metagRoot

F434663

General Info

Members	Datasets	Scaffolds	Average Seq Length
400	228	400	127

Family's Representative Sequence

Representative Sequence	3300046536\|Ga0495587_0274818\|Ga0495587_0274818_473_853
Length	126
Sequence	MDVRSIEAKAPVVEHNGTVPVWWMIESREFKDITDGGYLELVNEFEVPGGGLVDPHHPTHEFYYVMNGKGIMTIDGEDRPISQGDLVYIPPDKVHSLRPISDHAPIHCFCFAIGVKGAGAINYTTH

Samples

	Sample ID	Description	Type	Environment
1	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
2	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
3	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
4	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
5	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
6	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
7	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
8	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
9	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
10	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
11	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
12	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
13	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
14	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
15	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
16	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
17	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
18	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
19	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
20	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
21	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
22	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
23	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
24	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
25	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
26	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
27	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
28	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
29	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
30	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
31	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
32	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
33	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
34	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
35	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
36	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
37	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
38	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
39	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
40	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
41	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
42	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
43	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
44	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
45	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
46	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
47	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
48	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
49	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
50	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
51	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
52	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
53	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
54	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
55	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
56	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
57	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
58	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
59	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
60	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
61	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
62	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
63	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
64	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
65	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
66	3300012505	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610	Metagenome	Rhizosphere
67	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
68	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
69	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
70	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
71	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
72	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
73	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
74	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
75	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
76	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
77	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
78	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
79	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
80	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
112	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
113	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
114	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
115	3300030760	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
116	3300030878	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
117	3300030879	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
118	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
119	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
120	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
121	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
122	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
123	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
124	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
125	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
126	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
127	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
128	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
129	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
130	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
131	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
132	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
133	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
134	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
135	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
136	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
137	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
138	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
139	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
140	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
141	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
142	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
143	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
144	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
145	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
146	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
147	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
148	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
149	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
150	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
151	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
152	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
153	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
154	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
155	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
156	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
157	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
158	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
159	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
160	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
161	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
162	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
163	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
164	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
165	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
166	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
167	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
168	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
169	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
170	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
171	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
172	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
173	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
174	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
175	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
176	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
177	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
178	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
179	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
180	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
181	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
182	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
183	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
184	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
185	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
186	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
187	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
188	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
189	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
190	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
191	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
192	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
193	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
194	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
195	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
196	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
197	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
198	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
199	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
200	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
201	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
202	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
203	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
204	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
205	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
206	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
207	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
208	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
209	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
210	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
211	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
212	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
213	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
214	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
215	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
216	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
217	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
218	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
219	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
220	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
221	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
222	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
223	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
224	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
225	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
226	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
227	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
228	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99
Metatranscriptomes	1
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1
Nodule	0
Rhizoplane	9.25
Rhizosphere	87.5
Stem	0
Stem Tuber	0
Unclassified	2.25

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0070683_102206314	3300005329	Bacteria	529
2	Ga0070670_100669910	3300005331	Bacteria	932
3	Ga0068868_100236650	3300005338	Bacteria	1533
4	Ga0068868_100460317	3300005338	Unclassified	1108
5	Ga0070660_100469545	3300005339	Bacteria	1045
6	Ga0070660_101548679	3300005339	Bacteria	564
7	Ga0070668_102115117	3300005347	Unclassified	520
8	Ga0070671_100560193	3300005355	Bacteria	986
9	Ga0070688_101064960	3300005365	Unclassified	645
10	Ga0070667_100872994	3300005367	Bacteria	837
11	Ga0070709_10683873	3300005434	Unclassified	797
12	Ga0070714_100741509	3300005435	Bacteria	949
13	Ga0070714_102263320	3300005435	Bacteria	529
14	Ga0070713_100564921	3300005436	Bacteria	1078
15	Ga0070713_100753615	3300005436	Unclassified	932
16	Ga0070713_102383058	3300005436	Bacteria	512
17	Ga0070705_100648309	3300005440	Bacteria	823
18	Ga0070700_100795805	3300005441	Bacteria	761
19	Ga0070700_100825336	3300005441	Bacteria	749
20	Ga0070678_100022267	3300005456	Bacteria	4195
21	Ga0070681_11991175	3300005458	Bacteria	509
22	Ga0070706_100033917	3300005467	Bacteria	4712
23	Ga0070706_100042517	3300005467	Bacteria	4199
24	Ga0070706_100148367	3300005467	Bacteria	2189
25	Ga0070706_100404793	3300005467	Bacteria	1270
26	Ga0070707_100082468	3300005468	Bacteria	3106
27	Ga0070698_101240533	3300005471	Unclassified	695
28	Ga0070699_100116732	3300005518	Bacteria	2346
29	Ga0070699_100295263	3300005518	Bacteria	1453
30	Ga0070699_101106787	3300005518	Bacteria	727
31	Ga0070679_100842988	3300005530	Bacteria	860
32	Ga0070684_100618395	3300005535	Bacteria	1008
33	Ga0070684_100683931	3300005535	Unclassified	956
34	Ga0070697_100174849	3300005536	Bacteria	1818
35	Ga0070697_100476293	3300005536	Unclassified	1090
36	Ga0070672_101033475	3300005543	Unclassified	729
37	Ga0070686_100238646	3300005544	Bacteria	1322
38	Ga0070696_100688983	3300005546	Unclassified	832
39	Ga0070693_100023080	3300005547	Bacteria	3319
40	Ga0070665_101314936	3300005548	Bacteria	733
41	Ga0068855_100602041	3300005563	Bacteria	1185
42	Ga0070664_100441336	3300005564	Bacteria	1194
43	Ga0068857_101209034	3300005577	Bacteria	732
44	Ga0068854_100163682	3300005578	Bacteria	1725
45	Ga0068856_100422384	3300005614	Bacteria	1353
46	Ga0068859_100911704	3300005617	Bacteria	963
47	Ga0068861_101147055	3300005719	Bacteria	749
48	Ga0068858_101696681	3300005842	Bacteria	624
49	Ga0068860_101811984	3300005843	Unclassified	632
50	Ga0068860_102501010	3300005843	Unclassified	536
51	Ga0068862_101554761	3300005844	Bacteria	668
52	Ga0068862_102216613	3300005844	Unclassified	561
53	Ga0081455_10060121	3300005937	Bacteria	3205
54	Ga0081455_10061718	3300005937	Bacteria	3153
55	Ga0081455_10110036	3300005937	Bacteria	2191
56	Ga0081455_10688010	3300005937	Unclassified	653
57	Ga0081539_10191070	3300005985	Bacteria	953
58	Ga0075363_100001448	3300006048	Bacteria	8990
59	Ga0070712_100661872	3300006175	Bacteria	888
60	Ga0070712_100741348	3300006175	Bacteria	840
61	Ga0097621_101376142	3300006237	Bacteria	668
62	Ga0075428_100227152	3300006844	Bacteria	2015
63	Ga0075428_100255767	3300006844	Bacteria	1887
64	Ga0075428_100322588	3300006844	Bacteria	1660
65	Ga0075428_100762709	3300006844	Bacteria	1029
66	Ga0075430_100014058	3300006846	Bacteria	6824
67	Ga0075431_100055538	3300006847	Bacteria	4085
68	Ga0075431_100159095	3300006847	Bacteria	2323
69	Ga0075431_100410423	3300006847	Bacteria	1354
70	Ga0075431_102143711	3300006847	Unclassified	513
71	Ga0075433_10002106	3300006852	Bacteria	15086
72	Ga0075434_100001387	3300006871	Bacteria	20320
73	Ga0075434_101531081	3300006871	Bacteria	676
74	Ga0075429_100003771	3300006880	Bacteria	12925
75	Ga0075429_100144167	3300006880	Bacteria	2085
76	Ga0068865_100724363	3300006881	Bacteria	852
77	Ga0075436_100016551	3300006914	Bacteria	5048
78	Ga0097620_100911561	3300006931	Bacteria	963
79	Ga0075435_100015092	3300007076	Bacteria	5799
80	Ga0105240_10827271	3300009093	Unclassified	1001
81	Ga0105240_11918746	3300009093	Bacteria	616
82	Ga0111539_10067790	3300009094	Bacteria	4213
83	Ga0111539_10139985	3300009094	Bacteria	2833
84	Ga0111539_10633119	3300009094	Bacteria	1245
85	Ga0111539_11291928	3300009094	Bacteria	847
86	Ga0105245_10282815	3300009098	Bacteria	1622
87	Ga0105245_11303670	3300009098	Bacteria	775
88	Ga0105245_11559892	3300009098	Bacteria	712
89	Ga0105245_12161039	3300009098	Unclassified	610
90	Ga0105247_10690431	3300009101	Unclassified	767
91	Ga0105247_11359770	3300009101	Bacteria	573
92	Ga0114129_10172794	3300009147	Bacteria	2945
93	Ga0114129_10523575	3300009147	Bacteria	1545
94	Ga0114129_10940306	3300009147	Bacteria	1092
95	Ga0114129_11014885	3300009147	Bacteria	1044
96	Ga0114129_11210348	3300009147	Bacteria	940
97	Ga0114129_11459988	3300009147	Unclassified	842
98	Ga0105243_10947682	3300009148	Bacteria	860
99	Ga0105243_13015058	3300009148	Unclassified	511
100	Ga0105241_12324455	3300009174	Unclassified	534
101	Ga0105242_10058521	3300009176	Bacteria	3160
102	Ga0105242_10132581	3300009176	Bacteria	2153
103	Ga0105242_10469618	3300009176	Archaea	1190
104	Ga0105242_11977772	3300009176	Bacteria	625
105	Ga0105248_12776248	3300009177	Unclassified	559
106	Ga0105237_12227632	3300009545	Bacteria	557
107	Ga0105249_10985439	3300009553	Bacteria	911
108	Ga0105249_11242161	3300009553	Bacteria	816
109	Ga0105249_12362256	3300009553	Bacteria	604
110	Ga0105239_10945952	3300010375	Bacteria	989
111	Ga0105239_11127530	3300010375	Bacteria	903
112	Ga0105246_10740652	3300011119	Bacteria	866
113	Ga0105246_11097277	3300011119	Unclassified	726
114	Ga0105246_11776789	3300011119	Unclassified	588
115	Ga0105246_11999623	3300011119	Bacteria	559
116	Ga0157339_1057237	3300012505	Unclassified	532
117	Ga0157369_12026488	3300013105	Unclassified	584
118	Ga0157378_10217178	3300013297	Bacteria	1816
119	Ga0163162_10276797	3300013306	Bacteria	1810
120	Ga0163162_11112234	3300013306	Bacteria	895
121	Ga0157372_11378333	3300013307	Bacteria	813
122	Ga0157372_13017280	3300013307	Unclassified	538
123	Ga0157375_10408266	3300013308	Bacteria	1524
124	Ga0157375_10625400	3300013308	Bacteria	1234
125	Ga0157375_11416920	3300013308	Bacteria	819
126	Ga0157375_11990981	3300013308	Unclassified	690
127	Ga0163163_10748277	3300014325	Bacteria	1041
128	Ga0163163_12175558	3300014325	Unclassified	614
129	Ga0157380_13268350	3300014326	Bacteria	518
130	Ga0182008_10813576	3300014497	Bacteria	543
131	Ga0157377_10515791	3300014745	Bacteria	838
132	Ga0157377_11175062	3300014745	Unclassified	592
133	Ga0157379_10426241	3300014968	Bacteria	1222
134	Ga0157379_10807753	3300014968	Bacteria	886
135	Ga0157379_12550529	3300014968	Unclassified	512
136	Ga0157376_10446241	3300014969	Bacteria	1261
137	Ga0157376_11754445	3300014969	Unclassified	656
138	Ga0206350_11118772	3300020080	Unclassified	947
139	Ga0213871_10059383	3300021441	Bacteria	1063
140	Ga0207692_10639410	3300025898	Bacteria	687
141	Ga0207699_10761374	3300025906	Unclassified	711
142	Ga0207645_10331170	3300025907	Bacteria	1017
143	Ga0207684_10115078	3300025910	Bacteria	2303
144	Ga0207684_10216485	3300025910	Bacteria	1653
145	Ga0207707_10165579	3300025912	Bacteria	1932
146	Ga0207652_11244636	3300025921	Unclassified	646
147	Ga0207646_10297532	3300025922	Bacteria	1458
148	Ga0207646_11033457	3300025922	Unclassified	725
149	Ga0207650_10777028	3300025925	Bacteria	811
150	Ga0207650_11317278	3300025925	Bacteria	615
151	Ga0207687_10010094	3300025927	Bacteria	6175
152	Ga0207700_10108174	3300025928	Bacteria	2232
153	Ga0207700_10485398	3300025928	Bacteria	1092
154	Ga0207664_11226395	3300025929	Unclassified	668
155	Ga0207644_10599471	3300025931	Bacteria	915
156	Ga0207644_11410648	3300025931	Unclassified	585
157	Ga0207706_11260446	3300025933	Bacteria	612
158	Ga0207686_10150651	3300025934	Bacteria	1619
159	Ga0207686_10515748	3300025934	Unclassified	930
160	Ga0207709_10405557	3300025935	Bacteria	1043
161	Ga0207669_11061320	3300025937	Bacteria	683
162	Ga0207665_10675793	3300025939	Bacteria	811
163	Ga0207691_10057138	3300025940	Bacteria	3552
164	Ga0207691_10640369	3300025940	Unclassified	898
165	Ga0207661_11146014	3300025944	Unclassified	716
166	Ga0207661_12168030	3300025944	Bacteria	502
167	Ga0207679_10331404	3300025945	Bacteria	1321
168	Ga0207679_10696570	3300025945	Bacteria	922
169	Ga0207679_10916137	3300025945	Bacteria	802
170	Ga0207712_10526357	3300025961	Bacteria	1014
171	Ga0207712_11833452	3300025961	Bacteria	543
172	Ga0207640_10340667	3300025981	Bacteria	1201
173	Ga0207677_10222117	3300026023	Unclassified	1516
174	Ga0207677_11544966	3300026023	Bacteria	614
175	Ga0207639_11706365	3300026041	Bacteria	590
176	Ga0207708_10722980	3300026075	Bacteria	853
177	Ga0207708_10894474	3300026075	Bacteria	768
178	Ga0207708_10896884	3300026075	Bacteria	767
179	Ga0207674_10749426	3300026116	Bacteria	943
180	Ga0207683_10036380	3300026121	Bacteria	4287
181	Ga0207683_11087847	3300026121	Bacteria	742
182	Ga0207698_11314747	3300026142	Bacteria	738
183	Ga0268266_11484411	3300028379	Bacteria	653
184	Ga0268265_10641768	3300028380	Bacteria	1020
185	Ga0268265_11160951	3300028380	Bacteria	769
186	Ga0268265_12375574	3300028380	Unclassified	537
187	Ga0268264_10431547	3300028381	Bacteria	1273
188	Ga0265326_10231029	3300028558	Unclassified	533
189	Ga0265334_10210834	3300028573	Unclassified	673
190	Ga0265318_10046252	3300028577	Bacteria	1643
191	Ga0265318_10152159	3300028577	Bacteria	849
192	Ga0265338_10063248	3300028800	Unclassified	3228
193	Ga0265338_10152175	3300028800	Bacteria	1796
194	Ga0265338_10219189	3300028800	Unclassified	1422
195	Ga0265338_10594526	3300028800	Unclassified	771
196	Ga0265762_1044934	3300030760	Unclassified	873
197	Ga0265770_1008682	3300030878	Bacteria	1453
198	Ga0265765_1008327	3300030879	Bacteria	1128
199	Ga0265320_10244277	3300031240	Bacteria	797
200	Ga0265340_10203457	3300031247	Unclassified	890
201	Ga0265327_10005382	3300031251	Bacteria	10698
202	Ga0265327_10032672	3300031251	Bacteria	2909
203	Ga0265327_10052177	3300031251	Bacteria	2130
204	Ga0265327_10133656	3300031251	Bacteria	1165
205	Ga0265327_10156706	3300031251	Bacteria	1055
206	Ga0265327_10203719	3300031251	Unclassified	895
207	Ga0265327_10240732	3300031251	Unclassified	808
208	Ga0265327_10250617	3300031251	Unclassified	789
209	Ga0265327_10288105	3300031251	Bacteria	725
210	Ga0265316_10606685	3300031344	Bacteria	776
211	Ga0265313_10137304	3300031595	Bacteria	1054
212	Ga0265314_10106588	3300031711	Bacteria	1790
213	Ga0265314_10194547	3300031711	Bacteria	1204
214	Ga0265342_10225977	3300031712	Bacteria	1007
215	Ga0307415_100805498	3300032126	Bacteria	858
216	Ga0373945_0139032	3300035116	Bacteria	978
217	Ga0373945_0414269	3300035116	Unclassified	592
218	Ga0373943_0449747	3300035170	Bacteria	748
219	Ga0373943_0582682	3300035170	Bacteria	658
220	Ga0373955_0452954	3300035172	Bacteria	782
221	Ga0373935_0161909	3300035692	Bacteria	1526
222	Ga0373935_1476812	3300035692	Bacteria	509
223	Ga0373947_0121699	3300035725	Bacteria	1658
224	Ga0373947_1164085	3300035725	Unclassified	525
225	Ga0373937_1424262	3300036401	Unclassified	641
226	Ga0373925_0440087	3300037068	Bacteria	1067
227	Ga0436365_1292120	3300039437	Bacteria	803
228	Ga0436365_1601787	3300039437	Bacteria	3780
229	Ga0436360_0253991	3300039438	Unclassified	1830
230	Ga0436360_0962140	3300039438	Bacteria	1869
231	Ga0436361_0076905	3300039447	Bacteria	761
232	Ga0436361_1033142	3300039447	Bacteria	1182
233	Ga0436363_0628680	3300039450	Bacteria	625
234	Ga0436363_0770541	3300039450	Bacteria	745
235	Ga0436363_1228645	3300039450	Bacteria	813
236	Ga0436362_1268431	3300039453	Bacteria	836
237	Ga0451793_0101112	3300041452	Unclassified	530
238	Ga0451795_0819431	3300041456	Unclassified	665
239	Ga0451802_0471874	3300041460	Bacteria	588
240	Ga0451804_1140514	3300041463	Bacteria	665
241	Ga0451807_1193890	3300041486	Bacteria	590
242	Ga0451839_1560335	3300041496	Unclassified	550
243	Ga0451855_0632374	3300041511	Bacteria	525
244	Ga0451853_3848491	3300041512	Unclassified	836
245	Ga0466966_0835753	3300044684	Unclassified	555
246	Ga0466967_0428108	3300045976	Bacteria	1291
247	Ga0466967_2234959	3300045976	Bacteria	543
248	Ga0495603_0230752	3300046455	Bacteria	1067
249	Ga0495603_0279880	3300046455	Unclassified	959
250	Ga0495629_0276620	3300046459	Bacteria	1153
251	Ga0495641_0118320	3300046461	Bacteria	1182
252	Ga0495651_0329242	3300046462	Bacteria	1016
253	Ga0495651_0333620	3300046462	Unclassified	1007
254	Ga0495651_0961197	3300046462	Unclassified	520
255	Ga0495653_0125221	3300046463	Bacteria	1826
256	Ga0495653_0227669	3300046463	Unclassified	1250
257	Ga0495580_0115572	3300046472	Bacteria	1864
258	Ga0495639_0067212	3300046475	Unclassified	1651
259	Ga0495639_0386200	3300046475	Bacteria	706
260	Ga0495639_0460056	3300046475	Unclassified	647
261	Ga0495639_0489586	3300046475	Bacteria	627
262	Ga0495639_0641691	3300046475	Unclassified	547
263	Ga0495664_0446407	3300046477	Bacteria	775
264	Ga0495608_0588424	3300046511	Unclassified	668
265	Ga0495608_0760247	3300046511	Unclassified	574
266	Ga0495628_0883556	3300046516	Unclassified	621
267	Ga0495630_0094195	3300046517	Bacteria	2264
268	Ga0495630_0148022	3300046517	Bacteria	1786
269	Ga0495630_0161700	3300046517	Bacteria	1705
270	Ga0495630_0285630	3300046517	Bacteria	1261
271	Ga0495630_0422220	3300046517	Unclassified	1022
272	Ga0495630_0752061	3300046517	Bacteria	745
273	Ga0495644_0275781	3300046523	Unclassified	656
274	Ga0495652_0379353	3300046529	Bacteria	1006
275	Ga0495652_0897762	3300046529	Unclassified	585
276	Ga0495640_0522365	3300046533	Bacteria	721
277	Ga0495640_0563521	3300046533	Bacteria	690
278	Ga0495586_0569132	3300046535	Bacteria	654
279	Ga0495586_0861587	3300046535	Unclassified	522
280	Ga0495587_0274818	3300046536	Unclassified	945
281	Ga0495667_0365364	3300046559	Bacteria	911
282	Ga0495667_0424804	3300046559	Unclassified	836
283	Ga0495667_0663734	3300046559	Bacteria	647
284	Ga0495667_0721990	3300046559	Bacteria	617
285	Ga0495656_0108462	3300046615	Bacteria	1295
286	Ga0495634_0199133	3300046642	Bacteria	1245
287	Ga0495588_0213072	3300046674	Bacteria	1020
288	Ga0495588_0276532	3300046674	Unclassified	885
289	Ga0495657_0175392	3300046675	Bacteria	1318
290	Ga0495657_0313732	3300046675	Unclassified	933
291	Ga0495657_0475343	3300046675	Unclassified	730
292	Ga0495647_0015254	3300046681	Bacteria	2690
293	Ga0495647_0130792	3300046681	Bacteria	1063
294	Ga0495647_0424077	3300046681	Bacteria	613
295	Ga0495658_0064979	3300046683	Bacteria	2104
296	Ga0495613_0844138	3300046689	Unclassified	596
297	Ga0495624_0657707	3300046690	Bacteria	623
298	Ga0495624_0825188	3300046690	Bacteria	548
299	Ga0495600_0592446	3300046809	Bacteria	674
300	Ga0495581_0134882	3300047315	Unclassified	1439
301	Ga0495676_0069711	3300047321	Bacteria	2712
302	Ga0495676_0190403	3300047321	Bacteria	1431
303	Ga0495676_0254018	3300047321	Bacteria	1198
304	Ga0495680_0230516	3300047322	Bacteria	1319
305	Ga0495680_0717984	3300047322	Bacteria	659
306	Ga0495675_0390528	3300047444	Unclassified	813
307	Ga0495684_0277010	3300047471	Bacteria	1212
308	Ga0495686_0162740	3300047472	Bacteria	1303
309	Ga0495602_0806820	3300048088	Unclassified	630
310	Ga0495602_0825901	3300048088	Bacteria	621
311	Ga0495614_0031366	3300048089	Unclassified	2287
312	Ga0496100_1284026	3300048903	Unclassified	578
313	Ga0496101_0758160	3300048904	Bacteria	766
314	Ga0496102_0642861	3300048905	Bacteria	984
315	Ga0496102_1262488	3300048905	Bacteria	658
316	Ga0496104_0217059	3300048907	Bacteria	1825
317	Ga0496104_0825814	3300048907	Bacteria	833
318	Ga0496105_1127222	3300048908	Unclassified	581
319	Ga0496108_0494196	3300048911	Bacteria	1069
320	Ga0496108_0646817	3300048911	Bacteria	919
321	Ga0496108_0884974	3300048911	Unclassified	767
322	Ga0496108_1013558	3300048911	Bacteria	709
323	Ga0496109_0360242	3300048912	Bacteria	1374
324	Ga0496109_0642916	3300048912	Bacteria	998
325	Ga0496109_0896401	3300048912	Bacteria	825
326	Ga0496110_0107545	3300048913	Bacteria	2504
327	Ga0496110_0866141	3300048913	Bacteria	809
328	Ga0496110_0920211	3300048913	Bacteria	781
329	Ga0496112_0079664	3300048915	Bacteria	3240
330	Ga0496112_0107620	3300048915	Bacteria	2758
331	Ga0496112_0231605	3300048915	Unclassified	1802
332	Ga0496112_1009508	3300048915	Bacteria	752
333	Ga0496112_1716527	3300048915	Bacteria	540
334	Ga0496113_0261904	3300048916	Bacteria	1381
335	Ga0496113_0713533	3300048916	Unclassified	800
336	Ga0496113_0738376	3300048916	Unclassified	784
337	Ga0496114_0339734	3300048917	Bacteria	1328
338	Ga0496114_0476288	3300048917	Bacteria	1105
339	Ga0496114_0869515	3300048917	Bacteria	782
340	Ga0496115_0106125	3300048918	Bacteria	2306
341	Ga0496115_0421140	3300048918	Bacteria	1082
342	Ga0496115_0480881	3300048918	Bacteria	1000
343	Ga0496115_1045141	3300048918	Bacteria	622
344	Ga0496126_0012365	3300048929	Bacteria	8753
345	Ga0501036_0303976	3300049572	Unclassified	1334
346	Ga0501036_1746959	3300049572	Bacteria	501
347	Ga0501037_0756228	3300049573	Bacteria	644
348	Ga0501040_0390621	3300049576	Unclassified	999
349	Ga0501043_0416996	3300049579	Unclassified	1013
350	Ga0501068_0035442	3300049584	Bacteria	2979
351	Ga0501069_0152561	3300049585	Bacteria	1328
352	Ga0501070_0040292	3300049586	Bacteria	3895
353	Ga0501070_0432038	3300049586	Bacteria	1063
354	Ga0501072_0400344	3300049588	Bacteria	1089
355	Ga0501072_0585095	3300049588	Bacteria	880
356	Ga0501075_0853519	3300049591	Bacteria	693
357	Ga0501077_0723565	3300049593	Bacteria	640
358	Ga0501079_0975610	3300049741	Bacteria	667
359	Ga0501080_0215477	3300049742	Bacteria	1759
360	Ga0501081_0854116	3300049743	Bacteria	686
361	Ga0501083_0464934	3300049744	Bacteria	823
362	Ga0501044_0936180	3300049823	Bacteria	740
363	Ga0501045_0840630	3300049824	Bacteria	675
364	nmdc:mga03n38_30897_c1	3300050490	Bacteria	2256
365	nmdc:mga05p37_1140584_c1	3300050507	Bacteria	812
366	nmdc:mga05p37_138539_c2	3300050507	Bacteria	2382
367	nmdc:mga05p37_1414368_c1	3300050507	Archaea	699
368	nmdc:mga05p37_62843_c1	3300050507	Bacteria	4569
369	nmdc:mga05p37_80385_c1	3300050507	Bacteria	4016
370	nmdc:mga05p37_844436_c1	3300050507	Bacteria	995
371	nmdc:mga09592_24734_c1	3300050508	Bacteria	4966
372	nmdc:mga09592_280072_c1	3300050508	Bacteria	1446
373	nmdc:mga09592_895804_c1	3300050508	Bacteria	746
374	nmdc:mga0qj67_97087_c1	3300050509	Bacteria	2372
375	nmdc:mga06r32_157704_c1	3300050510	Bacteria	2251
376	nmdc:mga06r32_173588_c1	3300050510	Bacteria	2140
377	nmdc:mga06r32_19729_c1	3300050510	Bacteria	6195
378	nmdc:mga08y16_170114_c1	3300050511	Bacteria	2263
379	nmdc:mga08y16_55028_c1	3300050511	Bacteria	4158
380	nmdc:mga0n895_44897_c1	3300050512	Bacteria	4310
381	nmdc:mga0rr50_533274_c1	3300050513	Bacteria	999
382	nmdc:mga0rr50_58803_c1	3300050513	Bacteria	2883
383	nmdc:mga08x19_18919_c1	3300050514	Bacteria	4223
384	nmdc:mga0a205_90298_c1	3300050515	Bacteria	2961
385	Ga0495601_0105068	3300053077	Bacteria	1826
386	Ga0495601_0136208	3300053077	Bacteria	1601
387	Ga0495601_0297959	3300053077	Bacteria	1051
388	Ga0495612_0325176	3300053078	Bacteria	692
389	Ga0495612_0354362	3300053078	Unclassified	663
390	Ga0495595_0450414	3300053084	Bacteria	654
391	Ga0495619_0051224	3300053085	Bacteria	2728
392	Ga0495619_0331943	3300053085	Unclassified	1053
393	Ga0495619_0366543	3300053085	Bacteria	996
394	Ga0495619_0440819	3300053085	Unclassified	898
395	Ga0495619_0518489	3300053085	Bacteria	819
396	Ga0500566_0176714	3300053094	Bacteria	1099
397	Ga0500616_0004886	3300053153	Bacteria	9328
398	Ga0501084_0000062	3300054114	Bacteria	81712
399	Ga0501084_0886245	3300054114	Bacteria	750
400	Ga0501082_0199283	3300060353	Bacteria	1742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300014745	Ga0157377_11175062	Ga0157377_111750622	114
2	3300025944	Ga0207661_12168030	Ga0207661_121680302	114
3	3300047444	Ga0495675_0390528	Ga0495675_0390528_86_466	116
4	3300046809	Ga0495600_0592446	Ga0495600_0592446_183_566	117
5	3300005367	Ga0070667_100872994	Ga0070667_1008729942	120
6	3300035725	Ga0373947_1164085	Ga0373947_1164085_89_451	120
7	3300046475	Ga0495639_0067212	Ga0495639_0067212_999_1361	120
8	3300046674	Ga0495588_0276532	Ga0495588_0276532_484_846	120
9	3300046681	Ga0495647_0015254	Ga0495647_0015254_200_562	120
10	3300046690	Ga0495624_0825188	Ga0495624_0825188_56_418	120
11	3300047315	Ga0495581_0134882	Ga0495581_0134882_679_1041	120
12	3300048089	Ga0495614_0031366	Ga0495614_0031366_838_1200	120
13	3300005365	Ga0070688_101064960	Ga0070688_1010649602	121
14	3300009174	Ga0105241_12324455	Ga0105241_123244552	121
15	3300025931	Ga0207644_11410648	Ga0207644_114106482	121
16	3300046559	Ga0495667_0721990	Ga0495667_0721990_39_416	124
17	3300005338	Ga0068868_100236650	Ga0068868_1002366502	125
18	3300005339	Ga0070660_101548679	Ga0070660_1015486791	125
19	3300005458	Ga0070681_11991175	Ga0070681_119911751	125
20	3300005471	Ga0070698_101240533	Ga0070698_1012405332	125
21	3300005518	Ga0070699_101106787	Ga0070699_1011067872	125
22	3300005548	Ga0070665_101314936	Ga0070665_1013149362	125
23	3300005617	Ga0068859_100911704	Ga0068859_1009117041	125
24	3300005842	Ga0068858_101696681	Ga0068858_1016966811	125
25	3300005843	Ga0068860_102501010	Ga0068860_1025010101	125
26	3300006931	Ga0097620_100911561	Ga0097620_1009115611	125
27	3300009098	Ga0105245_11559892	Ga0105245_115598922	125
28	3300009176	Ga0105242_11977772	Ga0105242_119777721	125
29	3300009545	Ga0105237_12227632	Ga0105237_122276321	125
30	3300009553	Ga0105249_12362256	Ga0105249_123622562	125
31	3300011119	Ga0105246_10740652	Ga0105246_107406522	125
32	3300011119	Ga0105246_11776789	Ga0105246_117767892	125
33	3300013306	Ga0163162_10276797	Ga0163162_102767971	125
34	3300014325	Ga0163163_12175558	Ga0163163_121755582	125
35	3300014968	Ga0157379_10426241	Ga0157379_104262412	125
36	3300025898	Ga0207692_10639410	Ga0207692_106394102	125
37	3300025906	Ga0207699_10761374	Ga0207699_107613742	125
38	3300025961	Ga0207712_11833452	Ga0207712_118334522	125
39	3300026023	Ga0207677_11544966	Ga0207677_115449662	125
40	3300026121	Ga0207683_11087847	Ga0207683_110878471	125
41	3300028379	Ga0268266_11484411	Ga0268266_114844112	125
42	3300028800	Ga0265338_10219189	Ga0265338_102191892	125
43	3300031240	Ga0265320_10244277	Ga0265320_102442772	125
44	3300031251	Ga0265327_10032672	Ga0265327_100326723	125
45	3300031251	Ga0265327_10203719	Ga0265327_102037192	125
46	3300031251	Ga0265327_10288105	Ga0265327_102881052	125
47	3300031344	Ga0265316_10606685	Ga0265316_106066852	125
48	3300031595	Ga0265313_10137304	Ga0265313_101373042	125
49	3300031711	Ga0265314_10106588	Ga0265314_101065883	125
50	3300035692	Ga0373935_1476812	Ga0373935_1476812_30_410	125
51	3300046475	Ga0495639_0489586	Ga0495639_0489586_227_607	125
52	3300046477	Ga0495664_0446407	Ga0495664_0446407_342_722	125
53	3300046517	Ga0495630_0752061	Ga0495630_0752061_124_504	125
54	3300046523	Ga0495644_0275781	Ga0495644_0275781_19_399	125
55	3300046535	Ga0495586_0861587	Ga0495586_0861587_24_404	125
56	3300046536	Ga0495587_0274818	Ga0495587_0274818_473_853	125
57	3300046689	Ga0495613_0844138	Ga0495613_0844138_165_545	125
58	3300047322	Ga0495680_0717984	Ga0495680_0717984_204_584	125
59	3300048088	Ga0495602_0806820	Ga0495602_0806820_108_488	125
60	3300048904	Ga0496101_0758160	Ga0496101_0758160_250_630	125
61	3300048907	Ga0496104_0217059	Ga0496104_0217059_668_1048	125
62	3300048911	Ga0496108_0884974	Ga0496108_0884974_226_606	125
63	3300048915	Ga0496112_0079664	Ga0496112_0079664_2612_2992	125
64	3300048916	Ga0496113_0261904	Ga0496113_0261904_719_1099	125
65	3300049744	Ga0501083_0464934	Ga0501083_0464934_66_446	125
66	3300054114	Ga0501084_0886245	Ga0501084_0886245_43_423	125
67	3300005329	Ga0070683_102206314	Ga0070683_1022063141	126
68	3300005331	Ga0070670_100669910	Ga0070670_1006699101	126
69	3300005338	Ga0068868_100460317	Ga0068868_1004603172	126
70	3300005339	Ga0070660_100469545	Ga0070660_1004695452	126
71	3300005347	Ga0070668_102115117	Ga0070668_1021151171	126
72	3300005355	Ga0070671_100560193	Ga0070671_1005601932	126
73	3300005434	Ga0070709_10683873	Ga0070709_106838732	126
74	3300005435	Ga0070714_100741509	Ga0070714_1007415092	126
75	3300005435	Ga0070714_102263320	Ga0070714_1022633201	126
76	3300005436	Ga0070713_100564921	Ga0070713_1005649212	126
77	3300005436	Ga0070713_100753615	Ga0070713_1007536152	126
78	3300005436	Ga0070713_102383058	Ga0070713_1023830581	126
79	3300005440	Ga0070705_100648309	Ga0070705_1006483091	126
80	3300005441	Ga0070700_100795805	Ga0070700_1007958051	126
81	3300005441	Ga0070700_100825336	Ga0070700_1008253362	126
82	3300005456	Ga0070678_100022267	Ga0070678_1000222676	126
83	3300005467	Ga0070706_100033917	Ga0070706_1000339174	126
84	3300005467	Ga0070706_100042517	Ga0070706_1000425173	126
85	3300005467	Ga0070706_100148367	Ga0070706_1001483673	126
86	3300005467	Ga0070706_100404793	Ga0070706_1004047933	126
87	3300005468	Ga0070707_100082468	Ga0070707_1000824684	126
88	3300005518	Ga0070699_100116732	Ga0070699_1001167322	126
89	3300005518	Ga0070699_100295263	Ga0070699_1002952632	126
90	3300005530	Ga0070679_100842988	Ga0070679_1008429881	126
91	3300005535	Ga0070684_100618395	Ga0070684_1006183952	126
92	3300005535	Ga0070684_100683931	Ga0070684_1006839311	126
93	3300005536	Ga0070697_100174849	Ga0070697_1001748492	126
94	3300005536	Ga0070697_100476293	Ga0070697_1004762931	126
95	3300005543	Ga0070672_101033475	Ga0070672_1010334752	126
96	3300005544	Ga0070686_100238646	Ga0070686_1002386462	126
97	3300005546	Ga0070696_100688983	Ga0070696_1006889832	126
98	3300005547	Ga0070693_100023080	Ga0070693_1000230802	126
99	3300005563	Ga0068855_100602041	Ga0068855_1006020412	126
100	3300005564	Ga0070664_100441336	Ga0070664_1004413362	126
101	3300005577	Ga0068857_101209034	Ga0068857_1012090342	126
102	3300005578	Ga0068854_100163682	Ga0068854_1001636822	126
103	3300005614	Ga0068856_100422384	Ga0068856_1004223843	126
104	3300005719	Ga0068861_101147055	Ga0068861_1011470552	126
105	3300005843	Ga0068860_101811984	Ga0068860_1018119841	126
106	3300005844	Ga0068862_101554761	Ga0068862_1015547611	126
107	3300005844	Ga0068862_102216613	Ga0068862_1022166131	126
108	3300005937	Ga0081455_10060121	Ga0081455_100601213	126
109	3300005937	Ga0081455_10061718	Ga0081455_100617182	126
110	3300005937	Ga0081455_10110036	Ga0081455_101100362	126
111	3300005937	Ga0081455_10688010	Ga0081455_106880102	126
112	3300005985	Ga0081539_10191070	Ga0081539_101910702	126
113	3300006048	Ga0075363_100001448	Ga0075363_1000014483	126
114	3300006175	Ga0070712_100661872	Ga0070712_1006618722	126
115	3300006175	Ga0070712_100741348	Ga0070712_1007413481	126
116	3300006237	Ga0097621_101376142	Ga0097621_1013761422	126
117	3300006844	Ga0075428_100227152	Ga0075428_1002271523	126
118	3300006844	Ga0075428_100255767	Ga0075428_1002557671	126
119	3300006844	Ga0075428_100322588	Ga0075428_1003225882	126
120	3300006844	Ga0075428_100762709	Ga0075428_1007627092	126
121	3300006846	Ga0075430_100014058	Ga0075430_1000140585	126
122	3300006847	Ga0075431_100055538	Ga0075431_1000555385	126
123	3300006847	Ga0075431_100159095	Ga0075431_1001590951	126
124	3300006847	Ga0075431_100410423	Ga0075431_1004104232	126
125	3300006847	Ga0075431_102143711	Ga0075431_1021437111	126
126	3300006852	Ga0075433_10002106	Ga0075433_100021066	126
127	3300006871	Ga0075434_100001387	Ga0075434_10000138711	126
128	3300006871	Ga0075434_101531081	Ga0075434_1015310812	126
129	3300006880	Ga0075429_100003771	Ga0075429_10000377114	126
130	3300006880	Ga0075429_100144167	Ga0075429_1001441673	126
131	3300006881	Ga0068865_100724363	Ga0068865_1007243632	126
132	3300006914	Ga0075436_100016551	Ga0075436_1000165514	126
133	3300007076	Ga0075435_100015092	Ga0075435_1000150927	126
134	3300009093	Ga0105240_10827271	Ga0105240_108272712	126
135	3300009093	Ga0105240_11918746	Ga0105240_119187462	126
136	3300009094	Ga0111539_10067790	Ga0111539_100677904	126
137	3300009094	Ga0111539_10139985	Ga0111539_101399852	126
138	3300009094	Ga0111539_10633119	Ga0111539_106331192	126
139	3300009094	Ga0111539_11291928	Ga0111539_112919281	126
140	3300009098	Ga0105245_10282815	Ga0105245_102828153	126
141	3300009098	Ga0105245_11303670	Ga0105245_113036702	126
142	3300009098	Ga0105245_12161039	Ga0105245_121610391	126
143	3300009101	Ga0105247_10690431	Ga0105247_106904312	126
144	3300009101	Ga0105247_11359770	Ga0105247_113597702	126
145	3300009147	Ga0114129_10172794	Ga0114129_101727942	126
146	3300009147	Ga0114129_10523575	Ga0114129_105235753	126
147	3300009147	Ga0114129_10940306	Ga0114129_109403061	126
148	3300009147	Ga0114129_11014885	Ga0114129_110148852	126
149	3300009147	Ga0114129_11210348	Ga0114129_112103482	126
150	3300009147	Ga0114129_11459988	Ga0114129_114599881	126
151	3300009148	Ga0105243_10947682	Ga0105243_109476821	126
152	3300009148	Ga0105243_13015058	Ga0105243_130150581	126
153	3300009176	Ga0105242_10058521	Ga0105242_100585213	126
154	3300009176	Ga0105242_10132581	Ga0105242_101325814	126
155	3300009176	Ga0105242_10469618	Ga0105242_104696182	126
156	3300009177	Ga0105248_12776248	Ga0105248_127762481	126
157	3300009553	Ga0105249_10985439	Ga0105249_109854392	126
158	3300009553	Ga0105249_11242161	Ga0105249_112421612	126
159	3300010375	Ga0105239_10945952	Ga0105239_109459522	126
160	3300010375	Ga0105239_11127530	Ga0105239_111275302	126
161	3300011119	Ga0105246_11097277	Ga0105246_110972771	126
162	3300011119	Ga0105246_11999623	Ga0105246_119996231	126
163	3300012505	Ga0157339_1057237	Ga0157339_10572372	126
164	3300013105	Ga0157369_12026488	Ga0157369_120264881	126
165	3300013297	Ga0157378_10217178	Ga0157378_102171782	126
166	3300013306	Ga0163162_11112234	Ga0163162_111122342	126
167	3300013307	Ga0157372_11378333	Ga0157372_113783331	126
168	3300013307	Ga0157372_13017280	Ga0157372_130172801	126
169	3300013308	Ga0157375_10408266	Ga0157375_104082663	126
170	3300013308	Ga0157375_10625400	Ga0157375_106254002	126
171	3300013308	Ga0157375_11416920	Ga0157375_114169202	126
172	3300013308	Ga0157375_11990981	Ga0157375_119909812	126
173	3300014325	Ga0163163_10748277	Ga0163163_107482772	126
174	3300014326	Ga0157380_13268350	Ga0157380_132683501	126
175	3300014497	Ga0182008_10813576	Ga0182008_108135761	126
176	3300014745	Ga0157377_10515791	Ga0157377_105157912	126
177	3300014968	Ga0157379_10807753	Ga0157379_108077531	126
178	3300014968	Ga0157379_12550529	Ga0157379_125505291	126
179	3300014969	Ga0157376_10446241	Ga0157376_104462412	126
180	3300014969	Ga0157376_11754445	Ga0157376_117544451	126
181	3300020080	Ga0206350_11118772	Ga0206350_111187721	126
182	3300021441	Ga0213871_10059383	Ga0213871_100593832	126
183	3300025907	Ga0207645_10331170	Ga0207645_103311701	126
184	3300025910	Ga0207684_10115078	Ga0207684_101150783	126
185	3300025910	Ga0207684_10216485	Ga0207684_102164852	126
186	3300025912	Ga0207707_10165579	Ga0207707_101655792	126
187	3300025921	Ga0207652_11244636	Ga0207652_112446362	126
188	3300025922	Ga0207646_10297532	Ga0207646_102975322	126
189	3300025922	Ga0207646_11033457	Ga0207646_110334572	126
190	3300025925	Ga0207650_10777028	Ga0207650_107770282	126
191	3300025925	Ga0207650_11317278	Ga0207650_113172781	126
192	3300025927	Ga0207687_10010094	Ga0207687_100100948	126
193	3300025928	Ga0207700_10108174	Ga0207700_101081744	126
194	3300025928	Ga0207700_10485398	Ga0207700_104853982	126
195	3300025929	Ga0207664_11226395	Ga0207664_112263952	126
196	3300025931	Ga0207644_10599471	Ga0207644_105994712	126
197	3300025933	Ga0207706_11260446	Ga0207706_112604462	126
198	3300025934	Ga0207686_10150651	Ga0207686_101506512	126
199	3300025934	Ga0207686_10515748	Ga0207686_105157482	126
200	3300025935	Ga0207709_10405557	Ga0207709_104055572	126
201	3300025937	Ga0207669_11061320	Ga0207669_110613202	126
202	3300025939	Ga0207665_10675793	Ga0207665_106757932	126
203	3300025940	Ga0207691_10057138	Ga0207691_100571383	126
204	3300025940	Ga0207691_10640369	Ga0207691_106403691	126
205	3300025944	Ga0207661_11146014	Ga0207661_111460142	126
206	3300025945	Ga0207679_10331404	Ga0207679_103314042	126
207	3300025945	Ga0207679_10696570	Ga0207679_106965702	126
208	3300025945	Ga0207679_10916137	Ga0207679_109161372	126
209	3300025961	Ga0207712_10526357	Ga0207712_105263572	126
210	3300025981	Ga0207640_10340667	Ga0207640_103406672	126
211	3300026023	Ga0207677_10222117	Ga0207677_102221173	126
212	3300026041	Ga0207639_11706365	Ga0207639_117063651	126
213	3300026075	Ga0207708_10722980	Ga0207708_107229802	126
214	3300026075	Ga0207708_10894474	Ga0207708_108944742	126
215	3300026075	Ga0207708_10896884	Ga0207708_108968842	126
216	3300026116	Ga0207674_10749426	Ga0207674_107494262	126
217	3300026121	Ga0207683_10036380	Ga0207683_100363802	126
218	3300026142	Ga0207698_11314747	Ga0207698_113147472	126
219	3300028380	Ga0268265_10641768	Ga0268265_106417682	126
220	3300028380	Ga0268265_11160951	Ga0268265_111609512	126
221	3300028380	Ga0268265_12375574	Ga0268265_123755741	126
222	3300028381	Ga0268264_10431547	Ga0268264_104315472	126
223	3300028558	Ga0265326_10231029	Ga0265326_102310292	126
224	3300028573	Ga0265334_10210834	Ga0265334_102108341	126
225	3300028577	Ga0265318_10046252	Ga0265318_100462522	126
226	3300028577	Ga0265318_10152159	Ga0265318_101521591	126
227	3300028800	Ga0265338_10063248	Ga0265338_100632483	126
228	3300028800	Ga0265338_10152175	Ga0265338_101521752	126
229	3300028800	Ga0265338_10594526	Ga0265338_105945261	126
230	3300030760	Ga0265762_1044934	Ga0265762_10449342	126
231	3300030878	Ga0265770_1008682	Ga0265770_10086823	126
232	3300030879	Ga0265765_1008327	Ga0265765_10083272	126
233	3300031247	Ga0265340_10203457	Ga0265340_102034572	126
234	3300031251	Ga0265327_10005382	Ga0265327_100053821	126
235	3300031251	Ga0265327_10052177	Ga0265327_100521773	126
236	3300031251	Ga0265327_10133656	Ga0265327_101336562	126
237	3300031251	Ga0265327_10156706	Ga0265327_101567062	126
238	3300031251	Ga0265327_10240732	Ga0265327_102407322	126
239	3300031251	Ga0265327_10250617	Ga0265327_102506171	126
240	3300031711	Ga0265314_10194547	Ga0265314_101945472	126
241	3300031712	Ga0265342_10225977	Ga0265342_102259772	126
242	3300032126	Ga0307415_100805498	Ga0307415_1008054981	126
243	3300035116	Ga0373945_0139032	Ga0373945_0139032_520_903	126
244	3300035116	Ga0373945_0414269	Ga0373945_0414269_161_544	126
245	3300035170	Ga0373943_0449747	Ga0373943_0449747_128_511	126
246	3300035170	Ga0373943_0582682	Ga0373943_0582682_132_515	126
247	3300035172	Ga0373955_0452954	Ga0373955_0452954_61_444	126
248	3300035692	Ga0373935_0161909	Ga0373935_0161909_1031_1420	126
249	3300035725	Ga0373947_0121699	Ga0373947_0121699_947_1330	126
250	3300036401	Ga0373937_1424262	Ga0373937_1424262_193_573	126
251	3300037068	Ga0373925_0440087	Ga0373925_0440087_340_729	126
252	3300039437	Ga0436365_1292120	Ga0436365_1292120_367_750	126
253	3300039437	Ga0436365_1601787	Ga0436365_1601787_2860_3243	126
254	3300039438	Ga0436360_0253991	Ga0436360_0253991_374_757	126
255	3300039438	Ga0436360_0962140	Ga0436360_0962140_932_1312	126
256	3300039447	Ga0436361_0076905	Ga0436361_0076905_366_749	126
257	3300039447	Ga0436361_1033142	Ga0436361_1033142_642_1022	126
258	3300039450	Ga0436363_0628680	Ga0436363_0628680_23_406	126
259	3300039450	Ga0436363_0770541	Ga0436363_0770541_244_627	126
260	3300039450	Ga0436363_1228645	Ga0436363_1228645_282_662	126
261	3300039453	Ga0436362_1268431	Ga0436362_1268431_19_399	126
262	3300041452	Ga0451793_0101112	Ga0451793_0101112_15_395	126
263	3300041456	Ga0451795_0819431	Ga0451795_0819431_135_515	126
264	3300041460	Ga0451802_0471874	Ga0451802_0471874_75_455	126
265	3300041463	Ga0451804_1140514	Ga0451804_1140514_263_643	126
266	3300041486	Ga0451807_1193890	Ga0451807_1193890_102_482	126
267	3300041496	Ga0451839_1560335	Ga0451839_1560335_101_481	126
268	3300041511	Ga0451855_0632374	Ga0451855_0632374_56_436	126
269	3300041512	Ga0451853_3848491	Ga0451853_3848491_188_568	126
270	3300044684	Ga0466966_0835753	Ga0466966_0835753_94_477	126
271	3300045976	Ga0466967_0428108	Ga0466967_0428108_258_641	126
272	3300045976	Ga0466967_2234959	Ga0466967_2234959_51_434	126
273	3300046455	Ga0495603_0230752	Ga0495603_0230752_390_773	126
274	3300046455	Ga0495603_0279880	Ga0495603_0279880_369_749	126
275	3300046459	Ga0495629_0276620	Ga0495629_0276620_444_824	126
276	3300046461	Ga0495641_0118320	Ga0495641_0118320_596_979	126
277	3300046462	Ga0495651_0329242	Ga0495651_0329242_41_421	126
278	3300046462	Ga0495651_0333620	Ga0495651_0333620_128_511	126
279	3300046462	Ga0495651_0961197	Ga0495651_0961197_34_414	126
280	3300046463	Ga0495653_0125221	Ga0495653_0125221_442_825	126
281	3300046463	Ga0495653_0227669	Ga0495653_0227669_73_462	126
282	3300046472	Ga0495580_0115572	Ga0495580_0115572_1198_1581	126
283	3300046475	Ga0495639_0386200	Ga0495639_0386200_147_527	126
284	3300046475	Ga0495639_0460056	Ga0495639_0460056_201_584	126
285	3300046475	Ga0495639_0641691	Ga0495639_0641691_77_460	126
286	3300046511	Ga0495608_0588424	Ga0495608_0588424_257_640	126
287	3300046511	Ga0495608_0760247	Ga0495608_0760247_15_398	126
288	3300046516	Ga0495628_0883556	Ga0495628_0883556_108_491	126
289	3300046517	Ga0495630_0094195	Ga0495630_0094195_92_475	126
290	3300046517	Ga0495630_0148022	Ga0495630_0148022_295_675	126
291	3300046517	Ga0495630_0161700	Ga0495630_0161700_208_591	126
292	3300046517	Ga0495630_0285630	Ga0495630_0285630_653_1042	126
293	3300046517	Ga0495630_0422220	Ga0495630_0422220_255_638	126
294	3300046529	Ga0495652_0379353	Ga0495652_0379353_490_873	126
295	3300046529	Ga0495652_0897762	Ga0495652_0897762_44_427	126
296	3300046533	Ga0495640_0522365	Ga0495640_0522365_326_706	126
297	3300046533	Ga0495640_0563521	Ga0495640_0563521_137_517	126
298	3300046535	Ga0495586_0569132	Ga0495586_0569132_216_605	126
299	3300046559	Ga0495667_0365364	Ga0495667_0365364_277_657	126
300	3300046559	Ga0495667_0424804	Ga0495667_0424804_364_744	126
301	3300046559	Ga0495667_0663734	Ga0495667_0663734_151_540	126
302	3300046615	Ga0495656_0108462	Ga0495656_0108462_709_1092	126
303	3300046642	Ga0495634_0199133	Ga0495634_0199133_573_962	126
304	3300046674	Ga0495588_0213072	Ga0495588_0213072_244_627	126
305	3300046675	Ga0495657_0175392	Ga0495657_0175392_75_458	126
306	3300046675	Ga0495657_0313732	Ga0495657_0313732_484_897	126
307	3300046675	Ga0495657_0475343	Ga0495657_0475343_292_675	126
308	3300046681	Ga0495647_0130792	Ga0495647_0130792_189_572	126
309	3300046681	Ga0495647_0424077	Ga0495647_0424077_216_599	126
310	3300046683	Ga0495658_0064979	Ga0495658_0064979_1089_1472	126
311	3300046690	Ga0495624_0657707	Ga0495624_0657707_23_403	126
312	3300047321	Ga0495676_0069711	Ga0495676_0069711_15_398	126
313	3300047321	Ga0495676_0190403	Ga0495676_0190403_341_724	126
314	3300047321	Ga0495676_0254018	Ga0495676_0254018_358_741	126
315	3300047322	Ga0495680_0230516	Ga0495680_0230516_472_852	126
316	3300047471	Ga0495684_0277010	Ga0495684_0277010_749_1138	126
317	3300047472	Ga0495686_0162740	Ga0495686_0162740_568_951	126
318	3300048088	Ga0495602_0825901	Ga0495602_0825901_178_567	126
319	3300048903	Ga0496100_1284026	Ga0496100_1284026_144_533	126
320	3300048905	Ga0496102_0642861	Ga0496102_0642861_239_661	126
321	3300048905	Ga0496102_1262488	Ga0496102_1262488_244_627	126
322	3300048907	Ga0496104_0825814	Ga0496104_0825814_245_634	126
323	3300048908	Ga0496105_1127222	Ga0496105_1127222_139_522	126
324	3300048911	Ga0496108_0494196	Ga0496108_0494196_187_570	126
325	3300048911	Ga0496108_0646817	Ga0496108_0646817_231_611	126
326	3300048911	Ga0496108_1013558	Ga0496108_1013558_225_608	126
327	3300048912	Ga0496109_0360242	Ga0496109_0360242_853_1236	126
328	3300048912	Ga0496109_0642916	Ga0496109_0642916_319_702	126
329	3300048912	Ga0496109_0896401	Ga0496109_0896401_406_786	126
330	3300048913	Ga0496110_0107545	Ga0496110_0107545_1310_1690	126
331	3300048913	Ga0496110_0866141	Ga0496110_0866141_248_631	126
332	3300048913	Ga0496110_0920211	Ga0496110_0920211_380_763	126
333	3300048915	Ga0496112_0107620	Ga0496112_0107620_2005_2388	126
334	3300048915	Ga0496112_0231605	Ga0496112_0231605_1015_1398	126
335	3300048915	Ga0496112_1009508	Ga0496112_1009508_158_538	126
336	3300048915	Ga0496112_1716527	Ga0496112_1716527_146_529	126
337	3300048916	Ga0496113_0713533	Ga0496113_0713533_247_630	126
338	3300048916	Ga0496113_0738376	Ga0496113_0738376_169_549	126
339	3300048917	Ga0496114_0339734	Ga0496114_0339734_122_502	126
340	3300048917	Ga0496114_0476288	Ga0496114_0476288_262_651	126
341	3300048917	Ga0496114_0869515	Ga0496114_0869515_130_519	126
342	3300048918	Ga0496115_0106125	Ga0496115_0106125_17_400	126
343	3300048918	Ga0496115_0421140	Ga0496115_0421140_181_564	126
344	3300048918	Ga0496115_0480881	Ga0496115_0480881_358_741	126
345	3300048918	Ga0496115_1045141	Ga0496115_1045141_124_513	126
346	3300048929	Ga0496126_0012365	Ga0496126_0012365_6552_6941	126
347	3300049572	Ga0501036_0303976	Ga0501036_0303976_802_1182	126
348	3300049572	Ga0501036_1746959	Ga0501036_1746959_53_436	126
349	3300049573	Ga0501037_0756228	Ga0501037_0756228_25_405	126
350	3300049576	Ga0501040_0390621	Ga0501040_0390621_55_438	126
351	3300049579	Ga0501043_0416996	Ga0501043_0416996_434_814	126
352	3300049584	Ga0501068_0035442	Ga0501068_0035442_1995_2378	126
353	3300049585	Ga0501069_0152561	Ga0501069_0152561_520_903	126
354	3300049586	Ga0501070_0040292	Ga0501070_0040292_2852_3232	126
355	3300049586	Ga0501070_0432038	Ga0501070_0432038_493_873	126
356	3300049588	Ga0501072_0400344	Ga0501072_0400344_311_694	126
357	3300049588	Ga0501072_0585095	Ga0501072_0585095_304_735	126
358	3300049591	Ga0501075_0853519	Ga0501075_0853519_23_406	126
359	3300049593	Ga0501077_0723565	Ga0501077_0723565_11_394	126
360	3300049741	Ga0501079_0975610	Ga0501079_0975610_19_402	126
361	3300049742	Ga0501080_0215477	Ga0501080_0215477_378_758	126
362	3300049743	Ga0501081_0854116	Ga0501081_0854116_139_522	126
363	3300049823	Ga0501044_0936180	Ga0501044_0936180_100_480	126
364	3300049824	Ga0501045_0840630	Ga0501045_0840630_91_474	126
365	3300050490	nmdc:mga03n38_30897_c1	nmdc:mga03n38_30897_c1_1014_1397	126
366	3300050507	nmdc:mga05p37_1140584_c1	nmdc:mga05p37_1140584_c1_315_698	126
367	3300050507	nmdc:mga05p37_138539_c2	nmdc:mga05p37_138539_c2_21_404	126
368	3300050507	nmdc:mga05p37_1414368_c1	nmdc:mga05p37_1414368_c1_190_603	126
369	3300050507	nmdc:mga05p37_62843_c1	nmdc:mga05p37_62843_c1_3105_3488	126
370	3300050507	nmdc:mga05p37_80385_c1	nmdc:mga05p37_80385_c1_2252_2635	126
371	3300050507	nmdc:mga05p37_844436_c1	nmdc:mga05p37_844436_c1_229_609	126
372	3300050508	nmdc:mga09592_24734_c1	nmdc:mga09592_24734_c1_1509_1892	126
373	3300050508	nmdc:mga09592_280072_c1	nmdc:mga09592_280072_c1_1026_1406	126
374	3300050508	nmdc:mga09592_895804_c1	nmdc:mga09592_895804_c1_215_598	126
375	3300050509	nmdc:mga0qj67_97087_c1	nmdc:mga0qj67_97087_c1_1139_1522	126
376	3300050510	nmdc:mga06r32_157704_c1	nmdc:mga06r32_157704_c1_1063_1446	126
377	3300050510	nmdc:mga06r32_173588_c1	nmdc:mga06r32_173588_c1_1162_1545	126
378	3300050510	nmdc:mga06r32_19729_c1	nmdc:mga06r32_19729_c1_3046_3429	126
379	3300050511	nmdc:mga08y16_170114_c1	nmdc:mga08y16_170114_c1_249_632	126
380	3300050511	nmdc:mga08y16_55028_c1	nmdc:mga08y16_55028_c1_65_445	126
381	3300050512	nmdc:mga0n895_44897_c1	nmdc:mga0n895_44897_c1_1977_2360	126
382	3300050513	nmdc:mga0rr50_533274_c1	nmdc:mga0rr50_533274_c1_496_879	126
383	3300050513	nmdc:mga0rr50_58803_c1	nmdc:mga0rr50_58803_c1_447_830	126
384	3300050514	nmdc:mga08x19_18919_c1	nmdc:mga08x19_18919_c1_1923_2306	126
385	3300050515	nmdc:mga0a205_90298_c1	nmdc:mga0a205_90298_c1_1382_1765	126
386	3300053077	Ga0495601_0105068	Ga0495601_0105068_707_1120	126
387	3300053077	Ga0495601_0136208	Ga0495601_0136208_775_1158	126
388	3300053077	Ga0495601_0297959	Ga0495601_0297959_41_430	126
389	3300053078	Ga0495612_0325176	Ga0495612_0325176_78_467	126
390	3300053078	Ga0495612_0354362	Ga0495612_0354362_92_472	126
391	3300053084	Ga0495595_0450414	Ga0495595_0450414_244_633	126
392	3300053085	Ga0495619_0051224	Ga0495619_0051224_779_1192	126
393	3300053085	Ga0495619_0331943	Ga0495619_0331943_433_822	126
394	3300053085	Ga0495619_0366543	Ga0495619_0366543_519_899	126
395	3300053085	Ga0495619_0440819	Ga0495619_0440819_47_430	126
396	3300053085	Ga0495619_0518489	Ga0495619_0518489_346_735	126
397	3300053094	Ga0500566_0176714	Ga0500566_0176714_180_560	126
398	3300053153	Ga0500616_0004886	Ga0500616_0004886_7643_8026	126
399	3300054114	Ga0501084_0000062	Ga0501084_0000062_52717_53148	126
400	3300060353	Ga0501082_0199283	Ga0501082_0199283_421_804	126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02311

AraC_binding

AraC-like ligand binding domain

53

120

0.91 PF05899

Cupin_3

EutQ-like cupin domain

45

99

0.88 PF07883

Cupin_2

Cupin domain

43

112

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8ch4-assembly1.cif.gz_C	crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp.	0.967	42	112
5wpw-assembly1.cif.gz_B	crystal structure of coconut allergen cocosin	0.9596	42	112
6b4s-assembly1.cif.gz_A	crystal structure of brazil nut (bertholletia excelsa) allergen ber e 2	0.9556	42	112
3nst-assembly1.cif.gz_A	crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans	0.9551	42	112
3ehk-assembly1.cif.gz_A	crystal structure of pru du amandin, an allergenic protein from prunus dulcis	0.9541	42	112

ID	Description	Score	Start	End	Superfamily
af_Q9USR9_537_626_2.60.120.10	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.9622	42	112	2.60.120.10
5wpwB01	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.9596	42	112	2.60.120.10
af_Q9FEC5_21_286_2.60.120.10	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.9594	42	112	2.60.120.10
5wxuF01	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.9515	42	112	2.60.120.10
3fz3F01	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.9496	42	112	2.60.120.10

ID	Description	Score	Start	End
AF-R0K925-F1-model_v4	Cupin type-2 domain-containing protein	0.9882	42	113
AF-A0A2B7Y1J8-F1-model_v4	Cupin type-2 domain-containing protein	0.9856	42	113
AF-A0A2U1F7X5-F1-model_v4	Cupin type-2 domain-containing protein	0.9855	42	112
AF-A0A163CE11-F1-model_v4	Uncharacterized protein	0.9852	42	113
AF-A0A0F4YT75-F1-model_v4	Cupin domain-containing protein	0.9839	42	113

Feature Viewer

pLDDT	pTM	Quality
95.49	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F434663

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02311

AraC_binding

AraC-like ligand binding domain

53

120

0.91

PF05899

Cupin_3

EutQ-like cupin domain

45

99

0.88

PF07883

Cupin_2

Cupin domain

43

112

0.86

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map