F434567

General Info

Members Datasets Scaffolds Average Seq Length
400 193 800 295

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10820483|Ga0114129_108204831
Length 343
Sequence VSAVANEPLVEIEHLTKVFPIKTGSGLGRAKSHLSAVDDVSLTISRGETLGLVGESGSGKTTLARLTLRLLPLTSGAIKIGGVDVHAADRRTLRKLRRFVQIVFQDPFSSLDPRMSVGAIVAEGLQELGRAERERKVGELLSHVGLPSGFARRHPHQLSGGQRQRVGIARALAVGPQFLVLDEPVSALDVSVQSQVLNLLRDLQQELRLTYLFISHDLTVVRHLADRIAVMYLGKLVELAPADEIFERPRHPYTEALLSAMPSITGERRERIILSGDIPSPIDPPEQCRFASRCFRQVEPCWAEVPPLERLAAGHDAACFNPMPPPAGSAVTTAGSGGVNGES

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
123 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
129 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
134 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
140 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
141 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
142 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.25
Nodule 0
Rhizoplane 2.25
Rhizosphere 92.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10820483 3300009147 Bacteria 1185
2 JGI25406J46586_10006331 3300003203 Bacteria 5460
3 Ga0065712_10004652 3300005290 Bacteria 4746
4 Ga0065712_10169265 3300005290 Bacteria 1253
5 Ga0065712_10187361 3300005290 Bacteria 1164
6 Ga0065715_10025224 3300005293 Bacteria 2146
7 Ga0065707_10000808 3300005295 Bacteria 15027
8 Ga0065707_10090700 3300005295 Bacteria 4078
9 Ga0065707_10178173 3300005295 Bacteria 1430
10 Ga0065707_10261819 3300005295 Bacteria 1095
11 Ga0065707_10287512 3300005295 Bacteria 1033
12 Ga0070690_100101861 3300005330 Bacteria 1905
13 Ga0068868_100220438 3300005338 Bacteria 1588
14 Ga0068868_100254088 3300005338 Bacteria 1480
15 Ga0070689_100018726 3300005340 Bacteria 5106
16 Ga0070689_100030582 3300005340 Bacteria 4088
17 Ga0070687_100012413 3300005343 Bacteria 3763
18 Ga0070661_100090879 3300005344 Bacteria 2261
19 Ga0070675_100000261 3300005354 Bacteria 34623
20 Ga0070675_100088829 3300005354 Bacteria 2587
21 Ga0070675_100298900 3300005354 Bacteria 1418
22 Ga0070675_100409621 3300005354 Bacteria 1211
23 Ga0070671_100045728 3300005355 Bacteria 3639
24 Ga0070674_100048289 3300005356 Bacteria 2921
25 Ga0070674_100226942 3300005356 Bacteria 1456
26 Ga0070674_100373014 3300005356 Bacteria 1159
27 Ga0070673_100024516 3300005364 Bacteria 4425
28 Ga0070673_100052369 3300005364 Bacteria 3202
29 Ga0070673_100226941 3300005364 Bacteria 1619
30 Ga0070688_100018601 3300005365 Bacteria 4012
31 Ga0070659_100237566 3300005366 Bacteria 1507
32 Ga0070659_100319040 3300005366 Bacteria 1299
33 Ga0070701_10001756 3300005438 Bacteria 8167
34 Ga0070701_10050585 3300005438 Bacteria 2152
35 Ga0070701_10074103 3300005438 Bacteria 1827
36 Ga0070705_100001090 3300005440 Bacteria 15074
37 Ga0070705_100031209 3300005440 Bacteria 2948
38 Ga0070705_100160599 3300005440 Bacteria 1502
39 Ga0070700_100010832 3300005441 Bacteria 5039
40 Ga0070700_100138370 3300005441 Bacteria 1652
41 Ga0070694_100000166 3300005444 Bacteria 34112
42 Ga0070694_100000439 3300005444 Bacteria 22673
43 Ga0070694_100374067 3300005444 Bacteria 1109
44 Ga0070708_100132562 3300005445 Bacteria 2307
45 Ga0070663_100232270 3300005455 Bacteria 1453
46 Ga0070678_100242068 3300005456 Bacteria 1509
47 Ga0070678_100400233 3300005456 Bacteria 1193
48 Ga0070681_10441651 3300005458 Bacteria 1213
49 Ga0068867_100013197 3300005459 Bacteria 5852
50 Ga0068867_100026390 3300005459 Bacteria 4171
51 Ga0070706_100049046 3300005467 Bacteria 3897
52 Ga0070707_100118118 3300005468 Bacteria 2574
53 Ga0070707_100339757 3300005468 Bacteria 1459
54 Ga0070698_100085275 3300005471 Bacteria 3146
55 Ga0070698_100129078 3300005471 Bacteria 2484
56 Ga0070698_100241176 3300005471 Bacteria 1741
57 Ga0070699_100014671 3300005518 Bacteria 6738
58 Ga0070699_100017098 3300005518 Bacteria 6229
59 Ga0070699_100340214 3300005518 Bacteria 1350
60 Ga0070684_100076843 3300005535 Bacteria 2948
61 Ga0070672_100003032 3300005543 Bacteria 10821
62 Ga0070672_100015700 3300005543 Bacteria 5405
63 Ga0070672_100393968 3300005543 Bacteria 1186
64 Ga0070695_100000038 3300005545 Bacteria 49915
65 Ga0070695_100038865 3300005545 Bacteria 3006
66 Ga0070695_100127171 3300005545 Bacteria 1751
67 Ga0070695_100262878 3300005545 Bacteria 1261
68 Ga0070696_100000416 3300005546 Bacteria 26618
69 Ga0070696_100008944 3300005546 Bacteria 6701
70 Ga0070693_100020632 3300005547 Bacteria 3479
71 Ga0070704_100000369 3300005549 Bacteria 20502
72 Ga0070704_100014591 3300005549 Bacteria 4909
73 Ga0068855_100394833 3300005563 Bacteria 1517
74 Ga0070664_100191337 3300005564 Bacteria 1823
75 Ga0070664_100285588 3300005564 Bacteria 1489
76 Ga0070664_100348140 3300005564 Bacteria 1347
77 Ga0070664_100411852 3300005564 Bacteria 1237
78 Ga0068857_100027453 3300005577 Bacteria 5022
79 Ga0068857_100037454 3300005577 Bacteria 4297
80 Ga0068859_100041381 3300005617 Bacteria 4628
81 Ga0068859_100121272 3300005617 Bacteria 2681
82 Ga0068859_100147277 3300005617 Bacteria 2430
83 Ga0068859_100483637 3300005617 Bacteria 1333
84 Ga0068859_100868172 3300005617 Bacteria 988
85 Ga0068864_100043813 3300005618 Bacteria 3833
86 Ga0068864_100110461 3300005618 Bacteria 2448
87 Ga0068864_100454937 3300005618 Bacteria 1225
88 Ga0068864_100556858 3300005618 Bacteria 1109
89 Ga0068861_100124889 3300005719 Bacteria 2081
90 Ga0068861_100155478 3300005719 Bacteria 1881
91 Ga0068861_100522526 3300005719 Bacteria 1077
92 Ga0068870_10005506 3300005840 Bacteria 5530
93 Ga0068858_100128674 3300005842 Bacteria 2373
94 Ga0068858_100181473 3300005842 Bacteria 1988
95 Ga0068858_100288008 3300005842 Bacteria 1565
96 Ga0068860_100036044 3300005843 Bacteria 4741
97 Ga0068860_100193332 3300005843 Bacteria 1969
98 Ga0068862_100000963 3300005844 Bacteria 27681
99 Ga0068862_100340403 3300005844 Bacteria 1389
100 Ga0081539_10000974 3300005985 Bacteria 53499
101 Ga0075368_10003179 3300006042 Bacteria 5460
102 Ga0075368_10032729 3300006042 Bacteria 2021
103 Ga0075364_10002058 3300006051 Bacteria 11227
104 Ga0075364_10062127 3300006051 Bacteria 2451
105 Ga0075432_10061885 3300006058 Bacteria 1334
106 Ga0075362_10000109 3300006177 Bacteria 22879
107 Ga0075367_10007567 3300006178 Bacteria 5571
108 Ga0075367_10011558 3300006178 Bacteria 4678
109 Ga0075367_10025757 3300006178 Bacteria 3329
110 Ga0075367_10185344 3300006178 Bacteria 1298
111 Ga0075366_10003937 3300006195 Bacteria 7920
112 Ga0075366_10017371 3300006195 Bacteria 4141
113 Ga0075366_10121342 3300006195 Bacteria 1575
114 Ga0075366_10121489 3300006195 Bacteria 1574
115 Ga0075370_10031139 3300006353 Bacteria 2978
116 Ga0068871_100466720 3300006358 Bacteria 1134
117 Ga0068871_100521028 3300006358 Bacteria 1074
118 Ga0075428_100007918 3300006844 Bacteria 11780
119 Ga0075428_100010751 3300006844 Bacteria 10172
120 Ga0075428_100078313 3300006844 Bacteria 3608
121 Ga0075428_100094599 3300006844 Bacteria 3258
122 Ga0075428_100173288 3300006844 Bacteria 2338
123 Ga0075428_100454562 3300006844 Bacteria 1372
124 Ga0075430_100187668 3300006846 Bacteria 1719
125 Ga0075430_100301616 3300006846 Bacteria 1325
126 Ga0075431_100009385 3300006847 Bacteria 9822
127 Ga0075431_100018975 3300006847 Bacteria 7006
128 Ga0075431_100234884 3300006847 Bacteria 1867
129 Ga0075433_10077963 3300006852 Bacteria 2919
130 Ga0075433_10088203 3300006852 Bacteria 2741
131 Ga0075433_10450791 3300006852 Bacteria 1134
132 Ga0075434_100000831 3300006871 Bacteria 24539
133 Ga0075434_100024320 3300006871 Bacteria 5921
134 Ga0075434_100026014 3300006871 Bacteria 5730
135 Ga0075434_100031783 3300006871 Bacteria 5205
136 Ga0075434_100158707 3300006871 Bacteria 2282
137 Ga0075429_100012557 3300006880 Bacteria 7349
138 Ga0075429_100060969 3300006880 Bacteria 3285
139 Ga0075429_100088335 3300006880 Bacteria 2702
140 Ga0075429_100354488 3300006880 Bacteria 1285
141 Ga0075429_100468598 3300006880 Bacteria 1104
142 Ga0097620_100041380 3300006931 Bacteria 4628
143 Ga0097620_100121271 3300006931 Bacteria 2681
144 Ga0097620_100147268 3300006931 Bacteria 2430
145 Ga0097620_100483633 3300006931 Bacteria 1333
146 Ga0097620_100868203 3300006931 Bacteria 988
147 Ga0075435_100001617 3300007076 Bacteria 14572
148 Ga0075435_100009522 3300007076 Bacteria 7040
149 Ga0075435_100057809 3300007076 Bacteria 3138
150 Ga0075435_100097810 3300007076 Bacteria 2429
151 Ga0075435_100121725 3300007076 Bacteria 2178
152 Ga0111539_10000080 3300009094 Bacteria 97114
153 Ga0111539_10001145 3300009094 Bacteria 35041
154 Ga0111539_10017893 3300009094 Bacteria 8778
155 Ga0111539_10027507 3300009094 Bacteria 6947
156 Ga0111539_10453034 3300009094 Bacteria 1494
157 Ga0105245_10022899 3300009098 Bacteria 5481
158 Ga0105247_10153844 3300009101 Bacteria 1517
159 Ga0114129_10001026 3300009147 Bacteria 36462
160 Ga0114129_10006969 3300009147 Bacteria 16081
161 Ga0114129_10015063 3300009147 Bacteria 11007
162 Ga0114129_10020753 3300009147 Bacteria 9336
163 Ga0114129_10029895 3300009147 Bacteria 7714
164 Ga0114129_10052462 3300009147 Bacteria 5723
165 Ga0114129_10105096 3300009147 Bacteria 3903
166 Ga0114129_10120429 3300009147 Bacteria 3613
167 Ga0114129_10121509 3300009147 Bacteria 3594
168 Ga0114129_10162188 3300009147 Bacteria 3053
169 Ga0114129_10184732 3300009147 Bacteria 2834
170 Ga0114129_10270689 3300009147 Bacteria 2272
171 Ga0114129_11119394 3300009147 Bacteria 985
172 Ga0105243_10351863 3300009148 Bacteria 1353
173 Ga0105241_10117670 3300009174 Bacteria 2136
174 Ga0105248_10122021 3300009177 Bacteria 2939
175 Ga0105248_10343292 3300009177 Bacteria 1681
176 Ga0105248_10355971 3300009177 Bacteria 1648
177 Ga0105249_10004488 3300009553 Bacteria 12066
178 Ga0105249_10446557 3300009553 Bacteria 1331
179 Ga0105239_10258090 3300010375 Bacteria 1958
180 Ga0105239_10433913 3300010375 Bacteria 1489
181 Ga0105246_10253942 3300011119 Bacteria 1397
182 Ga0157374_10448152 3300013296 Bacteria 1292
183 Ga0157378_10065473 3300013297 Bacteria 3253
184 Ga0163162_10601833 3300013306 Bacteria 1225
185 Ga0157375_10004182 3300013308 Bacteria 12526
186 Ga0157375_10235160 3300013308 Bacteria 1991
187 Ga0157375_10590519 3300013308 Bacteria 1270
188 Ga0163163_10011017 3300014325 Bacteria 8176
189 Ga0157380_10089925 3300014326 Bacteria 2531
190 Ga0157377_10096459 3300014745 Bacteria 1754
191 Ga0157379_10287488 3300014968 Bacteria 1497
192 Ga0207697_10007693 3300025315 Bacteria 4777
193 Ga0207642_10154058 3300025899 Bacteria 1227
194 Ga0207710_10079704 3300025900 Bacteria 1517
195 Ga0207688_10010448 3300025901 Bacteria 5053
196 Ga0207688_10052487 3300025901 Bacteria 2285
197 Ga0207680_10089870 3300025903 Bacteria 1951
198 Ga0207680_10172472 3300025903 Bacteria 1458
199 Ga0207647_10151050 3300025904 Bacteria 1358
200 Ga0207645_10011920 3300025907 Bacteria 5916
201 Ga0207645_10080023 3300025907 Bacteria 2094
202 Ga0207643_10007482 3300025908 Bacteria 5864
203 Ga0207643_10029839 3300025908 Bacteria 3034
204 Ga0207654_10102594 3300025911 Bacteria 1765
205 Ga0207707_10351266 3300025912 Bacteria 1270
206 Ga0207660_10121421 3300025917 Bacteria 1979
207 Ga0207662_10018369 3300025918 Bacteria 3967
208 Ga0207662_10021421 3300025918 Bacteria 3694
209 Ga0207657_10184136 3300025919 Bacteria 1687
210 Ga0207649_10050442 3300025920 Bacteria 2574
211 Ga0207646_10097901 3300025922 Bacteria 2628
212 Ga0207646_10141957 3300025922 Bacteria 2163
213 Ga0207646_10290580 3300025922 Bacteria 1477
214 Ga0207681_10001379 3300025923 Bacteria 15691
215 Ga0207681_10040729 3300025923 Bacteria 3093
216 Ga0207650_10014370 3300025925 Bacteria 5504
217 Ga0207650_10027312 3300025925 Bacteria 4085
218 Ga0207659_10022574 3300025926 Bacteria 4191
219 Ga0207659_10083097 3300025926 Bacteria 2373
220 Ga0207659_10117999 3300025926 Bacteria 2029
221 Ga0207659_10274430 3300025926 Bacteria 1376
222 Ga0207687_10234520 3300025927 Bacteria 1451
223 Ga0207690_10108937 3300025932 Bacteria 1992
224 Ga0207690_10262568 3300025932 Bacteria 1338
225 Ga0207686_10254004 3300025934 Bacteria 1286
226 Ga0207670_10020082 3300025936 Bacteria 4096
227 Ga0207670_10033776 3300025936 Bacteria 3299
228 Ga0207704_10178194 3300025938 Bacteria 1533
229 Ga0207691_10003857 3300025940 Bacteria 14550
230 Ga0207691_10014058 3300025940 Bacteria 7638
231 Ga0207691_10447579 3300025940 Bacteria 1099
232 Ga0207661_10067843 3300025944 Bacteria 2902
233 Ga0207679_10173589 3300025945 Bacteria 1777
234 Ga0207679_10208739 3300025945 Bacteria 1636
235 Ga0207679_10318150 3300025945 Bacteria 1347
236 Ga0207679_10361091 3300025945 Bacteria 1269
237 Ga0207651_10243736 3300025960 Bacteria 1466
238 Ga0207712_10004081 3300025961 Bacteria 9212
239 Ga0207640_10314613 3300025981 Bacteria 1244
240 Ga0207677_10207629 3300026023 Bacteria 1561
241 Ga0207677_10229012 3300026023 Bacteria 1496
242 Ga0207677_10232858 3300026023 Bacteria 1485
243 Ga0207703_10087888 3300026035 Bacteria 2607
244 Ga0207703_10260318 3300026035 Bacteria 1568
245 Ga0207678_10063748 3300026067 Bacteria 3167
246 Ga0207708_10022265 3300026075 Bacteria 4785
247 Ga0207708_10025430 3300026075 Bacteria 4478
248 Ga0207708_10118124 3300026075 Bacteria 2064
249 Ga0207648_10000992 3300026089 Bacteria 32023
250 Ga0207648_10039982 3300026089 Bacteria 4122
251 Ga0207648_10162248 3300026089 Bacteria 1974
252 Ga0207648_10204118 3300026089 Bacteria 1754
253 Ga0207676_10172457 3300026095 Bacteria 1886
254 Ga0207676_10266120 3300026095 Bacteria 1550
255 Ga0207676_10418969 3300026095 Bacteria 1255
256 Ga0207674_10024160 3300026116 Bacteria 6498
257 Ga0207674_10072084 3300026116 Bacteria 3470
258 Ga0207674_10361446 3300026116 Bacteria 1403
259 Ga0207675_100059044 3300026118 Bacteria 3580
260 Ga0207675_100087493 3300026118 Bacteria 2926
261 Ga0207675_100192210 3300026118 Bacteria 1958
262 Ga0207675_100538092 3300026118 Bacteria 1166
263 Ga0207683_10058481 3300026121 Bacteria 3385
264 Ga0207683_10172955 3300026121 Bacteria 1957
265 Ga0207683_10582935 3300026121 Bacteria 1035
266 Ga0207428_10001248 3300027907 Bacteria 27269
267 Ga0207428_10001608 3300027907 Bacteria 23460
268 Ga0207428_10002448 3300027907 Bacteria 18540
269 Ga0207428_10068264 3300027907 Bacteria 2797
270 Ga0207428_10126253 3300027907 Bacteria 1959
271 Ga0268266_10012207 3300028379 Bacteria 7433
272 Ga0268265_10000873 3300028380 Bacteria 28282
273 Ga0268265_10375374 3300028380 Bacteria 1306
274 Ga0268264_10547720 3300028381 Bacteria 1134
275 Ga0316576_10001328 3300031727 Bacteria 13138
276 Ga0316576_10003140 3300031727 Bacteria 9630
277 Ga0316578_10021735 3300031728 Bacteria 3565
278 Ga0307410_10231308 3300031852 Bacteria 1427
279 Ga0307409_100003152 3300031995 Bacteria 8864
280 Ga0307416_100829122 3300032002 Bacteria 1022
281 Ga0307411_10049696 3300032005 Bacteria 2727
282 Ga0307411_10246275 3300032005 Bacteria 1403
283 Ga0373932_0042758 3300035112 Bacteria 1315
284 Ga0316574_0014906 3300035398 Bacteria 4502
285 Ga0373935_0028080 3300035692 Bacteria 3477
286 Ga0316584_0002483 3300036712 Bacteria 11678
287 Ga0316584_0123587 3300036712 Bacteria 1933
288 Ga0395898_0176238 3300037466 Bacteria 2044
289 Ga0450923_025521 3300042125 Bacteria 1179
290 Ga0439464_0086942 3300042439 Bacteria 939
291 Ga0451576_0005569 3300045051 Bacteria 15735
292 Ga0451576_0023567 3300045051 Bacteria 6663
293 Ga0451576_0156290 3300045051 Bacteria 2379
294 Ga0451576_0179761 3300045051 Bacteria 2209
295 Ga0451576_0211944 3300045051 Bacteria 2023
296 Ga0495603_0042271 3300046455 Bacteria 2725
297 Ga0495603_0165206 3300046455 Bacteria 1283
298 Ga0495585_0091770 3300046492 Bacteria 1635
299 Ga0495630_0235070 3300046517 Bacteria 1400
300 Ga0495644_0126870 3300046523 Bacteria 972
301 Ga0495642_0003029 3300046528 Bacteria 6695
302 Ga0495642_0034662 3300046528 Bacteria 2034
303 Ga0495598_0045984 3300046537 Bacteria 1296
304 Ga0495609_0052156 3300046538 Bacteria 1820
305 Ga0495621_0021874 3300046539 Bacteria 2113
306 Ga0495621_0056011 3300046539 Bacteria 1420
307 Ga0495622_0036805 3300046557 Bacteria 2281
308 Ga0495656_0028413 3300046615 Bacteria 2243
309 Ga0495634_0046207 3300046642 Bacteria 2940
310 Ga0495588_0026265 3300046674 Bacteria 2906
311 Ga0495658_0020847 3300046683 Bacteria 3448
312 Ga0495658_0137351 3300046683 Bacteria 1493
313 Ga0495658_0167682 3300046683 Bacteria 1357
314 Ga0495669_0010075 3300046684 Bacteria 3992
315 Ga0495669_0151235 3300046684 Bacteria 1099
316 Ga0495613_0066296 3300046689 Bacteria 2637
317 Ga0495670_0150156 3300046691 Bacteria 1222
318 Ga0495636_0026762 3300047318 Bacteria 2347
319 Ga0495636_0033611 3300047318 Bacteria 2108
320 Ga0495676_0109968 3300047321 Bacteria 2024
321 Ga0495677_0059047 3300047445 Bacteria 1420
322 Ga0496104_0215785 3300048907 Bacteria 1830
323 Ga0496105_0266700 3300048908 Bacteria 1384
324 Ga0496106_0072834 3300048909 Bacteria 2628
325 Ga0496107_0168220 3300048910 Bacteria 1626
326 Ga0496108_0020419 3300048911 Bacteria 5446
327 Ga0496109_0099670 3300048912 Bacteria 2695
328 Ga0496109_0365399 3300048912 Bacteria 1363
329 Ga0496112_0114661 3300048915 Bacteria 2665
330 Ga0496113_0150280 3300048916 Bacteria 1837
331 Ga0501036_0184023 3300049572 Bacteria 1758
332 Ga0501036_0188762 3300049572 Bacteria 1734
333 Ga0501042_0009316 3300049578 Bacteria 6539
334 Ga0501042_0086405 3300049578 Bacteria 2249
335 Ga0501048_0120723 3300049582 Bacteria 1852
336 Ga0501071_0174091 3300049587 Bacteria 1612
337 Ga0501075_0121696 3300049591 Bacteria 1986
338 Ga0501076_0125226 3300049592 Bacteria 2082
339 Ga0501077_0119726 3300049593 Bacteria 1668
340 Ga0501079_0033253 3300049741 Bacteria 3967
341 Ga0501079_0108224 3300049741 Bacteria 2158
342 Ga0501080_0061255 3300049742 Bacteria 3504
343 Ga0501081_0014819 3300049743 Bacteria 5145
344 Ga0501081_0166903 3300049743 Bacteria 1588
345 Ga0501045_0033465 3300049824 Bacteria 3727
346 nmdc:mga00v17_107473_c1 3300050491 Bacteria 1767
347 nmdc:mga0k408_23882_c1 3300050493 Bacteria 3453
348 nmdc:mga0k408_72105_c1 3300050493 Bacteria 2017
349 nmdc:mga06z11_145063_c1 3300050494 Bacteria 1345
350 nmdc:mga06z11_58769_c1 3300050494 Bacteria 1996
351 nmdc:mga07m45_30709_c2 3300050496 Bacteria 1862
352 nmdc:mga05p37_1120_c2 3300050507 Bacteria 12838
353 nmdc:mga05p37_12982_c1 3300050507 Bacteria 9966
354 nmdc:mga05p37_13568_c1 3300050507 Bacteria 9768
355 nmdc:mga05p37_150224_c1 3300050507 Bacteria 2850
356 nmdc:mga05p37_18489_c1 3300050507 Bacteria 8420
357 nmdc:mga05p37_21318_c1 3300050507 Bacteria 7275
358 nmdc:mga05p37_216462_c1 3300050507 Bacteria 2313
359 nmdc:mga05p37_219082_c1 3300050507 Bacteria 2297
360 nmdc:mga05p37_27837_c1 3300050507 Bacteria 6885
361 nmdc:mga05p37_52836_c1 3300050507 Bacteria 4996
362 nmdc:mga05p37_672782_c1 3300050507 Bacteria 1155
363 nmdc:mga09592_138364_c1 3300050508 Bacteria 2098
364 nmdc:mga09592_69674_c1 3300050508 Bacteria 2983
365 nmdc:mga09592_75565_c1 3300050508 Bacteria 2864
366 nmdc:mga0qj67_56952_c1 3300050509 Bacteria 3099
367 nmdc:mga06r32_120069_c1 3300050510 Bacteria 2592
368 nmdc:mga06r32_2277_c1 3300050510 Bacteria 17167
369 nmdc:mga06r32_567382_c1 3300050510 Bacteria 1108
370 nmdc:mga06r32_70827_c1 3300050510 Bacteria 3373
371 nmdc:mga08y16_161680_c1 3300050511 Bacteria 2327
372 nmdc:mga08y16_174943_c1 3300050511 Bacteria 2229
373 nmdc:mga08y16_181385_c1 3300050511 Bacteria 2186
374 nmdc:mga08y16_22154_c1 3300050511 Bacteria 6707
375 nmdc:mga08y16_29582_c1 3300050511 Bacteria 5770
376 nmdc:mga08y16_49969_c1 3300050511 Bacteria 4376
377 nmdc:mga08y16_558200_c1 3300050511 Bacteria 1158
378 nmdc:mga08y16_55_c1 3300050511 Bacteria 102176
379 nmdc:mga08y16_58010_c1 3300050511 Bacteria 4045
380 nmdc:mga0n895_136837_c1 3300050512 Bacteria 2476
381 nmdc:mga0n895_16487_c1 3300050512 Bacteria 6781
382 nmdc:mga0n895_21995_c1 3300050512 Bacteria 5974
383 nmdc:mga0n895_3450_c1 3300050512 Bacteria 12761
384 nmdc:mga0n895_62280_c1 3300050512 Bacteria 3686
385 nmdc:mga0rr50_1981_c1 3300050513 Bacteria 11380
386 nmdc:mga0rr50_306996_c1 3300050513 Bacteria 1328
387 nmdc:mga0rr50_53269_c1 3300050513 Bacteria 3010
388 nmdc:mga08x19_53524_c1 3300050514 Bacteria 2597
389 nmdc:mga0a205_179890_c1 3300050515 Bacteria 2009
390 nmdc:mga0a205_217220_c1 3300050515 Bacteria 1799
391 nmdc:mga0a205_240599_c1 3300050515 Bacteria 1691
392 nmdc:mga0a205_63177_c1 3300050515 Bacteria 3577
393 Ga0495619_0294005 3300053085 Bacteria 1125
394 Ga0500616_0000511 3300053153 Bacteria 49145
395 Ga0501084_0026621 3300054114 Bacteria 4827
396 Ga0501084_0130721 3300054114 Bacteria 2114
397 Ga0590071_000746 3300059421 Bacteria 9129
398 Ga0590074_000793 3300059423 Bacteria 4866
399 Ga0590075_002049 3300059424 Bacteria 4861
400 Ga0590077_000717 3300059426 Bacteria 8721
401 Ga0114129_10820483
402 JGI25406J46586_10006331
403 Ga0065712_10004652
404 Ga0065712_10169265
405 Ga0065712_10187361
406 Ga0065715_10025224
407 Ga0065707_10000808
408 Ga0065707_10090700
409 Ga0065707_10178173
410 Ga0065707_10261819
411 Ga0065707_10287512
412 Ga0070690_100101861
413 Ga0068868_100220438
414 Ga0068868_100254088
415 Ga0070689_100018726
416 Ga0070689_100030582
417 Ga0070687_100012413
418 Ga0070661_100090879
419 Ga0070675_100000261
420 Ga0070675_100088829
421 Ga0070675_100298900
422 Ga0070675_100409621
423 Ga0070671_100045728
424 Ga0070674_100048289
425 Ga0070674_100226942
426 Ga0070674_100373014
427 Ga0070673_100024516
428 Ga0070673_100052369
429 Ga0070673_100226941
430 Ga0070688_100018601
431 Ga0070659_100237566
432 Ga0070659_100319040
433 Ga0070701_10001756
434 Ga0070701_10050585
435 Ga0070701_10074103
436 Ga0070705_100001090
437 Ga0070705_100031209
438 Ga0070705_100160599
439 Ga0070700_100010832
440 Ga0070700_100138370
441 Ga0070694_100000166
442 Ga0070694_100000439
443 Ga0070694_100374067
444 Ga0070708_100132562
445 Ga0070663_100232270
446 Ga0070678_100242068
447 Ga0070678_100400233
448 Ga0070681_10441651
449 Ga0068867_100013197
450 Ga0068867_100026390
451 Ga0070706_100049046
452 Ga0070707_100118118
453 Ga0070707_100339757
454 Ga0070698_100085275
455 Ga0070698_100129078
456 Ga0070698_100241176
457 Ga0070699_100014671
458 Ga0070699_100017098
459 Ga0070699_100340214
460 Ga0070684_100076843
461 Ga0070672_100003032
462 Ga0070672_100015700
463 Ga0070672_100393968
464 Ga0070695_100000038
465 Ga0070695_100038865
466 Ga0070695_100127171
467 Ga0070695_100262878
468 Ga0070696_100000416
469 Ga0070696_100008944
470 Ga0070693_100020632
471 Ga0070704_100000369
472 Ga0070704_100014591
473 Ga0068855_100394833
474 Ga0070664_100191337
475 Ga0070664_100285588
476 Ga0070664_100348140
477 Ga0070664_100411852
478 Ga0068857_100027453
479 Ga0068857_100037454
480 Ga0068859_100041381
481 Ga0068859_100121272
482 Ga0068859_100147277
483 Ga0068859_100483637
484 Ga0068859_100868172
485 Ga0068864_100043813
486 Ga0068864_100110461
487 Ga0068864_100454937
488 Ga0068864_100556858
489 Ga0068861_100124889
490 Ga0068861_100155478
491 Ga0068861_100522526
492 Ga0068870_10005506
493 Ga0068858_100128674
494 Ga0068858_100181473
495 Ga0068858_100288008
496 Ga0068860_100036044
497 Ga0068860_100193332
498 Ga0068862_100000963
499 Ga0068862_100340403
500 Ga0081539_10000974
501 Ga0075368_10003179
502 Ga0075368_10032729
503 Ga0075364_10002058
504 Ga0075364_10062127
505 Ga0075432_10061885
506 Ga0075362_10000109
507 Ga0075367_10007567
508 Ga0075367_10011558
509 Ga0075367_10025757
510 Ga0075367_10185344
511 Ga0075366_10003937
512 Ga0075366_10017371
513 Ga0075366_10121342
514 Ga0075366_10121489
515 Ga0075370_10031139
516 Ga0068871_100466720
517 Ga0068871_100521028
518 Ga0075428_100007918
519 Ga0075428_100010751
520 Ga0075428_100078313
521 Ga0075428_100094599
522 Ga0075428_100173288
523 Ga0075428_100454562
524 Ga0075430_100187668
525 Ga0075430_100301616
526 Ga0075431_100009385
527 Ga0075431_100018975
528 Ga0075431_100234884
529 Ga0075433_10077963
530 Ga0075433_10088203
531 Ga0075433_10450791
532 Ga0075434_100000831
533 Ga0075434_100024320
534 Ga0075434_100026014
535 Ga0075434_100031783
536 Ga0075434_100158707
537 Ga0075429_100012557
538 Ga0075429_100060969
539 Ga0075429_100088335
540 Ga0075429_100354488
541 Ga0075429_100468598
542 Ga0097620_100041380
543 Ga0097620_100121271
544 Ga0097620_100147268
545 Ga0097620_100483633
546 Ga0097620_100868203
547 Ga0075435_100001617
548 Ga0075435_100009522
549 Ga0075435_100057809
550 Ga0075435_100097810
551 Ga0075435_100121725
552 Ga0111539_10000080
553 Ga0111539_10001145
554 Ga0111539_10017893
555 Ga0111539_10027507
556 Ga0111539_10453034
557 Ga0105245_10022899
558 Ga0105247_10153844
559 Ga0114129_10001026
560 Ga0114129_10006969
561 Ga0114129_10015063
562 Ga0114129_10020753
563 Ga0114129_10029895
564 Ga0114129_10052462
565 Ga0114129_10105096
566 Ga0114129_10120429
567 Ga0114129_10121509
568 Ga0114129_10162188
569 Ga0114129_10184732
570 Ga0114129_10270689
571 Ga0114129_11119394
572 Ga0105243_10351863
573 Ga0105241_10117670
574 Ga0105248_10122021
575 Ga0105248_10343292
576 Ga0105248_10355971
577 Ga0105249_10004488
578 Ga0105249_10446557
579 Ga0105239_10258090
580 Ga0105239_10433913
581 Ga0105246_10253942
582 Ga0157374_10448152
583 Ga0157378_10065473
584 Ga0163162_10601833
585 Ga0157375_10004182
586 Ga0157375_10235160
587 Ga0157375_10590519
588 Ga0163163_10011017
589 Ga0157380_10089925
590 Ga0157377_10096459
591 Ga0157379_10287488
592 Ga0207697_10007693
593 Ga0207642_10154058
594 Ga0207710_10079704
595 Ga0207688_10010448
596 Ga0207688_10052487
597 Ga0207680_10089870
598 Ga0207680_10172472
599 Ga0207647_10151050
600 Ga0207645_10011920
601 Ga0207645_10080023
602 Ga0207643_10007482
603 Ga0207643_10029839
604 Ga0207654_10102594
605 Ga0207707_10351266
606 Ga0207660_10121421
607 Ga0207662_10018369
608 Ga0207662_10021421
609 Ga0207657_10184136
610 Ga0207649_10050442
611 Ga0207646_10097901
612 Ga0207646_10141957
613 Ga0207646_10290580
614 Ga0207681_10001379
615 Ga0207681_10040729
616 Ga0207650_10014370
617 Ga0207650_10027312
618 Ga0207659_10022574
619 Ga0207659_10083097
620 Ga0207659_10117999
621 Ga0207659_10274430
622 Ga0207687_10234520
623 Ga0207690_10108937
624 Ga0207690_10262568
625 Ga0207686_10254004
626 Ga0207670_10020082
627 Ga0207670_10033776
628 Ga0207704_10178194
629 Ga0207691_10003857
630 Ga0207691_10014058
631 Ga0207691_10447579
632 Ga0207661_10067843
633 Ga0207679_10173589
634 Ga0207679_10208739
635 Ga0207679_10318150
636 Ga0207679_10361091
637 Ga0207651_10243736
638 Ga0207712_10004081
639 Ga0207640_10314613
640 Ga0207677_10207629
641 Ga0207677_10229012
642 Ga0207677_10232858
643 Ga0207703_10087888
644 Ga0207703_10260318
645 Ga0207678_10063748
646 Ga0207708_10022265
647 Ga0207708_10025430
648 Ga0207708_10118124
649 Ga0207648_10000992
650 Ga0207648_10039982
651 Ga0207648_10162248
652 Ga0207648_10204118
653 Ga0207676_10172457
654 Ga0207676_10266120
655 Ga0207676_10418969
656 Ga0207674_10024160
657 Ga0207674_10072084
658 Ga0207674_10361446
659 Ga0207675_100059044
660 Ga0207675_100087493
661 Ga0207675_100192210
662 Ga0207675_100538092
663 Ga0207683_10058481
664 Ga0207683_10172955
665 Ga0207683_10582935
666 Ga0207428_10001248
667 Ga0207428_10001608
668 Ga0207428_10002448
669 Ga0207428_10068264
670 Ga0207428_10126253
671 Ga0268266_10012207
672 Ga0268265_10000873
673 Ga0268265_10375374
674 Ga0268264_10547720
675 Ga0316576_10001328
676 Ga0316576_10003140
677 Ga0316578_10021735
678 Ga0307410_10231308
679 Ga0307409_100003152
680 Ga0307416_100829122
681 Ga0307411_10049696
682 Ga0307411_10246275
683 Ga0373932_0042758
684 Ga0316574_0014906
685 Ga0373935_0028080
686 Ga0316584_0002483
687 Ga0316584_0123587
688 Ga0395898_0176238
689 Ga0450923_025521
690 Ga0439464_0086942
691 Ga0451576_0005569
692 Ga0451576_0023567
693 Ga0451576_0156290
694 Ga0451576_0179761
695 Ga0451576_0211944
696 Ga0495603_0042271
697 Ga0495603_0165206
698 Ga0495585_0091770
699 Ga0495630_0235070
700 Ga0495644_0126870
701 Ga0495642_0003029
702 Ga0495642_0034662
703 Ga0495598_0045984
704 Ga0495609_0052156
705 Ga0495621_0021874
706 Ga0495621_0056011
707 Ga0495622_0036805
708 Ga0495656_0028413
709 Ga0495634_0046207
710 Ga0495588_0026265
711 Ga0495658_0020847
712 Ga0495658_0137351
713 Ga0495658_0167682
714 Ga0495669_0010075
715 Ga0495669_0151235
716 Ga0495613_0066296
717 Ga0495670_0150156
718 Ga0495636_0026762
719 Ga0495636_0033611
720 Ga0495676_0109968
721 Ga0495677_0059047
722 Ga0496104_0215785
723 Ga0496105_0266700
724 Ga0496106_0072834
725 Ga0496107_0168220
726 Ga0496108_0020419
727 Ga0496109_0099670
728 Ga0496109_0365399
729 Ga0496112_0114661
730 Ga0496113_0150280
731 Ga0501036_0184023
732 Ga0501036_0188762
733 Ga0501042_0009316
734 Ga0501042_0086405
735 Ga0501048_0120723
736 Ga0501071_0174091
737 Ga0501075_0121696
738 Ga0501076_0125226
739 Ga0501077_0119726
740 Ga0501079_0033253
741 Ga0501079_0108224
742 Ga0501080_0061255
743 Ga0501081_0014819
744 Ga0501081_0166903
745 Ga0501045_0033465
746 nmdc:mga00v17_107473_c1
747 nmdc:mga0k408_23882_c1
748 nmdc:mga0k408_72105_c1
749 nmdc:mga06z11_145063_c1
750 nmdc:mga06z11_58769_c1
751 nmdc:mga07m45_30709_c2
752 nmdc:mga05p37_1120_c2
753 nmdc:mga05p37_12982_c1
754 nmdc:mga05p37_13568_c1
755 nmdc:mga05p37_150224_c1
756 nmdc:mga05p37_18489_c1
757 nmdc:mga05p37_21318_c1
758 nmdc:mga05p37_216462_c1
759 nmdc:mga05p37_219082_c1
760 nmdc:mga05p37_27837_c1
761 nmdc:mga05p37_52836_c1
762 nmdc:mga05p37_672782_c1
763 nmdc:mga09592_138364_c1
764 nmdc:mga09592_69674_c1
765 nmdc:mga09592_75565_c1
766 nmdc:mga0qj67_56952_c1
767 nmdc:mga06r32_120069_c1
768 nmdc:mga06r32_2277_c1
769 nmdc:mga06r32_567382_c1
770 nmdc:mga06r32_70827_c1
771 nmdc:mga08y16_161680_c1
772 nmdc:mga08y16_174943_c1
773 nmdc:mga08y16_181385_c1
774 nmdc:mga08y16_22154_c1
775 nmdc:mga08y16_29582_c1
776 nmdc:mga08y16_49969_c1
777 nmdc:mga08y16_558200_c1
778 nmdc:mga08y16_55_c1
779 nmdc:mga08y16_58010_c1
780 nmdc:mga0n895_136837_c1
781 nmdc:mga0n895_16487_c1
782 nmdc:mga0n895_21995_c1
783 nmdc:mga0n895_3450_c1
784 nmdc:mga0n895_62280_c1
785 nmdc:mga0rr50_1981_c1
786 nmdc:mga0rr50_306996_c1
787 nmdc:mga0rr50_53269_c1
788 nmdc:mga08x19_53524_c1
789 nmdc:mga0a205_179890_c1
790 nmdc:mga0a205_217220_c1
791 nmdc:mga0a205_240599_c1
792 nmdc:mga0a205_63177_c1
793 Ga0495619_0294005
794 Ga0500616_0000511
795 Ga0501084_0026621
796 Ga0501084_0130721
797 Ga0590071_000746
798 Ga0590074_000793
799 Ga0590075_002049
800 Ga0590077_000717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08352

oligo_HPY

Oligopeptide/dipeptide transporter, C-terminal region

237

301

0.98

PF00005

ABC_tran

ABC transporter

37

186

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9493 3 260
7d06-assembly1.cif.gz_B cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.9379 1 256
7z19-assembly1.cif.gz_I e. coli c-p lyase bound to a single phnk abc domain 0.9337 1 255
7z17-assembly1.cif.gz_J e. coli c-p lyase bound to a phnk abc dimer in an open conformation 0.9312 1 255
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9289 4 255
ID Description Score Start End Superfamily
af_Q2G1F8_275_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9742 3 259 3.40.50.300
af_P75796_311_605_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9685 1 270 3.40.50.300
af_P33916_272_529_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9685 1 256 3.40.50.300
af_P0AAH8_2_263_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9658 1 254 3.40.50.300
af_I6Y482_280_547_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.965 2 266 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3A1XPB1-F1-model_v4 deleted 0.9901 59 257
AF-X0QJQ9-F1-model_v4 Dipeptide transport ATP-binding protein DppD 0.9831 95 255 GO:0005524
GO:0016887
AF-A0A3M1U256-F1-model_v4 ABC transporter ATP-binding protein 0.9799 1 255 GO:0005524
GO:0015833
GO:0016887
GO:0055085
AF-A0A2G6K7A8-F1-model_v4 Peptide ABC transporter ATP-binding protein 0.9798 2 255 GO:0005524
GO:0016887
GO:0055085
AF-A0A3N1KYJ0-F1-model_v4 Peptide/nickel transport system ATP-binding protein 0.9788 1 257 GO:0005524
GO:0005886
GO:0015833
GO:0016887

Map