025921 Unclassified 815
181 Ga0207681_10055802 3300025923 Bacteria 2693
182 Ga0207694_10203407 3300025924 Bacteria 1611
183 Ga0207694_10343267 3300025924 Unclassified 1235
184 Ga0207687_10096947 3300025927 Bacteria 2162
185 Ga0207644_10535143 3300025931 Bacteria 969
186 Ga0207690_10112399 3300025932 Bacteria 1964
187 Ga0207706_10036082 3300025933 Bacteria 4393
188 Ga0207706_10150165 3300025933 Bacteria 2049
189 Ga0207706_10154749 3300025933 Bacteria 2017
190 Ga0207686_10543129 3300025934 Bacteria 908
191 Ga0207709_10097817 3300025935 Bacteria 1934
192 Ga0207669_10028127 3300025937 Bacteria 3089
193 Ga0207691_10068902 3300025940 Bacteria 3196
194 Ga0207691_10125677 3300025940 Bacteria 2270
195 Ga0207711_10133727 3300025941 Bacteria 2226
196 Ga0207711_10568357 3300025941 Bacteria 1058
197 Ga0207689_10089709 3300025942 Bacteria 2525
198 Ga0207661_10000186 3300025944 Bacteria 40168
199 Ga0207661_10168132 3300025944 Bacteria 1907
200 Ga0207661_10420400 3300025944 Unclassified 1214
201 Ga0207679_10167946 3300025945 Bacteria 1803
202 Ga0207679_10797717 3300025945 Bacteria 861
203 Ga0207667_10716459 3300025949 Bacteria 1002
204 Ga0207667_10763596 3300025949 Bacteria 965
205 Ga0207712_10023018 3300025961 Bacteria 4108
206 Ga0207712_10868713 3300025961 Bacteria 796
207 Ga0207668_10024309 3300025972 Bacteria 3908
208 Ga0207677_10127328 3300026023 Bacteria 1927
209 Ga0207677_10145170 3300026023 Bacteria 1822
210 Ga0207639_10024518 3300026041 Bacteria 4366
211 Ga0207678_10044918 3300026067 Bacteria 3821
212 Ga0207678_10183237 3300026067 Bacteria 1788
213 Ga0207678_10435184 3300026067 Bacteria 1139
214 Ga0207678_10609085 3300026067 Bacteria 958
215 Ga0207708_10001399 3300026075 Bacteria 18108
216 Ga0207708_10103918 3300026075 Bacteria 2201
217 Ga0207708_10255035 3300026075 Bacteria 1415
218 Ga0207702_10052860 3300026078 Bacteria 3439
219 Ga0207641_10131630 3300026088 Bacteria 2247
220 Ga0207641_10164075 3300026088 Bacteria 2022
221 Ga0207676_10003912 3300026095 Bacteria 10515
222 Ga0207676_10080910 3300026095 Bacteria 2638
223 Ga0207676_10661791 3300026095 Bacteria 1009
224 Ga0207674_10001143 3300026116 Bacteria 34428
225 Ga0207674_10242253 3300026116 Bacteria 1750
226 Ga0207674_11034362 3300026116 Bacteria 790
227 Ga0207675_100048221 3300026118 Bacteria 3977
228 Ga0207675_100135123 3300026118 Unclassified 2339
229 Ga0207683_10053612 3300026121 Bacteria 3537
230 Ga0207683_10168119 3300026121 Bacteria 1985
231 Ga0207698_10319495 3300026142 Bacteria 1453
232 Ga0207698_11788614 3300026142 Unclassified 630
233 Ga0209813_10013463 3300027866 Unclassified 2184
234 Ga0268266_10119099 3300028379 Bacteria 2348
235 Ga0268265_10000626 3300028380 Bacteria 35203
236 Ga0268265_10036784 3300028380 Bacteria 3588
237 Ga0268265_10235949 3300028380 Bacteria 1611
238 Ga0268264_10003320 3300028381 Bacteria 13903
239 Ga0307405_10119658 3300031731 Bacteria 1800
240 Ga0307413_10240172 3300031824 Bacteria 1337
241 Ga0307413_10325848 3300031824 Bacteria 1175
242 Ga0326468_10004035 3300031889 Bacteria 1269
243 Ga0307406_10007814 3300031901 Bacteria 5949
244 Ga0307407_10073940 3300031903 Bacteria 2038
245 Ga0307409_100027346 3300031995 Bacteria 4040
246 Ga0307416_100092630 3300032002 Bacteria 2600
247 Ga0307411_10141110 3300032005 Bacteria 1777
248 Ga0307415_100071786 3300032126 Bacteria 2436
249 Ga0307415_100632381 3300032126 Bacteria 957
250 Ga0373931_0296164 3300035691 Bacteria 998
251 Ga0395899_0735821 3300037312 Bacteria 615
252 Ga0395901_0339236 3300038443 Bacteria 1553
253 Ga0451800_0144451 3300041459 Unclassified 676
254 Ga0451807_0753102 3300041486 Unclassified 594
255 Ga0451853_2901402 3300041512 Bacteria 1043
256 Ga0451853_2966075 3300041512 Unclassified 584
257 Ga0439442_160298 3300042002 Unclassified 503
258 Ga0439459_0044804 3300042438 Bacteria 952
259 Ga0495603_0084753 3300046455 Bacteria 1856
260 Ga0495629_0217343 3300046459 Bacteria 1319
261 Ga0496100_0245892 3300048903 Bacteria 1322
262 Ga0496101_0109131 3300048904 Bacteria 2081
263 Ga0496101_0291161 3300048904 Bacteria 1278
264 Ga0496102_0009559 3300048905 Bacteria 8340
265 Ga0496102_0039333 3300048905 Bacteria 4273
266 Ga0496102_0251716 3300048905 Bacteria 1666
267 Ga0496103_0036330 3300048906 Bacteria 3017
268 Ga0496103_0161053 3300048906 Bacteria 1439
269 Ga0496104_0132289 3300048907 Bacteria 2396
270 Ga0496104_0425223 3300048907 Bacteria 1240
271 Ga0496105_0052219 3300048908 Bacteria 3376
272 Ga0496105_0121824 3300048908 Bacteria 2151
273 Ga0496105_0591261 3300048908 Bacteria 862
274 Ga0496105_1068102 3300048908 Unclassified 601
275 Ga0496106_0042073 3300048909 Bacteria 3425
276 Ga0496106_0255921 3300048909 Bacteria 1400
277 Ga0496107_0011296 3300048910 Bacteria 6217
278 Ga0496107_0067379 3300048910 Bacteria 2597
279 Ga0496108_0040335 3300048911 Bacteria 3891
280 Ga0496108_0622801 3300048911 Bacteria 939
281 Ga0496109_0039540 3300048912 Bacteria 4269
282 Ga0496109_0336834 3300048912 Bacteria 1425
283 Ga0496110_0017647 3300048913 Bacteria 5967
284 Ga0496112_0015803 3300048915 Bacteria 7052
285 Ga0496112_0016184 3300048915 Bacteria 6978
286 Ga0496112_1642161 3300048915 Bacteria 556
287 Ga0496113_0205497 3300048916 Bacteria 1566
288 Ga0496114_0040997 3300048917 Bacteria 3836
289 Ga0501031_0021962 3300049568 Bacteria 4158
290 Ga0501031_0121925 3300049568 Bacteria 1703
291 Ga0501031_0445807 3300049568 Unclassified 836
292 Ga0501032_0038787 3300049569 Bacteria 3242
293 Ga0501032_0082015 3300049569 Bacteria 2146
294 Ga0501032_0507393 3300049569 Bacteria 770
295 Ga0501033_0004294 3300049570 Bacteria 11449
296 Ga0501033_0029981 3300049570 Bacteria 4089
297 Ga0501033_0364429 3300049570 Bacteria 1011
298 Ga0501033_0755164 3300049570 Bacteria 659
299 Ga0501034_0073146 3300049571 Bacteria 3436
300 Ga0501034_0139192 3300049571 Bacteria 2407
301 Ga0501034_0720472 3300049571 Bacteria 895
302 Ga0501034_0750292 3300049571 Bacteria 871
303 Ga0501034_0774770 3300049571 Bacteria 853
304 Ga0501036_0039590 3300049572 Bacteria 3988
305 Ga0501036_0043106 3300049572 Bacteria 3821
306 Ga0501036_0043249 3300049572 Bacteria 3814
307 Ga0501037_0015413 3300049573 Bacteria 5624
308 Ga0501037_0029303 3300049573 Bacteria 4067
309 Ga0501037_0290347 3300049573 Bacteria 1138
310 Ga0501037_0421132 3300049573 Bacteria 914
311 Ga0501038_0023114 3300049574 Bacteria 5562
312 Ga0501038_0134187 3300049574 Bacteria 2030
313 Ga0501038_0695400 3300049574 Bacteria 762
314 Ga0501038_1096881 3300049574 Bacteria 581
315 Ga0501039_0312463 3300049575 Bacteria 1235
316 Ga0501040_0209868 3300049576 Bacteria 1384
317 Ga0501041_0009961 3300049577 Bacteria 5600
318 Ga0501041_0137308 3300049577 Bacteria 1524
319 Ga0501042_0016734 3300049578 Bacteria 5041
320 Ga0501043_0023357 3300049579 Bacteria 4850
321 Ga0501043_0083685 3300049579 Bacteria 2508
322 Ga0501043_0315158 3300049579 Bacteria 1193
323 Ga0501043_0662765 3300049579 Bacteria 765
324 Ga0501046_0006239 3300049580 Bacteria 10582
325 Ga0501046_0597111 3300049580 Unclassified 784
326 Ga0501047_0025205 3300049581 Bacteria 5714
327 Ga0501047_0038746 3300049581 Bacteria 4611
328 Ga0501047_0125964 3300049581 Bacteria 2442
329 Ga0501047_0192145 3300049581 Bacteria 1904
330 Ga0501047_0558962 3300049581 Bacteria 968
331 Ga0501048_0022535 3300049582 Bacteria 4605
332 Ga0501048_0250462 3300049582 Bacteria 1257
333 Ga0501068_0344050 3300049584 Bacteria 958
334 Ga0501069_0080090 3300049585 Bacteria 1839
335 Ga0501069_0105697 3300049585 Bacteria 1600
336 Ga0501070_0047983 3300049586 Bacteria 3548
337 Ga0501070_0227971 3300049586 Bacteria 1527
338 Ga0501070_0330595 3300049586 Bacteria 1239
339 Ga0501070_0341639 3300049586 Bacteria 1216
340 Ga0501071_0017556 3300049587 Bacteria 4938
341 Ga0501071_0083056 3300049587 Bacteria 2347
342 Ga0501071_0307763 3300049587 Bacteria 1202
343 Ga0501071_0410503 3300049587 Bacteria 1034
344 Ga0501072_0149597 3300049588 Bacteria 1861
345 Ga0501072_0366370 3300049588 Bacteria 1144
346 Ga0501072_0600302 3300049588 Bacteria 868
347 Ga0501073_0152782 3300049589 Bacteria 1600
348 Ga0501073_0201448 3300049589 Bacteria 1376
349 Ga0501074_0245665 3300049590 Bacteria 1273
350 Ga0501074_0314240 3300049590 Bacteria 1113
351 Ga0501075_0016047 3300049591 Bacteria 5388
352 Ga0501076_0013015 3300049592 Bacteria 6229
353 Ga0501076_0093445 3300049592 Bacteria 2420
354 Ga0501077_0067608 3300049593 Bacteria 2265
355 Ga0501077_0226749 3300049593 Bacteria 1188
356 Ga0501079_0226542 3300049741 Bacteria 1460
357 Ga0501080_0084392 3300049742 Bacteria 2951
358 Ga0501080_0110362 3300049742 Bacteria 2549
359 Ga0501081_0025471 3300049743 Bacteria 3979
360 Ga0501081_0252915 3300049743 Bacteria 1287
361 Ga0501081_0641650 3300049743 Bacteria 796
362 Ga0501083_0868237 3300049744 Bacteria 587
363 Ga0501035_0039585 3300049822 Bacteria 4265
364 Ga0501035_0054537 3300049822 Bacteria 3572
365 Ga0501035_0066879 3300049822 Bacteria 3189
366 Ga0501035_0230153 3300049822 Bacteria 1580
367 Ga0501035_0631049 3300049822 Unclassified 870
368 Ga0501044_0030874 3300049823 Bacteria 5643
369 Ga0501044_0145612 3300049823 Bacteria 2355
370 Ga0501044_0215578 3300049823 Bacteria 1872
371 Ga0501044_0444462 3300049823 Bacteria 1204
372 Ga0501044_0820185 3300049823 Unclassified 808
373 Ga0501044_0895694 3300049823 Bacteria 762
374 Ga0501044_0940940 3300049823 Unclassified 737
375 Ga0501045_0109607 3300049824 Bacteria 2046
376 Ga0501045_0164076 3300049824 Bacteria 1654
377 nmdc:mga03683_359453_c1 3300050489 Bacteria 690
378 nmdc:mga00v17_292984_c1 3300050491 Bacteria 1057
379 nmdc:mga0yw44_260214_c1 3300050492 Bacteria 1156
380 nmdc:mga0k408_197401_c1 3300050493 Bacteria 1201
381 nmdc:mga0k408_220406_c1 3300050493 Bacteria 1132
382 nmdc:mga0k408_346791_c1 3300050493 Bacteria 885
383 nmdc:mga06z11_110892_c1 3300050494 Bacteria 1519
384 nmdc:mga06z11_9784_c1 3300050494 Bacteria 4053
385 nmdc:mga04h51_10906_c1 3300050495 Unclassified 2509
386 nmdc:mga07m45_37513_c1 3300050496 Unclassified 2703
387 nmdc:mga07m45_579645_c1 3300050496 Bacteria 648
388 nmdc:mga0qj67_893337_c1 3300050509 Bacteria 700
389 nmdc:mga06r32_26679_c1 3300050510 Bacteria 5389
390 nmdc:mga06r32_848374_c1 3300050510 Unclassified 872
391 nmdc:mga0sz30_80476_c1 3300050516 Unclassified 1409
392 Ga0500641_0016481 3300053096 Bacteria 2752
393 Ga0501082_0049267 3300060353 Bacteria 3632
394 Ga0501082_0385566 3300060353 Bacteria 1223
395 Ga0501082_0571287 3300060353 Bacteria 989
396 Ga0530510_0002984 3300061734 Bacteria 11600
397 Ga0530510_0062570 3300061734 Bacteria 2694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042002 Ga0439442_160298 Ga0439442_160298_89_484 131
2 3300049585 Ga0501069_0080090 Ga0501069_0080090_328_816 149
3 3300038443 Ga0395901_0339236 Ga0395901_0339236_714_1169 151
4 3300049568 Ga0501031_0445807 Ga0501031_0445807_216_704 152
5 3300049744 Ga0501083_0868237 Ga0501083_0868237_22_513 152
6 3300049823 Ga0501044_0940940 Ga0501044_0940940_142_630 152
7 3300009148 Ga0105243_11417754 Ga0105243_114177541 153
8 3300014326 Ga0157380_10035122 Ga0157380_100351224 153
9 3300041512 Ga0451853_2901402 Ga0451853_2901402_157_618 153
10 3300048904 Ga0496101_0291161 Ga0496101_0291161_186_647 153
11 3300048907 Ga0496104_0425223 Ga0496104_0425223_66_527 153
12 3300048908 Ga0496105_0121824 Ga0496105_0121824_694_1155 153
13 3300048911 Ga0496108_0622801 Ga0496108_0622801_219_680 153
14 3300048912 Ga0496109_0336834 Ga0496109_0336834_73_534 153
15 3300048915 Ga0496112_0015803 Ga0496112_0015803_594_1055 153
16 3300050489 nmdc:mga03683_359453_c1 nmdc:mga03683_359453_c1_67_528 153
17 3300050491 nmdc:mga00v17_292984_c1 nmdc:mga00v17_292984_c1_359_820 153
18 3300050493 nmdc:mga0k408_197401_c1 nmdc:mga0k408_197401_c1_679_1140 153
19 3300050493 nmdc:mga0k408_220406_c1 nmdc:mga0k408_220406_c1_438_899 153
20 3300050494 nmdc:mga06z11_110892_c1 nmdc:mga06z11_110892_c1_494_955 153
21 3300050494 nmdc:mga06z11_9784_c1 nmdc:mga06z11_9784_c1_2823_3284 153
22 3300050495 nmdc:mga04h51_10906_c1 nmdc:mga04h51_10906_c1_1464_1925 153
23 3300050496 nmdc:mga07m45_37513_c1 nmdc:mga07m45_37513_c1_1465_1926 153
24 3300050496 nmdc:mga07m45_579645_c1 nmdc:mga07m45_579645_c1_32_493 153
25 3300050516 nmdc:mga0sz30_80476_c1 nmdc:mga0sz30_80476_c1_834_1295 153
26 3300005329 Ga0070683_100164491 Ga0070683_1001644912 157
27 3300005344 Ga0070661_100811387 Ga0070661_1008113871 157
28 3300005458 Ga0070681_10259660 Ga0070681_102596601 157
29 3300005530 Ga0070679_100204142 Ga0070679_1002041422 157
30 3300005563 Ga0068855_100408200 Ga0068855_1004082004 157
31 3300005614 Ga0068856_100612157 Ga0068856_1006121572 157
32 3300009551 Ga0105238_10317910 Ga0105238_103179103 157
33 3300013104 Ga0157370_10417584 Ga0157370_104175842 157
34 3300013104 Ga0157370_11433915 Ga0157370_114339151 157
35 3300013105 Ga0157369_10148213 Ga0157369_101482134 157
36 3300013105 Ga0157369_10586600 Ga0157369_105866002 157
37 3300013307 Ga0157372_10051543 Ga0157372_100515434 157
38 3300025944 Ga0207661_10168132 Ga0207661_101681323 157
39 3300025949 Ga0207667_10763596 Ga0207667_107635962 157
40 3300026078 Ga0207702_10052860 Ga0207702_100528604 157
41 3300037312 Ga0395899_0735821 Ga0395899_0735821_81_554 157
42 3300049568 Ga0501031_0021962 Ga0501031_0021962_972_1460 157
43 3300049569 Ga0501032_0038787 Ga0501032_0038787_1917_2405 157
44 3300049570 Ga0501033_0004294 Ga0501033_0004294_7258_7746 157
45 3300049571 Ga0501034_0073146 Ga0501034_0073146_1136_1624 157
46 3300049572 Ga0501036_0039590 Ga0501036_0039590_2692_3180 157
47 3300049573 Ga0501037_0015413 Ga0501037_0015413_2905_3393 157
48 3300049574 Ga0501038_0023114 Ga0501038_0023114_1679_2167 157
49 3300049579 Ga0501043_0083685 Ga0501043_0083685_1264_1752 157
50 3300049581 Ga0501047_0025205 Ga0501047_0025205_2474_2962 157
51 3300049586 Ga0501070_0047983 Ga0501070_0047983_550_1038 157
52 3300049822 Ga0501035_0066879 Ga0501035_0066879_2413_2901 157
53 3300049823 Ga0501044_0030874 Ga0501044_0030874_2753_3241 157
54 iso_pu_bacteria 2597490356 2599104604 157
55 iso_pu_bacteria 2846952575 2846955461 157
56 iso_pu_bacteria 2848858292 2848862660 157
57 3300014325 Ga0163163_10044059 Ga0163163_100440592 158
58 3300031824 Ga0307413_10325848 Ga0307413_103258483 159
59 3300005329 Ga0070683_100180822 Ga0070683_1001808223 160
60 3300005618 Ga0068864_101206950 Ga0068864_1012069502 160
61 3300005719 Ga0068861_100450526 Ga0068861_1004505262 160
62 3300026075 Ga0207708_10255035 Ga0207708_102550352 160
63 3300026095 Ga0207676_10661791 Ga0207676_106617912 160
64 3300005329 Ga0070683_100176216 Ga0070683_1001762162 161
65 3300005329 Ga0070683_100207451 Ga0070683_1002074513 161
66 3300005330 Ga0070690_100124493 Ga0070690_1001244932 161
67 3300005336 Ga0070680_100063774 Ga0070680_1000637743 161
68 3300005336 Ga0070680_101262105 Ga0070680_1012621051 161
69 3300005337 Ga0070682_100089566 Ga0070682_1000895662 161
70 3300005337 Ga0070682_100623547 Ga0070682_1006235471 161
71 3300005341 Ga0070691_10152325 Ga0070691_101523252 161
72 3300005343 Ga0070687_100224480 Ga0070687_1002244802 161
73 3300005343 Ga0070687_100422112 Ga0070687_1004221122 161
74 3300005344 Ga0070661_100010269 Ga0070661_1000102693 161
75 3300005347 Ga0070668_100076893 Ga0070668_1000768932 161
76 3300005347 Ga0070668_100846059 Ga0070668_1008460591 161
77 3300005353 Ga0070669_100089827 Ga0070669_1000898274 161
78 3300005355 Ga0070671_100359625 Ga0070671_1003596253 161
79 3300005356 Ga0070674_100375882 Ga0070674_1003758822 161
80 3300005366 Ga0070659_100028608 Ga0070659_1000286085 161
81 3300005366 Ga0070659_100127702 Ga0070659_1001277022 161
82 3300005367 Ga0070667_100101024 Ga0070667_1001010242 161
83 3300005440 Ga0070705_100124782 Ga0070705_1001247822 161
84 3300005455 Ga0070663_100065164 Ga0070663_1000651642 161
85 3300005455 Ga0070663_100198443 Ga0070663_1001984432 161
86 3300005455 Ga0070663_100260723 Ga0070663_1002607233 161
87 3300005456 Ga0070678_100054493 Ga0070678_1000544932 161
88 3300005456 Ga0070678_100078226 Ga0070678_1000782262 161
89 3300005456 Ga0070678_100574215 Ga0070678_1005742152 161
90 3300005458 Ga0070681_10107835 Ga0070681_101078354 161
91 3300005458 Ga0070681_10284077 Ga0070681_102840772 161
92 3300005459 Ga0068867_100072516 Ga0068867_1000725165 161
93 3300005535 Ga0070684_100602167 Ga0070684_1006021672 161
94 3300005539 Ga0068853_100570951 Ga0068853_1005709512 161
95 3300005543 Ga0070672_100098034 Ga0070672_1000980344 161
96 3300005543 Ga0070672_100152234 Ga0070672_1001522344 161
97 3300005548 Ga0070665_100081964 Ga0070665_1000819645 161
98 3300005548 Ga0070665_100724693 Ga0070665_1007246932 161
99 3300005563 Ga0068855_100777803 Ga0068855_1007778032 161
100 3300005564 Ga0070664_100118502 Ga0070664_1001185025 161
101 3300005564 Ga0070664_100373844 Ga0070664_1003738442 161
102 3300005564 Ga0070664_100881094 Ga0070664_1008810942 161
103 3300005577 Ga0068857_100271570 Ga0068857_1002715703 161
104 3300005577 Ga0068857_100654587 Ga0068857_1006545872 161
105 3300005616 Ga0068852_100392752 Ga0068852_1003927522 161
106 3300005617 Ga0068859_100194379 Ga0068859_1001943792 161
107 3300005719 Ga0068861_100023390 Ga0068861_1000233902 161
108 3300005840 Ga0068870_10159334 Ga0068870_101593343 161
109 3300005841 Ga0068863_100107338 Ga0068863_1001073384 161
110 3300005843 Ga0068860_100080379 Ga0068860_1000803792 161
111 3300005844 Ga0068862_100017501 Ga0068862_1000175014 161
112 3300005844 Ga0068862_100296142 Ga0068862_1002961424 161
113 3300006237 Ga0097621_100565015 Ga0097621_1005650152 161
114 3300006358 Ga0068871_101124101 Ga0068871_1011241011 161
115 3300006931 Ga0097620_100194396 Ga0097620_1001943963 161
116 3300009011 Ga0105251_10129128 Ga0105251_101291282 161
117 3300009093 Ga0105240_10553123 Ga0105240_105531232 161
118 3300009098 Ga0105245_10067879 Ga0105245_100678794 161
119 3300009148 Ga0105243_10056569 Ga0105243_100565694 161
120 3300009176 Ga0105242_10205554 Ga0105242_102055542 161
121 3300009177 Ga0105248_10555022 Ga0105248_105550223 161
122 3300009551 Ga0105238_11372983 Ga0105238_113729832 161
123 3300009553 Ga0105249_11736288 Ga0105249_117362882 161
124 3300010375 Ga0105239_10053150 Ga0105239_100531504 161
125 3300010375 Ga0105239_10346368 Ga0105239_103463682 161
126 3300010375 Ga0105239_11180782 Ga0105239_111807822 161
127 3300011119 Ga0105246_10012864 Ga0105246_100128644 161
128 3300011119 Ga0105246_10040416 Ga0105246_100404164 161
129 3300011119 Ga0105246_10883316 Ga0105246_108833162 161
130 3300011119 Ga0105246_11231248 Ga0105246_112312481 161
131 3300013100 Ga0157373_10285492 Ga0157373_102854922 161
132 3300013104 Ga0157370_10015905 Ga0157370_100159059 161
133 3300013105 Ga0157369_10008159 Ga0157369_100081599 161
134 3300013296 Ga0157374_10716311 Ga0157374_107163112 161
135 3300013297 Ga0157378_10099522 Ga0157378_100995222 161
136 3300013297 Ga0157378_10595505 Ga0157378_105955052 161
137 3300013306 Ga0163162_10214861 Ga0163162_102148614 161
138 3300013306 Ga0163162_10528127 Ga0163162_105281272 161
139 3300013307 Ga0157372_10215758 Ga0157372_102157581 161
140 3300013307 Ga0157372_12316102 Ga0157372_123161021 161
141 3300013308 Ga0157375_10306008 Ga0157375_103060084 161
142 3300014325 Ga0163163_10051486 Ga0163163_100514864 161
143 3300014968 Ga0157379_11300073 Ga0157379_113000731 161
144 3300014969 Ga0157376_10222379 Ga0157376_102223793 161
145 3300025901 Ga0207688_10030603 Ga0207688_100306034 161
146 3300025903 Ga0207680_10418292 Ga0207680_104182922 161
147 3300025908 Ga0207643_10015598 Ga0207643_100155984 161
148 3300025908 Ga0207643_10094685 Ga0207643_100946852 161
149 3300025912 Ga0207707_10126494 Ga0207707_101264942 161
150 3300025912 Ga0207707_10137067 Ga0207707_101370672 161
151 3300025917 Ga0207660_10824227 Ga0207660_108242271 161
152 3300025920 Ga0207649_10099608 Ga0207649_100996082 161
153 3300025923 Ga0207681_10055802 Ga0207681_100558024 161
154 3300025924 Ga0207694_10203407 Ga0207694_102034072 161
155 3300025924 Ga0207694_10343267 Ga0207694_103432671 161
156 3300025927 Ga0207687_10096947 Ga0207687_100969472 161
157 3300025931 Ga0207644_10535143 Ga0207644_105351432 161
158 3300025932 Ga0207690_10112399 Ga0207690_101123991 161
159 3300025933 Ga0207706_10036082 Ga0207706_100360825 161
160 3300025933 Ga0207706_10150165 Ga0207706_101501652 161
161 3300025934 Ga0207686_10543129 Ga0207686_105431292 161
162 3300025935 Ga0207709_10097817 Ga0207709_100978172 161
163 3300025937 Ga0207669_10028127 Ga0207669_100281272 161
164 3300025940 Ga0207691_10068902 Ga0207691_100689025 161
165 3300025940 Ga0207691_10125677 Ga0207691_101256774 161
166 3300025941 Ga0207711_10133727 Ga0207711_101337273 161
167 3300025941 Ga0207711_10568357 Ga0207711_105683572 161
168 3300025944 Ga0207661_10420400 Ga0207661_104204001 161
169 3300025945 Ga0207679_10167946 Ga0207679_101679464 161
170 3300025945 Ga0207679_10797717 Ga0207679_107977172 161
171 3300025949 Ga0207667_10716459 Ga0207667_107164591 161
172 3300025961 Ga0207712_10868713 Ga0207712_108687132 161
173 3300025972 Ga0207668_10024309 Ga0207668_100243097 161
174 3300026023 Ga0207677_10127328 Ga0207677_101273282 161
175 3300026023 Ga0207677_10145170 Ga0207677_101451703 161
176 3300026041 Ga0207639_10024518 Ga0207639_100245182 161
177 3300026067 Ga0207678_10183237 Ga0207678_101832372 161
178 3300026067 Ga0207678_10435184 Ga0207678_104351842 161
179 3300026067 Ga0207678_10609085 Ga0207678_106090852 161
180 3300026075 Ga0207708_10103918 Ga0207708_101039182 161
181 3300026088 Ga0207641_10131630 Ga0207641_101316304 161
182 3300026095 Ga0207676_10080910 Ga0207676_100809104 161
183 3300026116 Ga0207674_10242253 Ga0207674_102422533 161
184 3300026116 Ga0207674_11034362 Ga0207674_110343621 161
185 3300026118 Ga0207675_100048221 Ga0207675_1000482214 161
186 3300026118 Ga0207675_100135123 Ga0207675_1001351232 161
187 3300026121 Ga0207683_10053612 Ga0207683_100536122 161
188 3300026121 Ga0207683_10168119 Ga0207683_101681193 161
189 3300026142 Ga0207698_10319495 Ga0207698_103194952 161
190 3300026142 Ga0207698_11788614 Ga0207698_117886142 161
191 3300028379 Ga0268266_10119099 Ga0268266_101190994 161
192 3300028380 Ga0268265_10036784 Ga0268265_100367842 161
193 3300028380 Ga0268265_10235949 Ga0268265_102359492 161
194 3300031731 Ga0307405_10119658 Ga0307405_101196581 161
195 3300031889 Ga0326468_10004035 Ga0326468_100040352 161
196 3300031901 Ga0307406_10007814 Ga0307406_100078144 161
197 3300031995 Ga0307409_100027346 Ga0307409_1000273465 161
198 3300032126 Ga0307415_100071786 Ga0307415_1000717863 161
199 3300041459 Ga0451800_0144451 Ga0451800_0144451_147_632 161
200 3300041486 Ga0451807_0753102 Ga0451807_0753102_83_568 161
201 3300041512 Ga0451853_2966075 Ga0451853_2966075_23_508 161
202 3300042438 Ga0439459_0044804 Ga0439459_0044804_73_558 161
203 3300046455 Ga0495603_0084753 Ga0495603_0084753_1291_1776 161
204 3300046459 Ga0495629_0217343 Ga0495629_0217343_72_557 161
205 3300048903 Ga0496100_0245892 Ga0496100_0245892_258_743 161
206 3300048904 Ga0496101_0109131 Ga0496101_0109131_981_1466 161
207 3300048905 Ga0496102_0039333 Ga0496102_0039333_2149_2634 161
208 3300048905 Ga0496102_0251716 Ga0496102_0251716_868_1353 161
209 3300048906 Ga0496103_0161053 Ga0496103_0161053_59_544 161
210 3300048907 Ga0496104_0132289 Ga0496104_0132289_1412_1897 161
211 3300048908 Ga0496105_0052219 Ga0496105_0052219_2444_2929 161
212 3300048909 Ga0496106_0255921 Ga0496106_0255921_880_1365 161
213 3300048910 Ga0496107_0067379 Ga0496107_0067379_1362_1847 161
214 3300048911 Ga0496108_0040335 Ga0496108_0040335_1880_2365 161
215 3300048912 Ga0496109_0039540 Ga0496109_0039540_2771_3256 161
216 3300048913 Ga0496110_0017647 Ga0496110_0017647_4226_4711 161
217 3300048915 Ga0496112_0016184 Ga0496112_0016184_1221_1706 161
218 3300048916 Ga0496113_0205497 Ga0496113_0205497_964_1449 161
219 3300048917 Ga0496114_0040997 Ga0496114_0040997_2842_3327 161
220 3300049586 Ga0501070_0227971 Ga0501070_0227971_235_720 161
221 3300049588 Ga0501072_0366370 Ga0501072_0366370_576_1061 161
222 3300050492 nmdc:mga0yw44_260214_c1 nmdc:mga0yw44_260214_c1_280_765 161
223 3300050493 nmdc:mga0k408_346791_c1 nmdc:mga0k408_346791_c1_261_746 161
224 3300053096 Ga0500641_0016481 Ga0500641_0016481_872_1357 161
225 3300003322 rootL2_10338223 rootL2_103382232 162
226 3300005329 Ga0070683_100014927 Ga0070683_1000149277 162
227 3300005334 Ga0068869_100014018 Ga0068869_1000140182 162
228 3300005336 Ga0070680_100020613 Ga0070680_1000206134 162
229 3300005336 Ga0070680_100061943 Ga0070680_1000619435 162
230 3300005338 Ga0068868_100491943 Ga0068868_1004919432 162
231 3300005341 Ga0070691_10015036 Ga0070691_100150364 162
232 3300005343 Ga0070687_100100854 Ga0070687_1001008542 162
233 3300005345 Ga0070692_10022193 Ga0070692_100221933 162
234 3300005347 Ga0070668_100297727 Ga0070668_1002977271 162
235 3300005406 Ga0070703_10019779 Ga0070703_100197792 162
236 3300005440 Ga0070705_100000901 Ga0070705_1000009014 162
237 3300005441 Ga0070700_100001924 Ga0070700_1000019242 162
238 3300005444 Ga0070694_100001405 Ga0070694_1000014054 162
239 3300005445 Ga0070708_100016481 Ga0070708_1000164817 162
240 3300005455 Ga0070663_100038744 Ga0070663_1000387444 162
241 3300005457 Ga0070662_100136753 Ga0070662_1001367532 162
242 3300005458 Ga0070681_10060278 Ga0070681_100602784 162
243 3300005458 Ga0070681_10161077 Ga0070681_101610772 162
244 3300005458 Ga0070681_10174999 Ga0070681_101749992 162
245 3300005458 Ga0070681_10303823 Ga0070681_103038232 162
246 3300005458 Ga0070681_10741145 Ga0070681_107411452 162
247 3300005467 Ga0070706_100029463 Ga0070706_1000294632 162
248 3300005471 Ga0070698_100017908 Ga0070698_1000179084 162
249 3300005518 Ga0070699_100015194 Ga0070699_1000151947 162
250 3300005530 Ga0070679_100482859 Ga0070679_1004828593 162
251 3300005530 Ga0070679_100764175 Ga0070679_1007641752 162
252 3300005530 Ga0070679_100918268 Ga0070679_1009182681 162
253 3300005535 Ga0070684_100004031 Ga0070684_1000040316 162
254 3300005545 Ga0070695_100000158 Ga0070695_10000015829 162
255 3300005546 Ga0070696_100233450 Ga0070696_1002334502 162
256 3300005547 Ga0070693_100155021 Ga0070693_1001550212 162
257 3300005549 Ga0070704_100008256 Ga0070704_1000082564 162
258 3300005577 Ga0068857_100009560 Ga0068857_1000095604 162
259 3300005615 Ga0070702_100016066 Ga0070702_1000160663 162
260 3300005616 Ga0068852_101670021 Ga0068852_1016700211 162
261 3300005617 Ga0068859_100003502 Ga0068859_1000035024 162
262 3300005618 Ga0068864_100025178 Ga0068864_1000251787 162
263 3300005618 Ga0068864_100299911 Ga0068864_1002999113 162
264 3300005841 Ga0068863_100250601 Ga0068863_1002506014 162
265 3300005843 Ga0068860_100001841 Ga0068860_1000018416 162
266 3300005844 Ga0068862_100002731 Ga0068862_1000027314 162
267 3300006038 Ga0075365_10076577 Ga0075365_100765772 162
268 3300006042 Ga0075368_10103147 Ga0075368_101031472 162
269 3300006051 Ga0075364_10030113 Ga0075364_100301137 162
270 3300006177 Ga0075362_10045679 Ga0075362_100456794 162
271 3300006178 Ga0075367_10098355 Ga0075367_100983554 162
272 3300006195 Ga0075366_10021454 Ga0075366_100214543 162
273 3300006353 Ga0075370_10060801 Ga0075370_100608013 162
274 3300006844 Ga0075428_100251939 Ga0075428_1002519393 162
275 3300006847 Ga0075431_100470881 Ga0075431_1004708812 162
276 3300006931 Ga0097620_100003500 Ga0097620_1000035004 162
277 3300009093 Ga0105240_10159100 Ga0105240_101591004 162
278 3300009093 Ga0105240_10239529 Ga0105240_102395294 162
279 3300009148 Ga0105243_10057408 Ga0105243_100574084 162
280 3300009545 Ga0105237_10130058 Ga0105237_101300584 162
281 3300009551 Ga0105238_11030473 Ga0105238_110304732 162
282 3300009553 Ga0105249_10046892 Ga0105249_100468922 162
283 3300009553 Ga0105249_10921608 Ga0105249_109216081 162
284 3300011119 Ga0105246_10162168 Ga0105246_101621683 162
285 3300013104 Ga0157370_10463279 Ga0157370_104632793 162
286 3300013105 Ga0157369_10484025 Ga0157369_104840253 162
287 3300013105 Ga0157369_10900740 Ga0157369_109007402 162
288 3300014326 Ga0157380_10888827 Ga0157380_108888273 162
289 3300020082 Ga0206353_11258788 Ga0206353_112587882 162
290 3300025885 Ga0207653_10102885 Ga0207653_101028853 162
291 3300025912 Ga0207707_10061591 Ga0207707_100615914 162
292 3300025912 Ga0207707_10141199 Ga0207707_101411992 162
293 3300025912 Ga0207707_10284392 Ga0207707_102843923 162
294 3300025913 Ga0207695_10180820 Ga0207695_101808204 162
295 3300025917 Ga0207660_10015931 Ga0207660_100159315 162
296 3300025921 Ga0207652_10664871 Ga0207652_106648712 162
297 3300025921 Ga0207652_10837897 Ga0207652_108378971 162
298 3300025933 Ga0207706_10154749 Ga0207706_101547492 162
299 3300025942 Ga0207689_10089709 Ga0207689_100897092 162
300 3300025944 Ga0207661_10000186 Ga0207661_1000018628 162
301 3300025961 Ga0207712_10023018 Ga0207712_100230182 162
302 3300026067 Ga0207678_10044918 Ga0207678_100449186 162
303 3300026075 Ga0207708_10001399 Ga0207708_100013994 162
304 3300026088 Ga0207641_10164075 Ga0207641_101640753 162
305 3300026095 Ga0207676_10003912 Ga0207676_100039122 162
306 3300026116 Ga0207674_10001143 Ga0207674_100011437 162
307 3300027866 Ga0209813_10013463 Ga0209813_100134634 162
308 3300028380 Ga0268265_10000626 Ga0268265_1000062630 162
309 3300028381 Ga0268264_10003320 Ga0268264_100033202 162
310 3300031824 Ga0307413_10240172 Ga0307413_102401723 162
311 3300031903 Ga0307407_10073940 Ga0307407_100739402 162
312 3300032002 Ga0307416_100092630 Ga0307416_1000926302 162
313 3300032005 Ga0307411_10141110 Ga0307411_101411103 162
314 3300032126 Ga0307415_100632381 Ga0307415_1006323812 162
315 3300035691 Ga0373931_0296164 Ga0373931_0296164_37_525 162
316 3300048905 Ga0496102_0009559 Ga0496102_0009559_1190_1678 162
317 3300048906 Ga0496103_0036330 Ga0496103_0036330_1168_1656 162
318 3300048908 Ga0496105_0591261 Ga0496105_0591261_288_776 162
319 3300048908 Ga0496105_1068102 Ga0496105_1068102_61_558 162
320 3300048909 Ga0496106_0042073 Ga0496106_0042073_2211_2699 162
321 3300048910 Ga0496107_0011296 Ga0496107_0011296_4877_5365 162
322 3300048915 Ga0496112_1642161 Ga0496112_1642161_26_526 162
323 3300049568 Ga0501031_0121925 Ga0501031_0121925_777_1268 162
324 3300049569 Ga0501032_0082015 Ga0501032_0082015_504_992 162
325 3300049569 Ga0501032_0507393 Ga0501032_0507393_166_654 162
326 3300049570 Ga0501033_0029981 Ga0501033_0029981_3473_3961 162
327 3300049570 Ga0501033_0364429 Ga0501033_0364429_134_625 162
328 3300049570 Ga0501033_0755164 Ga0501033_0755164_103_591 162
329 3300049571 Ga0501034_0139192 Ga0501034_0139192_298_786 162
330 3300049571 Ga0501034_0720472 Ga0501034_0720472_310_798 162
331 3300049571 Ga0501034_0750292 Ga0501034_0750292_105_593 162
332 3300049571 Ga0501034_0774770 Ga0501034_0774770_289_777 162
333 3300049572 Ga0501036_0043106 Ga0501036_0043106_1479_1967 162
334 3300049572 Ga0501036_0043249 Ga0501036_0043249_909_1400 162
335 3300049573 Ga0501037_0029303 Ga0501037_0029303_3342_3830 162
336 3300049573 Ga0501037_0290347 Ga0501037_0290347_211_699 162
337 3300049573 Ga0501037_0421132 Ga0501037_0421132_32_520 162
338 3300049574 Ga0501038_0134187 Ga0501038_0134187_1191_1679 162
339 3300049574 Ga0501038_0695400 Ga0501038_0695400_26_514 162
340 3300049574 Ga0501038_1096881 Ga0501038_1096881_39_527 162
341 3300049575 Ga0501039_0312463 Ga0501039_0312463_497_985 162
342 3300049576 Ga0501040_0209868 Ga0501040_0209868_493_981 162
343 3300049577 Ga0501041_0009961 Ga0501041_0009961_4538_5026 162
344 3300049577 Ga0501041_0137308 Ga0501041_0137308_445_936 162
345 3300049578 Ga0501042_0016734 Ga0501042_0016734_4484_4972 162
346 3300049579 Ga0501043_0023357 Ga0501043_0023357_1802_2290 162
347 3300049579 Ga0501043_0315158 Ga0501043_0315158_352_840 162
348 3300049579 Ga0501043_0662765 Ga0501043_0662765_81_569 162
349 3300049580 Ga0501046_0006239 Ga0501046_0006239_8219_8707 162
350 3300049580 Ga0501046_0597111 Ga0501046_0597111_184_672 162
351 3300049581 Ga0501047_0038746 Ga0501047_0038746_70_558 162
352 3300049581 Ga0501047_0125964 Ga0501047_0125964_1821_2309 162
353 3300049581 Ga0501047_0192145 Ga0501047_0192145_505_993 162
354 3300049581 Ga0501047_0558962 Ga0501047_0558962_187_675 162
355 3300049582 Ga0501048_0022535 Ga0501048_0022535_718_1206 162
356 3300049582 Ga0501048_0250462 Ga0501048_0250462_262_753 162
357 3300049584 Ga0501068_0344050 Ga0501068_0344050_64_552 162
358 3300049585 Ga0501069_0105697 Ga0501069_0105697_312_800 162
359 3300049586 Ga0501070_0330595 Ga0501070_0330595_437_925 162
360 3300049586 Ga0501070_0341639 Ga0501070_0341639_605_1093 162
361 3300049587 Ga0501071_0017556 Ga0501071_0017556_1780_2268 162
362 3300049587 Ga0501071_0083056 Ga0501071_0083056_1540_2031 162
363 3300049587 Ga0501071_0307763 Ga0501071_0307763_104_715 162
364 3300049587 Ga0501071_0410503 Ga0501071_0410503_103_591 162
365 3300049588 Ga0501072_0149597 Ga0501072_0149597_641_1129 162
366 3300049588 Ga0501072_0600302 Ga0501072_0600302_237_728 162
367 3300049589 Ga0501073_0152782 Ga0501073_0152782_936_1424 162
368 3300049589 Ga0501073_0201448 Ga0501073_0201448_411_899 162
369 3300049590 Ga0501074_0245665 Ga0501074_0245665_163_654 162
370 3300049590 Ga0501074_0314240 Ga0501074_0314240_194_682 162
371 3300049591 Ga0501075_0016047 Ga0501075_0016047_945_1433 162
372 3300049592 Ga0501076_0013015 Ga0501076_0013015_835_1323 162
373 3300049592 Ga0501076_0093445 Ga0501076_0093445_122_613 162
374 3300049593 Ga0501077_0067608 Ga0501077_0067608_310_798 162
375 3300049593 Ga0501077_0226749 Ga0501077_0226749_428_916 162
376 3300049741 Ga0501079_0226542 Ga0501079_0226542_272_760 162
377 3300049742 Ga0501080_0084392 Ga0501080_0084392_1890_2378 162
378 3300049742 Ga0501080_0110362 Ga0501080_0110362_641_1129 162
379 3300049743 Ga0501081_0025471 Ga0501081_0025471_897_1385 162
380 3300049743 Ga0501081_0252915 Ga0501081_0252915_743_1231 162
381 3300049743 Ga0501081_0641650 Ga0501081_0641650_66_554 162
382 3300049822 Ga0501035_0039585 Ga0501035_0039585_763_1251 162
383 3300049822 Ga0501035_0054537 Ga0501035_0054537_1387_1878 162
384 3300049822 Ga0501035_0230153 Ga0501035_0230153_470_958 162
385 3300049822 Ga0501035_0631049 Ga0501035_0631049_305_793 162
386 3300049823 Ga0501044_0145612 Ga0501044_0145612_1076_1564 162
387 3300049823 Ga0501044_0215578 Ga0501044_0215578_247_735 162
388 3300049823 Ga0501044_0444462 Ga0501044_0444462_593_1081 162
389 3300049823 Ga0501044_0820185 Ga0501044_0820185_14_502 162
390 3300049823 Ga0501044_0895694 Ga0501044_0895694_162_650 162
391 3300049824 Ga0501045_0109607 Ga0501045_0109607_182_670 162
392 3300049824 Ga0501045_0164076 Ga0501045_0164076_438_929 162
393 3300050509 nmdc:mga0qj67_893337_c1 nmdc:mga0qj67_893337_c1_138_626 162
394 3300050510 nmdc:mga06r32_26679_c1 nmdc:mga06r32_26679_c1_1562_2050 162
395 3300050510 nmdc:mga06r32_848374_c1 nmdc:mga06r32_848374_c1_236_724 162
396 3300060353 Ga0501082_0049267 Ga0501082_0049267_1482_1970 162
397 3300060353 Ga0501082_0385566 Ga0501082_0385566_297_785 162
398 3300060353 Ga0501082_0571287 Ga0501082_0571287_357_848 162
399 3300061734 Ga0530510_0002984 Ga0530510_0002984_9290_9778 162
400 3300061734 Ga0530510_0062570 Ga0530510_0062570_1459_1950 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01899

MNHE

Na+/H+ ion antiporter subunit

15

164

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jk9-assembly1.cif.gz_B heterodimer between h48f-ysod1 and yccs 0.871 92 136
1qup-assembly1.cif.gz_B crystal structure of the copper chaperone for superoxide dismutase 0.8477 91 136
2ggp-assembly1.cif.gz_B solution structure of the atx1-cu(i)-ccc2a complex 0.8176 92 149
6fon-assembly1.cif.gz_C elongated conformer of the human copper chaperone for sod1 complexed with human sod1 0.8123 94 149
6fp6-assembly4.cif.gz_H complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation 0.809 91 149
ID Description Score Start End Superfamily
af_I1JM65_169_393_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9146 94 136 3.30.70.100
af_B6SZL4_173_238_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8669 91 145 3.30.70.100
1jk9D01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8634 92 136 3.30.70.100
af_A0A1D6KPQ3_20_86_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8616 89 149 3.30.70.100
af_Q54Q77_94_172_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8524 94 136 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A4U0YBI4-F1-model_v4 Pesticidal protein Cry1Ia 0.9101 87 161 GO:0008324
GO:0016020
AF-A0A4Q3SMI3-F1-model_v4 Na+/H+ antiporter subunit E 0.9078 76 162 GO:0005886
GO:0008324
AF-A0A7Z1V1R0-F1-model_v4 deleted 0.8959 54 161
AF-A0A4Q3SMI3-F1-model_v4 Na+/H+ antiporter subunit E 0.8887 76 162 GO:0005886
GO:0008324
AF-A0A7W7V745-F1-model_v4 Multisubunit Na+/H+ antiporter MnhE subunit 0.8874 56 162 GO:0005886
GO:0008324

Feature Viewer

pLDDT pTM Quality
80.9 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map