F434491

General Info

Members Datasets Scaffolds Average Seq Length
400 198 800 136

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100192087|Ga0070683_1001920872
Length 154
Sequence MATEPVHDDDPTIGRLVSDASRDISSLISNEIKLAKSELKLSAQAGGAGIALFAAAVFFLVMALIMLSVAIAYFINWNGDGLPLMWAFTIVFAFYLVVTAILAFVGYRKFKKVRGPQRAIQQAEEAKQMLTRSGSSSSAPEITPRSPRSTPPAS

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
116 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
117 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
118 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
181 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
185 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
188 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
189 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
190 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
191 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 2643221561 Nocardioides sp. Root151 Isolate Unclassified
195 2643221696 Nocardioides sp. Root140 Isolate Unclassified
196 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
197 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
198 2857481737 Nocardioides sp. R-74106 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.5
Metatranscriptomes 2.25
Isolates 1.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.5
Nodule 0
Rhizoplane 12.25
Rhizosphere 66.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100192087 3300005329 Bacteria 1939
2 JGI24741J21665_1056629 3300001915 Bacteria 578
3 JGI24740J21852_10025016 3300001979 Bacteria 2018
4 JGI24739J22299_10175797 3300001989 Bacteria 630
5 JGI24737J22298_10011847 3300001990 Bacteria 2850
6 JGI24735J21928_10042751 3300002067 Bacteria 1319
7 JGI24735J21928_10067051 3300002067 Bacteria 1029
8 JGI24738J21930_10102738 3300002075 Bacteria 611
9 Ga0070658_10016711 3300005327 Bacteria 5873
10 Ga0070658_10121646 3300005327 Bacteria 2169
11 Ga0070658_11354949 3300005327 Bacteria 618
12 Ga0070658_11724627 3300005327 Bacteria 542
13 Ga0070683_100004034 3300005329 Bacteria 12020
14 Ga0070683_100621766 3300005329 Bacteria 1034
15 Ga0070680_100193509 3300005336 Bacteria 1714
16 Ga0070680_100383517 3300005336 Bacteria 1197
17 Ga0070682_100005152 3300005337 Bacteria 7265
18 Ga0070682_100143157 3300005337 Bacteria 1632
19 Ga0070682_100831521 3300005337 Bacteria 753
20 Ga0070660_100030977 3300005339 Bacteria 4015
21 Ga0070692_10148707 3300005345 Bacteria 1332
22 Ga0070659_100433976 3300005366 Bacteria 1112
23 Ga0070667_100037115 3300005367 Bacteria 4085
24 Ga0070667_100090514 3300005367 Bacteria 2630
25 Ga0070714_100361018 3300005435 Bacteria 1366
26 Ga0070710_11065424 3300005437 Bacteria 592
27 Ga0070663_101778203 3300005455 Bacteria 552
28 Ga0070681_10069579 3300005458 Bacteria 3486
29 Ga0070681_10316896 3300005458 Bacteria 1469
30 Ga0070685_10402337 3300005466 Bacteria 948
31 Ga0070679_100015457 3300005530 Bacteria 7334
32 Ga0070679_100317732 3300005530 Bacteria 1507
33 Ga0070679_100802235 3300005530 Bacteria 885
34 Ga0070684_100040568 3300005535 Bacteria 4010
35 Ga0070684_100429930 3300005535 Bacteria 1219
36 Ga0070684_100790225 3300005535 Bacteria 887
37 Ga0068853_101022207 3300005539 Bacteria 796
38 Ga0068853_102061950 3300005539 Bacteria 553
39 Ga0070693_100291998 3300005547 Bacteria 1096
40 Ga0070693_101041833 3300005547 Bacteria 621
41 Ga0070665_100001661 3300005548 Bacteria 25614
42 Ga0068855_100041472 3300005563 Bacteria 5455
43 Ga0070664_100214110 3300005564 Bacteria 1722
44 Ga0070664_100862478 3300005564 Bacteria 848
45 Ga0068857_100029566 3300005577 Bacteria 4835
46 Ga0068857_101222025 3300005577 Bacteria 728
47 Ga0068857_101379502 3300005577 Bacteria 685
48 Ga0068854_101019979 3300005578 Bacteria 734
49 Ga0068856_100606066 3300005614 Bacteria 1116
50 Ga0070702_100134338 3300005615 Bacteria 1567
51 Ga0070702_100176334 3300005615 Bacteria 1395
52 Ga0068852_100164434 3300005616 Bacteria 2075
53 Ga0068864_100031736 3300005618 Bacteria 4484
54 Ga0068861_100196405 3300005719 Bacteria 1690
55 Ga0068861_100399222 3300005719 Bacteria 1220
56 Ga0068858_100051558 3300005842 Bacteria 3807
57 Ga0068860_100000865 3300005843 Bacteria 33675
58 Ga0068860_100128890 3300005843 Bacteria 2426
59 Ga0075365_10008933 3300006038 Bacteria 5725
60 Ga0075365_10054284 3300006038 Bacteria 2657
61 Ga0075365_10084184 3300006038 Bacteria 2158
62 Ga0075365_10086642 3300006038 Bacteria 2129
63 Ga0075365_10118368 3300006038 Bacteria 1825
64 Ga0075365_10154324 3300006038 Bacteria 1598
65 Ga0075365_10173656 3300006038 Bacteria 1505
66 Ga0075365_10255792 3300006038 Bacteria 1231
67 Ga0075365_10380170 3300006038 Bacteria 996
68 Ga0075368_10002629 3300006042 Bacteria 5899
69 Ga0075368_10002980 3300006042 Bacteria 5589
70 Ga0075363_100000342 3300006048 Bacteria 13938
71 Ga0075363_100008107 3300006048 Bacteria 4875
72 Ga0075363_100025458 3300006048 Bacteria 3018
73 Ga0075363_100075339 3300006048 Bacteria 1838
74 Ga0075363_100215702 3300006048 Bacteria 1099
75 Ga0075363_100316891 3300006048 Bacteria 907
76 Ga0075364_10012144 3300006051 Bacteria 5258
77 Ga0075364_10051207 3300006051 Bacteria 2696
78 Ga0075364_10095059 3300006051 Bacteria 1981
79 Ga0075364_10133600 3300006051 Bacteria 1666
80 Ga0075364_10186008 3300006051 Bacteria 1406
81 Ga0075364_10365704 3300006051 Bacteria 983
82 Ga0075364_10416935 3300006051 Bacteria 916
83 Ga0075364_10818171 3300006051 Bacteria 635
84 Ga0075364_11012632 3300006051 Bacteria 565
85 Ga0075362_10043702 3300006177 Bacteria 1984
86 Ga0075367_10004544 3300006178 Bacteria 6788
87 Ga0075367_10005751 3300006178 Bacteria 6198
88 Ga0075367_10005904 3300006178 Bacteria 6140
89 Ga0075367_10250499 3300006178 Bacteria 1111
90 Ga0075367_10295312 3300006178 Bacteria 1020
91 Ga0097621_100132965 3300006237 Bacteria 2119
92 Ga0097621_100355900 3300006237 Bacteria 1303
93 Ga0075370_10005070 3300006353 Bacteria 6492
94 Ga0075370_10014541 3300006353 Bacteria 4201
95 Ga0075370_10048602 3300006353 Bacteria 2403
96 Ga0075370_10457010 3300006353 Bacteria 769
97 Ga0068865_100221931 3300006881 Bacteria 1478
98 Ga0105245_10022036 3300009098 Bacteria 5591
99 Ga0105247_10403737 3300009101 Bacteria 974
100 Ga0105243_10325996 3300009148 Bacteria 1401
101 Ga0105242_10273407 3300009176 Bacteria 1531
102 Ga0105242_11413303 3300009176 Bacteria 724
103 Ga0105248_10088319 3300009177 Bacteria 3489
104 Ga0105248_11110637 3300009177 Bacteria 894
105 Ga0105237_10024883 3300009545 Bacteria 6125
106 Ga0105238_10262731 3300009551 Bacteria 1706
107 Ga0105238_11427446 3300009551 Bacteria 720
108 Ga0105249_10128928 3300009553 Bacteria 2412
109 Ga0105249_10720625 3300009553 Bacteria 1058
110 Ga0105239_10341718 3300010375 Bacteria 1689
111 Ga0105239_10835409 3300010375 Bacteria 1056
112 Ga0105239_11796659 3300010375 Bacteria 710
113 Ga0105246_10000654 3300011119 Bacteria 19374
114 Ga0157371_10076518 3300013102 Bacteria 2370
115 Ga0157369_10168219 3300013105 Bacteria 2311
116 Ga0157369_10528808 3300013105 Bacteria 1220
117 Ga0157369_10571919 3300013105 Bacteria 1167
118 Ga0157378_10826942 3300013297 Bacteria 953
119 Ga0157378_11160805 3300013297 Bacteria 811
120 Ga0163162_10328282 3300013306 Bacteria 1662
121 Ga0157372_10001247 3300013307 Bacteria 27513
122 Ga0157372_10079872 3300013307 Bacteria 3700
123 Ga0157372_10224134 3300013307 Bacteria 2179
124 Ga0157372_10243188 3300013307 Bacteria 2088
125 Ga0157372_10323411 3300013307 Bacteria 1796
126 Ga0157372_10522543 3300013307 Bacteria 1384
127 Ga0157372_11203607 3300013307 Bacteria 875
128 Ga0157372_11618828 3300013307 Bacteria 745
129 Ga0157375_10310240 3300013308 Bacteria 1742
130 Ga0157375_10436119 3300013308 Bacteria 1476
131 Ga0157375_10708127 3300013308 Bacteria 1160
132 Ga0157375_11012361 3300013308 Bacteria 970
133 Ga0157375_12766157 3300013308 Bacteria 587
134 Ga0163163_10100437 3300014325 Bacteria 2915
135 Ga0163163_10573225 3300014325 Bacteria 1192
136 Ga0157379_10037111 3300014968 Bacteria 4345
137 Ga0157376_12060756 3300014969 Bacteria 609
138 Ga0163161_10888803 3300017792 Bacteria 754
139 Ga0206356_10365960 3300020070 Bacteria 1214
140 Ga0206356_11122092 3300020070 Bacteria 1187
141 Ga0206354_10003251 3300020081 Bacteria 864
142 Ga0206354_10828677 3300020081 Bacteria 1074
143 Ga0206353_11269125 3300020082 Bacteria 1151
144 Ga0206353_11440359 3300020082 Bacteria 1624
145 Ga0154015_1303928 3300020610 Bacteria 655
146 Ga0224712_10089240 3300022467 Bacteria 1288
147 Ga0207697_10338689 3300025315 Bacteria 668
148 Ga0207688_10015916 3300025901 Bacteria 4078
149 Ga0207647_10062582 3300025904 Bacteria 2267
150 Ga0207647_10090327 3300025904 Bacteria 1827
151 Ga0207647_10272447 3300025904 Bacteria 967
152 Ga0207705_10023812 3300025909 Bacteria 4368
153 Ga0207705_10057168 3300025909 Bacteria 2814
154 Ga0207705_10634490 3300025909 Bacteria 831
155 Ga0207705_10647293 3300025909 Bacteria 822
156 Ga0207705_11226252 3300025909 Bacteria 575
157 Ga0207707_10229826 3300025912 Bacteria 1614
158 Ga0207660_10065570 3300025917 Bacteria 2625
159 Ga0207660_10609483 3300025917 Bacteria 889
160 Ga0207657_10022965 3300025919 Bacteria 5820
161 Ga0207657_10097361 3300025919 Bacteria 2446
162 Ga0207652_10085680 3300025921 Bacteria 2761
163 Ga0207652_10209858 3300025921 Bacteria 1753
164 Ga0207652_10747216 3300025921 Bacteria 871
165 Ga0207694_10220247 3300025924 Bacteria 1548
166 Ga0207694_10846411 3300025924 Bacteria 773
167 Ga0207664_10011035 3300025929 Bacteria 6400
168 Ga0207690_10934318 3300025932 Bacteria 720
169 Ga0207690_11053404 3300025932 Bacteria 677
170 Ga0207686_10223518 3300025934 Bacteria 1361
171 Ga0207709_10263862 3300025935 Bacteria 1264
172 Ga0207704_10093517 3300025938 Bacteria 1982
173 Ga0207711_10291371 3300025941 Bacteria 1504
174 Ga0207661_10132306 3300025944 Bacteria 2138
175 Ga0207661_10328449 3300025944 Bacteria 1376
176 Ga0207679_12155964 3300025945 Bacteria 506
177 Ga0207667_10069386 3300025949 Bacteria 3668
178 Ga0207712_10303084 3300025961 Bacteria 1312
179 Ga0207712_10966942 3300025961 Bacteria 755
180 Ga0207640_10388492 3300025981 Bacteria 1133
181 Ga0207658_10042890 3300025986 Bacteria 3285
182 Ga0207703_10090326 3300026035 Bacteria 2574
183 Ga0207703_11538929 3300026035 Bacteria 640
184 Ga0207639_10451630 3300026041 Bacteria 1167
185 Ga0207639_11903745 3300026041 Bacteria 556
186 Ga0207678_10551193 3300026067 Bacteria 1008
187 Ga0207708_10035734 3300026075 Bacteria 3781
188 Ga0207702_10076419 3300026078 Bacteria 2895
189 Ga0207702_10330834 3300026078 Bacteria 1453
190 Ga0207674_10007640 3300026116 Bacteria 12592
191 Ga0207674_10205091 3300026116 Bacteria 1921
192 Ga0207674_10636901 3300026116 Bacteria 1029
193 Ga0207675_100104112 3300026118 Bacteria 2675
194 Ga0207698_10072311 3300026142 Bacteria 2741
195 Ga0209813_10000775 3300027866 Bacteria 7270
196 Ga0268266_10003653 3300028379 Bacteria 15203
197 Ga0268264_10015410 3300028381 Bacteria 6269
198 Ga0268264_10023919 3300028381 Bacteria 4984
199 Ga0307408_101257955 3300031548 Bacteria 692
200 Ga0307405_10387151 3300031731 Bacteria 1090
201 Ga0307410_10121006 3300031852 Bacteria 1909
202 Ga0307406_10074610 3300031901 Bacteria 2234
203 Ga0307407_10004960 3300031903 Bacteria 5723
204 Ga0307407_10263109 3300031903 Bacteria 1187
205 Ga0307412_10313732 3300031911 Bacteria 1244
206 Ga0307409_100003456 3300031995 Bacteria 8578
207 Ga0307409_100230058 3300031995 Bacteria 1680
208 Ga0307409_100955130 3300031995 Bacteria 873
209 Ga0307416_100003722 3300032002 Bacteria 9043
210 Ga0307416_100275809 3300032002 Bacteria 1654
211 Ga0307416_101710291 3300032002 Bacteria 734
212 Ga0307411_10484898 3300032005 Bacteria 1042
213 Ga0307411_10920904 3300032005 Bacteria 778
214 Ga0307415_100021021 3300032126 Bacteria 4000
215 Ga0307415_100507545 3300032126 Bacteria 1056
216 Ga0395900_0219114 3300037418 Bacteria 1919
217 Ga0395901_0027570 3300038443 Bacteria 5838
218 Ga0395901_0279936 3300038443 Bacteria 1733
219 Ga0436365_0634151 3300039437 Bacteria 1593
220 Ga0451800_0803671 3300041459 Bacteria 642
221 Ga0451802_0326433 3300041460 Bacteria 702
222 Ga0451835_0550863 3300041492 Bacteria 1036
223 Ga0451837_0121714 3300041494 Bacteria 537
224 Ga0466972_0013452 3300044658 Bacteria 4109
225 Ga0466972_0293927 3300044658 Bacteria 759
226 Ga0466965_0008563 3300044683 Bacteria 4734
227 Ga0466965_0051464 3300044683 Bacteria 2043
228 Ga0466965_0802491 3300044683 Bacteria 545
229 Ga0466966_0417627 3300044684 Bacteria 806
230 Ga0466963_0030760 3300044694 Bacteria 3466
231 Ga0466963_0119966 3300044694 Bacteria 1809
232 Ga0466963_0919565 3300044694 Bacteria 616
233 Ga0466964_0011096 3300044706 Bacteria 3403
234 Ga0466964_0026454 3300044706 Bacteria 2271
235 Ga0466971_0208342 3300044719 Bacteria 924
236 Ga0466970_0045942 3300044765 Bacteria 2326
237 Ga0466970_0053232 3300044765 Bacteria 2161
238 Ga0466970_0082852 3300044765 Bacteria 1735
239 Ga0466957_0666614 3300044842 Bacteria 732
240 Ga0466960_0143642 3300044901 Bacteria 1269
241 Ga0451576_0028169 3300045051 Bacteria 6023
242 Ga0466967_0036324 3300045976 Bacteria 4205
243 Ga0466967_0072465 3300045976 Bacteria 3087
244 Ga0466967_0681173 3300045976 Bacteria 1018
245 Ga0466967_1663168 3300045976 Bacteria 636
246 Ga0495592_0543426 3300046454 Bacteria 715
247 Ga0495667_0225899 3300046559 Bacteria 1194
248 Ga0495657_0472563 3300046675 Bacteria 733
249 Ga0495674_0288260 3300047319 Bacteria 1343
250 Ga0496100_0067954 3300048903 Bacteria 2369
251 Ga0496100_0306804 3300048903 Bacteria 1189
252 Ga0496100_0500668 3300048903 Bacteria 936
253 Ga0496101_0019156 3300048904 Bacteria 4667
254 Ga0496101_0280434 3300048904 Bacteria 1302
255 Ga0496101_0730378 3300048904 Bacteria 782
256 Ga0496101_1082084 3300048904 Bacteria 630
257 Ga0496102_0003189 3300048905 Bacteria 13909
258 Ga0496102_0039261 3300048905 Bacteria 4277
259 Ga0496102_0944886 3300048905 Bacteria 783
260 Ga0496102_1151388 3300048905 Bacteria 695
261 Ga0496102_1770839 3300048905 Bacteria 535
262 Ga0496103_0031368 3300048906 Bacteria 3238
263 Ga0496103_0037591 3300048906 Bacteria 2967
264 Ga0496103_0373765 3300048906 Bacteria 916
265 Ga0496103_0687815 3300048906 Bacteria 649
266 Ga0496104_0005564 3300048907 Bacteria 11032
267 Ga0496104_0023774 3300048907 Bacteria 5635
268 Ga0496105_0015125 3300048908 Bacteria 6141
269 Ga0496105_0035894 3300048908 Bacteria 4083
270 Ga0496105_0110269 3300048908 Bacteria 2272
271 Ga0496106_0606564 3300048909 Bacteria 876
272 Ga0496106_0767531 3300048909 Bacteria 766
273 Ga0496106_1536864 3300048909 Bacteria 511
274 Ga0496107_0134625 3300048910 Bacteria 1826
275 Ga0496108_1190548 3300048911 Bacteria 645
276 Ga0496109_0029037 3300048912 Bacteria 4951
277 Ga0496109_0040137 3300048912 Bacteria 4238
278 Ga0496109_0092509 3300048912 Bacteria 2797
279 Ga0496110_0150902 3300048913 Bacteria 2104
280 Ga0496111_0024332 3300048914 Bacteria 4262
281 Ga0496111_0073205 3300048914 Bacteria 2495
282 Ga0496111_0111550 3300048914 Bacteria 2014
283 Ga0496111_0742776 3300048914 Bacteria 712
284 Ga0496112_0502995 3300048915 Bacteria 1147
285 Ga0496112_0989942 3300048915 Bacteria 761
286 Ga0496113_0269589 3300048916 Bacteria 1360
287 Ga0496114_0002623 3300048917 Bacteria 13721
288 Ga0496114_0011415 3300048917 Bacteria 7098
289 Ga0496114_0026467 3300048917 Bacteria 4749
290 Ga0496114_0039911 3300048917 Bacteria 3885
291 Ga0496114_0103970 3300048917 Bacteria 2428
292 Ga0496114_0298567 3300048917 Bacteria 1422
293 Ga0496115_0011423 3300048918 Bacteria 6656
294 Ga0496115_0022614 3300048918 Bacteria 4874
295 Ga0496115_0089609 3300048918 Bacteria 2512
296 Ga0496115_1206700 3300048918 Bacteria 568
297 Ga0501031_0113163 3300049568 Bacteria 1773
298 Ga0501033_0102033 3300049570 Bacteria 2093
299 Ga0501034_0010438 3300049571 Bacteria 9674
300 Ga0501034_0070540 3300049571 Bacteria 3505
301 Ga0501034_0260503 3300049571 Bacteria 1677
302 Ga0501036_0016568 3300049572 Bacteria 6155
303 Ga0501036_0173559 3300049572 Bacteria 1816
304 Ga0501036_0279210 3300049572 Bacteria 1398
305 Ga0501038_0005427 3300049574 Bacteria 11848
306 Ga0501038_0957830 3300049574 Bacteria 630
307 Ga0501039_0085621 3300049575 Bacteria 2455
308 Ga0501039_0697492 3300049575 Bacteria 794
309 Ga0501040_0250985 3300049576 Bacteria 1262
310 Ga0501040_0635824 3300049576 Bacteria 771
311 Ga0501041_0885132 3300049577 Bacteria 573
312 Ga0501042_0102827 3300049578 Bacteria 2055
313 Ga0501043_0112177 3300049579 Bacteria 2141
314 Ga0501046_0027105 3300049580 Bacteria 4679
315 Ga0501046_0545629 3300049580 Bacteria 827
316 Ga0501047_0445462 3300049581 Bacteria 1124
317 Ga0501048_0076020 3300049582 Bacteria 2370
318 Ga0501048_0079585 3300049582 Bacteria 2313
319 Ga0501067_0031818 3300049583 Bacteria 2927
320 Ga0501068_0374228 3300049584 Bacteria 917
321 Ga0501068_0876310 3300049584 Bacteria 590
322 Ga0501069_0046722 3300049585 Bacteria 2402
323 Ga0501069_0116847 3300049585 Bacteria 1522
324 Ga0501069_0447326 3300049585 Bacteria 768
325 Ga0501070_0091905 3300049586 Bacteria 2512
326 Ga0501070_0231846 3300049586 Bacteria 1512
327 Ga0501070_0565323 3300049586 Bacteria 909
328 Ga0501070_1326306 3300049586 Bacteria 549
329 Ga0501071_0020833 3300049587 Bacteria 4561
330 Ga0501071_0402510 3300049587 Bacteria 1045
331 Ga0501072_0149507 3300049588 Bacteria 1862
332 Ga0501072_0162192 3300049588 Bacteria 1783
333 Ga0501072_0684856 3300049588 Bacteria 806
334 Ga0501072_1589793 3300049588 Bacteria 504
335 Ga0501073_0035708 3300049589 Bacteria 3531
336 Ga0501073_0109529 3300049589 Bacteria 1916
337 Ga0501073_0659401 3300049589 Bacteria 722
338 Ga0501074_0349597 3300049590 Bacteria 1049
339 Ga0501079_0027435 3300049741 Bacteria 4366
340 Ga0501079_1098702 3300049741 Bacteria 627
341 Ga0501080_0083982 3300049742 Bacteria 2959
342 Ga0501081_0160646 3300049743 Bacteria 1619
343 Ga0501081_0212060 3300049743 Bacteria 1407
344 Ga0501035_0007262 3300049822 Bacteria 10366
345 Ga0501044_0011512 3300049823 Bacteria 9584
346 Ga0501045_0176183 3300049824 Bacteria 1593
347 Ga0501045_0290902 3300049824 Bacteria 1216
348 nmdc:mga03n38_1866_c1 3300050490 Bacteria 6297
349 nmdc:mga03n38_22423_c1 3300050490 Bacteria 2555
350 nmdc:mga03n38_239251_c1 3300050490 Bacteria 955
351 nmdc:mga00v17_188483_c1 3300050491 Bacteria 1332
352 nmdc:mga00v17_252257_c1 3300050491 Bacteria 1144
353 nmdc:mga00v17_30284_c1 3300050491 Bacteria 3183
354 nmdc:mga00v17_360667_c1 3300050491 Bacteria 945
355 nmdc:mga00v17_369803_c1 3300050491 Bacteria 932
356 nmdc:mga00v17_417683_c1 3300050491 Bacteria 871
357 nmdc:mga00v17_565556_c1 3300050491 Bacteria 735
358 nmdc:mga00v17_75472_c1 3300050491 Bacteria 2096
359 nmdc:mga00v17_80621_c1 3300050491 Bacteria 2031
360 nmdc:mga00v17_85895_c1 3300050491 Bacteria 1971
361 nmdc:mga0yw44_113289_c1 3300050492 Bacteria 1740
362 nmdc:mga0yw44_12664_c1 3300050492 Bacteria 4406
363 nmdc:mga0yw44_129762_c1 3300050492 Bacteria 1631
364 nmdc:mga0yw44_143989_c1 3300050492 Bacteria 1550
365 nmdc:mga0yw44_2712_c1 3300050492 Bacteria 7648
366 nmdc:mga0yw44_31204_c1 3300050492 Bacteria 3096
367 nmdc:mga0yw44_32773_c1 3300050492 Bacteria 3030
368 nmdc:mga0yw44_367144_c1 3300050492 Bacteria 971
369 nmdc:mga0yw44_37582_c1 3300050492 Bacteria 2859
370 nmdc:mga0yw44_428459_c1 3300050492 Bacteria 896
371 nmdc:mga0yw44_456741_c1 3300050492 Bacteria 866
372 nmdc:mga0yw44_49436_c1 3300050492 Bacteria 2538
373 nmdc:mga0yw44_794494_c1 3300050492 Bacteria 643
374 nmdc:mga06z11_38951_c1 3300050494 Bacteria 2363
375 nmdc:mga06z11_422243_c1 3300050494 Bacteria 804
376 nmdc:mga06z11_60467_c1 3300050494 Bacteria 1973
377 nmdc:mga06z11_63334_c1 3300050494 Bacteria 1935
378 nmdc:mga04h51_11300_c1 3300050495 Bacteria 2475
379 nmdc:mga04h51_313_c1 3300050495 Bacteria 12263
380 nmdc:mga07m45_12092_c1 3300050496 Bacteria 4246
381 nmdc:mga07m45_46114_c2 3300050496 Bacteria 1490
382 nmdc:mga07m45_49571_c1 3300050496 Bacteria 2364
383 nmdc:mga08y16_470158_c1 3300050511 Bacteria 1280
384 Ga0495655_0016849 3300053083 Bacteria 1582
385 Ga0495595_0257073 3300053084 Bacteria 875
386 Ga0495619_0014986 3300053085 Bacteria 4898
387 Ga0500644_0000181 3300053088 Bacteria 40245
388 Ga0500644_0025268 3300053088 Bacteria 1826
389 Ga0500554_007601 3300053102 Bacteria 2502
390 Ga0500556_0000483 3300053104 Bacteria 27786
391 Ga0500573_0049807 3300053140 Bacteria 2410
392 Ga0500573_0131344 3300053140 Bacteria 1387
393 Ga0590074_063684 3300059423 Bacteria 688
394 Ga0587083_0236744 3300059505 Bacteria 538
395 Ga0501082_0182292 3300060353 Bacteria 1826
396 2643824863 2643221561 Bacteria 4984412
397 2644532586 2643221696 Bacteria 5431823
398 2812330013 2811994874 Bacteria 5367947
399 2855390116 2855386786 Bacteria 4752232
400 2857484941 2857481737 Bacteria 4761446
401 Ga0070683_100192087
402 JGI24741J21665_1056629
403 JGI24740J21852_10025016
404 JGI24739J22299_10175797
405 JGI24737J22298_10011847
406 JGI24735J21928_10042751
407 JGI24735J21928_10067051
408 JGI24738J21930_10102738
409 Ga0070658_10016711
410 Ga0070658_10121646
411 Ga0070658_11354949
412 Ga0070658_11724627
413 Ga0070683_100004034
414 Ga0070683_100621766
415 Ga0070680_100193509
416 Ga0070680_100383517
417 Ga0070682_100005152
418 Ga0070682_100143157
419 Ga0070682_100831521
420 Ga0070660_100030977
421 Ga0070692_10148707
422 Ga0070659_100433976
423 Ga0070667_100037115
424 Ga0070667_100090514
425 Ga0070714_100361018
426 Ga0070710_11065424
427 Ga0070663_101778203
428 Ga0070681_10069579
429 Ga0070681_10316896
430 Ga0070685_10402337
431 Ga0070679_100015457
432 Ga0070679_100317732
433 Ga0070679_100802235
434 Ga0070684_100040568
435 Ga0070684_100429930
436 Ga0070684_100790225
437 Ga0068853_101022207
438 Ga0068853_102061950
439 Ga0070693_100291998
440 Ga0070693_101041833
441 Ga0070665_100001661
442 Ga0068855_100041472
443 Ga0070664_100214110
444 Ga0070664_100862478
445 Ga0068857_100029566
446 Ga0068857_101222025
447 Ga0068857_101379502
448 Ga0068854_101019979
449 Ga0068856_100606066
450 Ga0070702_100134338
451 Ga0070702_100176334
452 Ga0068852_100164434
453 Ga0068864_100031736
454 Ga0068861_100196405
455 Ga0068861_100399222
456 Ga0068858_100051558
457 Ga0068860_100000865
458 Ga0068860_100128890
459 Ga0075365_10008933
460 Ga0075365_10054284
461 Ga0075365_10084184
462 Ga0075365_10086642
463 Ga0075365_10118368
464 Ga0075365_10154324
465 Ga0075365_10173656
466 Ga0075365_10255792
467 Ga0075365_10380170
468 Ga0075368_10002629
469 Ga0075368_10002980
470 Ga0075363_100000342
471 Ga0075363_100008107
472 Ga0075363_100025458
473 Ga0075363_100075339
474 Ga0075363_100215702
475 Ga0075363_100316891
476 Ga0075364_10012144
477 Ga0075364_10051207
478 Ga0075364_10095059
479 Ga0075364_10133600
480 Ga0075364_10186008
481 Ga0075364_10365704
482 Ga0075364_10416935
483 Ga0075364_10818171
484 Ga0075364_11012632
485 Ga0075362_10043702
486 Ga0075367_10004544
487 Ga0075367_10005751
488 Ga0075367_10005904
489 Ga0075367_10250499
490 Ga0075367_10295312
491 Ga0097621_100132965
492 Ga0097621_100355900
493 Ga0075370_10005070
494 Ga0075370_10014541
495 Ga0075370_10048602
496 Ga0075370_10457010
497 Ga0068865_100221931
498 Ga0105245_10022036
499 Ga0105247_10403737
500 Ga0105243_10325996
501 Ga0105242_10273407
502 Ga0105242_11413303
503 Ga0105248_10088319
504 Ga0105248_11110637
505 Ga0105237_10024883
506 Ga0105238_10262731
507 Ga0105238_11427446
508 Ga0105249_10128928
509 Ga0105249_10720625
510 Ga0105239_10341718
511 Ga0105239_10835409
512 Ga0105239_11796659
513 Ga0105246_10000654
514 Ga0157371_10076518
515 Ga0157369_10168219
516 Ga0157369_10528808
517 Ga0157369_10571919
518 Ga0157378_10826942
519 Ga0157378_11160805
520 Ga0163162_10328282
521 Ga0157372_10001247
522 Ga0157372_10079872
523 Ga0157372_10224134
524 Ga0157372_10243188
525 Ga0157372_10323411
526 Ga0157372_10522543
527 Ga0157372_11203607
528 Ga0157372_11618828
529 Ga0157375_10310240
530 Ga0157375_10436119
531 Ga0157375_10708127
532 Ga0157375_11012361
533 Ga0157375_12766157
534 Ga0163163_10100437
535 Ga0163163_10573225
536 Ga0157379_10037111
537 Ga0157376_12060756
538 Ga0163161_10888803
539 Ga0206356_10365960
540 Ga0206356_11122092
541 Ga0206354_10003251
542 Ga0206354_10828677
543 Ga0206353_11269125
544 Ga0206353_11440359
545 Ga0154015_1303928
546 Ga0224712_10089240
547 Ga0207697_10338689
548 Ga0207688_10015916
549 Ga0207647_10062582
550 Ga0207647_10090327
551 Ga0207647_10272447
552 Ga0207705_10023812
553 Ga0207705_10057168
554 Ga0207705_10634490
555 Ga0207705_10647293
556 Ga0207705_11226252
557 Ga0207707_10229826
558 Ga0207660_10065570
559 Ga0207660_10609483
560 Ga0207657_10022965
561 Ga0207657_10097361
562 Ga0207652_10085680
563 Ga0207652_10209858
564 Ga0207652_10747216
565 Ga0207694_10220247
566 Ga0207694_10846411
567 Ga0207664_10011035
568 Ga0207690_10934318
569 Ga0207690_11053404
570 Ga0207686_10223518
571 Ga0207709_10263862
572 Ga0207704_10093517
573 Ga0207711_10291371
574 Ga0207661_10132306
575 Ga0207661_10328449
576 Ga0207679_12155964
577 Ga0207667_10069386
578 Ga0207712_10303084
579 Ga0207712_10966942
580 Ga0207640_10388492
581 Ga0207658_10042890
582 Ga0207703_10090326
583 Ga0207703_11538929
584 Ga0207639_10451630
585 Ga0207639_11903745
586 Ga0207678_10551193
587 Ga0207708_10035734
588 Ga0207702_10076419
589 Ga0207702_10330834
590 Ga0207674_10007640
591 Ga0207674_10205091
592 Ga0207674_10636901
593 Ga0207675_100104112
594 Ga0207698_10072311
595 Ga0209813_10000775
596 Ga0268266_10003653
597 Ga0268264_10015410
598 Ga0268264_10023919
599 Ga0307408_101257955
600 Ga0307405_10387151
601 Ga0307410_10121006
602 Ga0307406_10074610
603 Ga0307407_10004960
604 Ga0307407_10263109
605 Ga0307412_10313732
606 Ga0307409_100003456
607 Ga0307409_100230058
608 Ga0307409_100955130
609 Ga0307416_100003722
610 Ga0307416_100275809
611 Ga0307416_101710291
612 Ga0307411_10484898
613 Ga0307411_10920904
614 Ga0307415_100021021
615 Ga0307415_100507545
616 Ga0395900_0219114
617 Ga0395901_0027570
618 Ga0395901_0279936
619 Ga0436365_0634151
620 Ga0451800_0803671
621 Ga0451802_0326433
622 Ga0451835_0550863
623 Ga0451837_0121714
624 Ga0466972_0013452
625 Ga0466972_0293927
626 Ga0466965_0008563
627 Ga0466965_0051464
628 Ga0466965_0802491
629 Ga0466966_0417627
630 Ga0466963_0030760
631 Ga0466963_0119966
632 Ga0466963_0919565
633 Ga0466964_0011096
634 Ga0466964_0026454
635 Ga0466971_0208342
636 Ga0466970_0045942
637 Ga0466970_0053232
638 Ga0466970_0082852
639 Ga0466957_0666614
640 Ga0466960_0143642
641 Ga0451576_0028169
642 Ga0466967_0036324
643 Ga0466967_0072465
644 Ga0466967_0681173
645 Ga0466967_1663168
646 Ga0495592_0543426
647 Ga0495667_0225899
648 Ga0495657_0472563
649 Ga0495674_0288260
650 Ga0496100_0067954
651 Ga0496100_0306804
652 Ga0496100_0500668
653 Ga0496101_0019156
654 Ga0496101_0280434
655 Ga0496101_0730378
656 Ga0496101_1082084
657 Ga0496102_0003189
658 Ga0496102_0039261
659 Ga0496102_0944886
660 Ga0496102_1151388
661 Ga0496102_1770839
662 Ga0496103_0031368
663 Ga0496103_0037591
664 Ga0496103_0373765
665 Ga0496103_0687815
666 Ga0496104_0005564
667 Ga0496104_0023774
668 Ga0496105_0015125
669 Ga0496105_0035894
670 Ga0496105_0110269
671 Ga0496106_0606564
672 Ga0496106_0767531
673 Ga0496106_1536864
674 Ga0496107_0134625
675 Ga0496108_1190548
676 Ga0496109_0029037
677 Ga0496109_0040137
678 Ga0496109_0092509
679 Ga0496110_0150902
680 Ga0496111_0024332
681 Ga0496111_0073205
682 Ga0496111_0111550
683 Ga0496111_0742776
684 Ga0496112_0502995
685 Ga0496112_0989942
686 Ga0496113_0269589
687 Ga0496114_0002623
688 Ga0496114_0011415
689 Ga0496114_0026467
690 Ga0496114_0039911
691 Ga0496114_0103970
692 Ga0496114_0298567
693 Ga0496115_0011423
694 Ga0496115_0022614
695 Ga0496115_0089609
696 Ga0496115_1206700
697 Ga0501031_0113163
698 Ga0501033_0102033
699 Ga0501034_0010438
700 Ga0501034_0070540
701 Ga0501034_0260503
702 Ga0501036_0016568
703 Ga0501036_0173559
704 Ga0501036_0279210
705 Ga0501038_0005427
706 Ga0501038_0957830
707 Ga0501039_0085621
708 Ga0501039_0697492
709 Ga0501040_0250985
710 Ga0501040_0635824
711 Ga0501041_0885132
712 Ga0501042_0102827
713 Ga0501043_0112177
714 Ga0501046_0027105
715 Ga0501046_0545629
716 Ga0501047_0445462
717 Ga0501048_0076020
718 Ga0501048_0079585
719 Ga0501067_0031818
720 Ga0501068_0374228
721 Ga0501068_0876310
722 Ga0501069_0046722
723 Ga0501069_0116847
724 Ga0501069_0447326
725 Ga0501070_0091905
726 Ga0501070_0231846
727 Ga0501070_0565323
728 Ga0501070_1326306
729 Ga0501071_0020833
730 Ga0501071_0402510
731 Ga0501072_0149507
732 Ga0501072_0162192
733 Ga0501072_0684856
734 Ga0501072_1589793
735 Ga0501073_0035708
736 Ga0501073_0109529
737 Ga0501073_0659401
738 Ga0501074_0349597
739 Ga0501079_0027435
740 Ga0501079_1098702
741 Ga0501080_0083982
742 Ga0501081_0160646
743 Ga0501081_0212060
744 Ga0501035_0007262
745 Ga0501044_0011512
746 Ga0501045_0176183
747 Ga0501045_0290902
748 nmdc:mga03n38_1866_c1
749 nmdc:mga03n38_22423_c1
750 nmdc:mga03n38_239251_c1
751 nmdc:mga00v17_188483_c1
752 nmdc:mga00v17_252257_c1
753 nmdc:mga00v17_30284_c1
754 nmdc:mga00v17_360667_c1
755 nmdc:mga00v17_369803_c1
756 nmdc:mga00v17_417683_c1
757 nmdc:mga00v17_565556_c1
758 nmdc:mga00v17_75472_c1
759 nmdc:mga00v17_80621_c1
760 nmdc:mga00v17_85895_c1
761 nmdc:mga0yw44_113289_c1
762 nmdc:mga0yw44_12664_c1
763 nmdc:mga0yw44_129762_c1
764 nmdc:mga0yw44_143989_c1
765 nmdc:mga0yw44_2712_c1
766 nmdc:mga0yw44_31204_c1
767 nmdc:mga0yw44_32773_c1
768 nmdc:mga0yw44_367144_c1
769 nmdc:mga0yw44_37582_c1
770 nmdc:mga0yw44_428459_c1
771 nmdc:mga0yw44_456741_c1
772 nmdc:mga0yw44_49436_c1
773 nmdc:mga0yw44_794494_c1
774 nmdc:mga06z11_38951_c1
775 nmdc:mga06z11_422243_c1
776 nmdc:mga06z11_60467_c1
777 nmdc:mga06z11_63334_c1
778 nmdc:mga04h51_11300_c1
779 nmdc:mga04h51_313_c1
780 nmdc:mga07m45_12092_c1
781 nmdc:mga07m45_46114_c2
782 nmdc:mga07m45_49571_c1
783 nmdc:mga08y16_470158_c1
784 Ga0495655_0016849
785 Ga0495595_0257073
786 Ga0495619_0014986
787 Ga0500644_0000181
788 Ga0500644_0025268
789 Ga0500554_007601
790 Ga0500556_0000483
791 Ga0500573_0049807
792 Ga0500573_0131344
793 Ga0590074_063684
794 Ga0587083_0236744
795 Ga0501082_0182292
796 2643824863
797 2644532586
798 2812330013
799 2855390116
800 2857484941

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07332

Phage_holin_3_6

Putative Actinobacterial Holin-X, holin superfamily III

14

131

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j10-assembly1.cif.gz_A the crystal structure of a secreted protein esxb (semet-labeled) from bacillus anthracis str. sterne 0.8476 42 119
4j7k-assembly1.cif.gz_A the crystal structure of a secreted protein esxb (mutant e54q) from bacillus anthracis str. sterne 0.8426 42 119
4j41-assembly1.cif.gz_B the crystal structure of a secreted protein esxb (mutant p67a) from bacillus anthracis str. sterne 0.8365 42 119
4j41-assembly3.cif.gz_E the crystal structure of a secreted protein esxb (mutant p67a) from bacillus anthracis str. sterne 0.8364 42 115
3gwk-assembly1.cif.gz_C structure of the homodimeric wxg-100 family protein from streptococcus agalactiae 0.8194 42 124
ID Description Score Start End Superfamily
af_A0A0G2JX93_513_695_1.20.1050.20 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2;STAT transcription factor, all-alpha domain 0.8868 27 113 1.20.1050.20
3tklB02 Special;Helix non-globular;Helix Hairpins; 0.878 48 107 6.10.140.990
af_Q9W0C5_130_468_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.8429 44 113 1.20.1560.10
2vs0B00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.8199 42 118 1.10.287.1060
2vs0A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.8175 42 117 1.10.287.1060
ID Description Score Start End GO Terms
AF-A0A3D2U5U9-F1-model_v4 Uncharacterized protein 0.8858 26 115
AF-W0Z8T9-F1-model_v4 PE domain-containing protein 0.8596 42 126
AF-A0A3E4YM75-F1-model_v4 Uncharacterized protein 0.8569 38 122 GO:0016020
AF-A0A7W1B2Q4-F1-model_v4 YbaB/EbfC DNA-binding family protein 0.8477 38 125
AF-A0A3D5CRN2-F1-model_v4 DUF2479 domain-containing protein 0.8387 36 124

Map