F434475

General Info

Members Datasets Scaffolds Average Seq Length
400 212 383 449

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10118507|rootH1_1011850710
Length 493
Sequence MFRVSNTHYIKKNYFAHLTIAYLTIIKRLLMASIPVAGSVKTTKPTLKFFQLLNMSFGFFGIQFGWDLQRANMGPIYEYLKASPDQIPLLFLAAPLTGLLVQPIIGYMSDRTWHPWWGRRRPYFFVGAVLSTICLFFMPNSSALWMAAGLLWILDTSGNIAMEPFRAFVADMLPEHQRTAGFATQSFMIALGGCIASALPWIMSNIFKVSNVAENGNIPNSVKYAFYAGGSIFLAAVLYTIFTTKEYPPTEAELTERKQAGKTSGFAEINHAIFNMPAKMKQLALVQFFTWPGLFLMWFYYNTAVANNVFHGNTETSPKLYSEGTEFGGLTLAYYNIVAFVFALMIPAISKKLGRKATHALCLLCGAVGLISVGFVTEKHELFFCMTGVGIAWTSILSMPYAMLAGALPENKIGVYMGIFNFFIVLPEIIASLFFGWIMQHLLNNNRMLAVQIGGAMMVLAALICYFLVKERKNEDASDAEIATLEIEEQRSV

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 2738541283 Pedobacter sp. OK701 Isolate Unclassified
3 2738541284 Pedobacter sp. YR016 Isolate Unclassified
4 2738541302 Pedobacter sp. CF074 Isolate Unclassified
5 2738543023 Pedobacter sp. OK628 Isolate Unclassified
6 2739367651 Pedobacter sp. OK291 Isolate Unclassified
7 2739367656 Pedobacter sp. CF523 Isolate Unclassified
8 2739367663 Pedobacter sp. YR510 Isolate Unclassified
9 2818991437 Pedobacter terrae 518 Isolate Unclassified
10 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
11 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
12 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
13 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
14 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
15 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
16 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
17 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
20 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
21 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
28 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
170 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
171 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
211 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
212 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.75
Metatranscriptomes 0
Isolates 4.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.25
Nodule 0
Rhizoplane 0.25
Rhizosphere 88.75
Stem 0
Stem Tuber 0
Unclassified 6.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10011875 3300001990 Bacteria 2846
2 JGI24751J29686_10012971 3300002459 Bacteria 1721
3 JGI25152J39213_1000006 3300002773 Bacteria 158516
4 JGI25150J39212_1000005 3300002774 Bacteria 311800
5 JGI25151J46595_10000004 3300003187 Bacteria 494006
6 JGI25153J46596_10000004 3300003215 Bacteria 494006
7 rootH2_10008353 3300003320 Bacteria 41961
8 rootH2_10274592 3300003320 Bacteria 2323
9 rootL2_10235903 3300003322 Bacteria 2455
10 rootL2_10274355 3300003322 Bacteria 2576
11 rootH1_10001823 3300003323 Bacteria 1539
12 rootH1_10003476 3300003323 Bacteria 16026
13 rootH1_10008561 3300003323 Bacteria 7304
14 rootH1_10118507 3300003323 Bacteria 10343
15 JGI25160J50197_1013841 3300003354 Bacteria 2730
16 Ga0055536_1000016 3300003781 Bacteria 222134
17 Ga0065714_10064640 3300005288 Bacteria 26501
18 Ga0065714_10073212 3300005288 Bacteria 3214
19 Ga0070658_10000045 3300005327 Bacteria 130728
20 Ga0070676_10000440 3300005328 Bacteria 19779
21 Ga0070676_10013860 3300005328 Bacteria 4423
22 Ga0070683_100005163 3300005329 Bacteria 10861
23 Ga0070683_100012705 3300005329 Bacteria 7323
24 Ga0070690_100017882 3300005330 Bacteria 4273
25 Ga0070690_100019337 3300005330 Bacteria 4131
26 Ga0070690_100055381 3300005330 Bacteria 2540
27 Ga0068869_100002835 3300005334 Bacteria 10510
28 Ga0068869_100004176 3300005334 Bacteria 8960
29 Ga0068869_100068142 3300005334 Bacteria 2627
30 Ga0068869_100068450 3300005334 Bacteria 2622
31 Ga0068869_100108420 3300005334 Bacteria 2110
32 Ga0070666_10014834 3300005335 Bacteria 4966
33 Ga0070682_100000037 3300005337 Bacteria 147526
34 Ga0068868_100002223 3300005338 Bacteria 13407
35 Ga0068868_100045425 3300005338 Bacteria 3436
36 Ga0068868_100046999 3300005338 Unclassified 3380
37 Ga0068868_100200627 3300005338 Bacteria 1663
38 Ga0070660_100010017 3300005339 Bacteria 6684
39 Ga0070689_100041611 3300005340 Bacteria 3527
40 Ga0070689_100154437 3300005340 Bacteria 1852
41 Ga0070661_100141943 3300005344 Bacteria 1810
42 Ga0070675_100040186 3300005354 Bacteria 3818
43 Ga0070671_100019643 3300005355 Bacteria 5501
44 Ga0070671_100118737 3300005355 Bacteria 2225
45 Ga0070673_100000911 3300005364 Bacteria 16687
46 Ga0070673_100024191 3300005364 Bacteria 4449
47 Ga0070673_100184490 3300005364 Unclassified 1788
48 Ga0070688_100024331 3300005365 Bacteria 3572
49 Ga0070659_100129043 3300005366 Bacteria 2052
50 Ga0070667_100001618 3300005367 Bacteria 20179
51 Ga0070667_100029842 3300005367 Bacteria 4546
52 Ga0070667_100042079 3300005367 Bacteria 3832
53 Ga0070700_100053389 3300005441 Bacteria 2522
54 Ga0070663_100146555 3300005455 Bacteria 1807
55 Ga0070678_100084463 3300005456 Unclassified 2417
56 Ga0070662_100028178 3300005457 Unclassified 3906
57 Ga0070681_10040334 3300005458 Unclassified 4678
58 Ga0068867_100003077 3300005459 Bacteria 11753
59 Ga0068867_100018187 3300005459 Bacteria 4994
60 Ga0068867_100054370 3300005459 Bacteria 2958
61 Ga0070685_10010307 3300005466 Bacteria 4853
62 Ga0070685_10015920 3300005466 Bacteria 4000
63 Ga0070698_100010788 3300005471 Bacteria 9722
64 Ga0070698_100025539 3300005471 Bacteria 6158
65 Ga0070698_100026883 3300005471 Bacteria 5984
66 Ga0070679_100093937 3300005530 Bacteria 2986
67 Ga0070684_100005282 3300005535 Bacteria 9884
68 Ga0070684_100022045 3300005535 Bacteria 5308
69 Ga0070684_100095318 3300005535 Unclassified 2651
70 Ga0068853_100010180 3300005539 Bacteria 7600
71 Ga0068853_100035193 3300005539 Bacteria 4253
72 Ga0068853_100037208 3300005539 Bacteria 4140
73 Ga0068853_100062374 3300005539 Bacteria 3226
74 Ga0070672_100072445 3300005543 Bacteria 2743
75 Ga0070665_100000034 3300005548 Bacteria 324289
76 Ga0068855_100064369 3300005563 Bacteria 4276
77 Ga0068855_100065661 3300005563 Bacteria 4230
78 Ga0068855_100108828 3300005563 Bacteria 3183
79 Ga0070664_100003366 3300005564 Bacteria 12922
80 Ga0070664_100005390 3300005564 Bacteria 10269
81 Ga0070664_100115909 3300005564 Bacteria 2342
82 Ga0070664_100284215 3300005564 Unclassified 1492
83 Ga0068857_100012251 3300005577 Bacteria 7460
84 Ga0068857_100019945 3300005577 Bacteria 5893
85 Ga0068857_100034940 3300005577 Bacteria 4448
86 Ga0068854_100028784 3300005578 Bacteria 3842
87 Ga0068856_100044380 3300005614 Bacteria 4375
88 Ga0068852_100002097 3300005616 Bacteria 13635
89 Ga0068852_100007910 3300005616 Bacteria 7789
90 Ga0068852_100016172 3300005616 Bacteria 5810
91 Ga0068852_100022874 3300005616 Bacteria 5021
92 Ga0068852_100089035 3300005616 Bacteria 2758
93 Ga0068852_100175452 3300005616 Unclassified 2012
94 Ga0068859_100000018 3300005617 Bacteria 248813
95 Ga0068859_100040068 3300005617 Bacteria 4701
96 Ga0068859_100079413 3300005617 Unclassified 3321
97 Ga0068859_100090695 3300005617 Bacteria 3107
98 Ga0068859_100154660 3300005617 Bacteria 2370
99 Ga0068863_100015643 3300005841 Bacteria 7287
100 Ga0068863_100016742 3300005841 Bacteria 7033
101 Ga0068863_100068164 3300005841 Unclassified 3366
102 Ga0068863_100116834 3300005841 Bacteria 2542
103 Ga0068858_100043435 3300005842 Bacteria 4167
104 Ga0068858_100212120 3300005842 Bacteria 1833
105 Ga0068860_100003468 3300005843 Bacteria 16226
106 Ga0068860_100004436 3300005843 Bacteria 14329
107 Ga0068860_100005855 3300005843 Bacteria 12375
108 Ga0068860_100036026 3300005843 Unclassified 4743
109 Ga0068860_100184952 3300005843 Bacteria 2015
110 Ga0081539_10000910 3300005985 Bacteria 55996
111 Ga0097621_100001767 3300006237 Bacteria 14838
112 Ga0097621_100189993 3300006237 Bacteria 1778
113 Ga0068871_100000674 3300006358 Bacteria 23358
114 Ga0068871_100119418 3300006358 Unclassified 2225
115 Ga0068871_100170847 3300006358 Bacteria 1863
116 Ga0068871_100268113 3300006358 Bacteria 1491
117 Ga0075428_100066559 3300006844 Bacteria 3944
118 Ga0075430_100037921 3300006846 Bacteria 4086
119 Ga0075429_100198940 3300006880 Bacteria 1755
120 Ga0068865_100000852 3300006881 Bacteria 17266
121 Ga0097620_100000018 3300006931 Bacteria 248813
122 Ga0097620_100040068 3300006931 Bacteria 4701
123 Ga0097620_100079414 3300006931 Unclassified 3321
124 Ga0097620_100090692 3300006931 Bacteria 3107
125 Ga0097620_100154677 3300006931 Bacteria 2370
126 Ga0105240_10004401 3300009093 Bacteria 21482
127 Ga0105240_10009243 3300009093 Bacteria 13982
128 Ga0105240_10013679 3300009093 Bacteria 11129
129 Ga0105240_10020923 3300009093 Bacteria 8711
130 Ga0105240_10092113 3300009093 Bacteria 3702
131 Ga0105240_10177290 3300009093 Bacteria 2519
132 Ga0105240_10278708 3300009093 Bacteria 1922
133 Ga0105243_10104431 3300009148 Unclassified 2359
134 Ga0105241_10001132 3300009174 Bacteria 20319
135 Ga0105241_10014081 3300009174 Bacteria 5861
136 Ga0105241_10095524 3300009174 Bacteria 2353
137 Ga0105242_10020223 3300009176 Bacteria 5219
138 Ga0105242_10024058 3300009176 Bacteria 4808
139 Ga0105242_10169099 3300009176 Bacteria 1920
140 Ga0105248_10425383 3300009177 Bacteria 1496
141 Ga0105237_10001570 3300009545 Bacteria 29798
142 Ga0105237_10002418 3300009545 Bacteria 23177
143 Ga0105237_10004538 3300009545 Bacteria 16046
144 Ga0105237_10015491 3300009545 Bacteria 7934
145 Ga0105237_10054974 3300009545 Bacteria 3988
146 Ga0105237_10101954 3300009545 Bacteria 2862
147 Ga0105237_10293241 3300009545 Bacteria 1629
148 Ga0105238_10018039 3300009551 Bacteria 7173
149 Ga0105238_10142254 3300009551 Unclassified 2375
150 Ga0105249_10008923 3300009553 Bacteria 8758
151 Ga0105249_10009250 3300009553 Bacteria 8615
152 Ga0105249_10115415 3300009553 Bacteria 2544
153 Ga0105239_10000059 3300010375 Bacteria 155685
154 Ga0105239_10011135 3300010375 Bacteria 10040
155 Ga0105239_10018874 3300010375 Bacteria 7619
156 Ga0105239_10053892 3300010375 Bacteria 4411
157 Ga0105239_10073701 3300010375 Bacteria 3753
158 Ga0105239_10123644 3300010375 Bacteria 2875
159 Ga0105246_10075759 3300011119 Bacteria 2383
160 Ga0157373_10006242 3300013100 Bacteria 8906
161 Ga0157371_10000027 3300013102 Bacteria 269243
162 Ga0157370_10000084 3300013104 Bacteria 104159
163 Ga0157370_10000961 3300013104 Bacteria 36550
164 Ga0157370_10011877 3300013104 Bacteria 9084
165 Ga0157370_10030279 3300013104 Bacteria 5304
166 Ga0157370_10057554 3300013104 Bacteria 3696
167 Ga0157370_10120200 3300013104 Bacteria 2453
168 Ga0157370_10204297 3300013104 Bacteria 1832
169 Ga0157369_10000169 3300013105 Bacteria 91977
170 Ga0157369_10074435 3300013105 Bacteria 3642
171 Ga0157369_10189143 3300013105 Bacteria 2163
172 Ga0157369_10208957 3300013105 Bacteria 2046
173 Ga0157374_10001036 3300013296 Bacteria 24103
174 Ga0157374_10003671 3300013296 Bacteria 12902
175 Ga0157374_10005265 3300013296 Bacteria 10857
176 Ga0157378_10008532 3300013297 Bacteria 8921
177 Ga0157378_10016493 3300013297 Bacteria 6470
178 Ga0157378_10019500 3300013297 Bacteria 5962
179 Ga0157378_10038883 3300013297 Bacteria 4218
180 Ga0163162_10000116 3300013306 Bacteria 70911
181 Ga0163162_10000349 3300013306 Bacteria 42017
182 Ga0163162_10000728 3300013306 Bacteria 30520
183 Ga0163162_10001022 3300013306 Bacteria 25996
184 Ga0163162_10004179 3300013306 Bacteria 13876
185 Ga0163162_10182301 3300013306 Bacteria 2226
186 Ga0163162_10194024 3300013306 Bacteria 2159
187 Ga0157372_10000915 3300013307 Bacteria 32101
188 Ga0157372_10002859 3300013307 Bacteria 18657
189 Ga0157372_10045444 3300013307 Bacteria 4872
190 Ga0157372_10216722 3300013307 Bacteria 2219
191 Ga0157372_10368905 3300013307 Bacteria 1673
192 Ga0157375_10016912 3300013308 Bacteria 6570
193 Ga0157375_10024211 3300013308 Bacteria 5615
194 Ga0157375_10129621 3300013308 Bacteria 2640
195 Ga0157375_10157260 3300013308 Bacteria 2412
196 Ga0163163_10000462 3300014325 Bacteria 37124
197 Ga0157380_10007169 3300014326 Bacteria 7900
198 Ga0157380_10098526 3300014326 Bacteria 2429
199 Ga0182008_10000631 3300014497 Bacteria 25814
200 Ga0182008_10000840 3300014497 Bacteria 21424
201 Ga0157379_10006351 3300014968 Bacteria 10181
202 Ga0157379_10117789 3300014968 Bacteria 2389
203 Ga0157379_10205278 3300014968 Bacteria 1782
204 Ga0157376_10176859 3300014969 Unclassified 1947
205 Ga0182006_1000236 3300015261 Bacteria 52217
206 Ga0182006_1000346 3300015261 Bacteria 39502
207 Ga0182007_10000016 3300015262 Bacteria 202375
208 Ga0183373_1012 3300015682 Bacteria 118834
209 Ga0163161_10000281 3300017792 Bacteria 44484
210 Ga0163161_10003150 3300017792 Bacteria 11638
211 Ga0163161_10043964 3300017792 Bacteria 3216
212 Ga0163161_10054796 3300017792 Bacteria 2894
213 Ga0163161_10102411 3300017792 Bacteria 2132
214 Ga0163161_10164258 3300017792 Bacteria 1694
215 Ga0207425_1000008 3300025245 Bacteria 618024
216 Ga0209129_1000040 3300025258 Bacteria 313043
217 Ga0209676_1000106 3300025292 Bacteria 222576
218 Ga0209025_1000020 3300025294 Bacteria 618024
219 Ga0209758_1000022 3300025297 Bacteria 618024
220 Ga0209050_1000456 3300025298 Bacteria 73296
221 Ga0207426_1000105 3300025302 Bacteria 247269
222 Ga0207682_10015382 3300025893 Unclassified 2978
223 Ga0207680_10113868 3300025903 Bacteria 1759
224 Ga0207647_10000238 3300025904 Bacteria 45001
225 Ga0207647_10005656 3300025904 Bacteria 9130
226 Ga0207647_10085613 3300025904 Bacteria 1885
227 Ga0207645_10000169 3300025907 Bacteria 51953
228 Ga0207645_10046317 3300025907 Bacteria 2778
229 Ga0207705_10000080 3300025909 Bacteria 119562
230 Ga0207654_10001629 3300025911 Bacteria 11731
231 Ga0207654_10006884 3300025911 Bacteria 5722
232 Ga0207707_10123322 3300025912 Bacteria 2266
233 Ga0207695_10020922 3300025913 Bacteria 7477
234 Ga0207695_10085691 3300025913 Unclassified 3179
235 Ga0207671_10002601 3300025914 Bacteria 19061
236 Ga0207671_10005892 3300025914 Bacteria 11119
237 Ga0207671_10027635 3300025914 Bacteria 4241
238 Ga0207671_10118176 3300025914 Bacteria 2024
239 Ga0207671_10186379 3300025914 Bacteria 1617
240 Ga0207662_10036227 3300025918 Bacteria 2883
241 Ga0207662_10076106 3300025918 Bacteria 2039
242 Ga0207657_10017621 3300025919 Bacteria 6842
243 Ga0207649_10012880 3300025920 Bacteria 4657
244 Ga0207694_10060487 3300025924 Bacteria 2948
245 Ga0207650_10022366 3300025925 Bacteria 4474
246 Ga0207644_10039019 3300025931 Bacteria 3350
247 Ga0207644_10047472 3300025931 Bacteria 3065
248 Ga0207644_10143181 3300025931 Unclassified 1843
249 Ga0207690_10160023 3300025932 Bacteria 1678
250 Ga0207706_10000306 3300025933 Bacteria 53202
251 Ga0207706_10086234 3300025933 Bacteria 2760
252 Ga0207686_10000871 3300025934 Bacteria 18250
253 Ga0207686_10016813 3300025934 Bacteria 4109
254 Ga0207670_10037170 3300025936 Bacteria 3172
255 Ga0207704_10000153 3300025938 Bacteria 37136
256 Ga0207691_10010452 3300025940 Bacteria 8904
257 Ga0207691_10021442 3300025940 Bacteria 6100
258 Ga0207691_10112628 3300025940 Bacteria 2418
259 Ga0207689_10003204 3300025942 Bacteria 14989
260 Ga0207689_10006469 3300025942 Bacteria 10352
261 Ga0207689_10022257 3300025942 Bacteria 5329
262 Ga0207661_10006593 3300025944 Bacteria 8209
263 Ga0207661_10022026 3300025944 Bacteria 4789
264 Ga0207661_10029721 3300025944 Bacteria 4201
265 Ga0207679_10012957 3300025945 Bacteria 5456
266 Ga0207679_10016811 3300025945 Bacteria 4864
267 Ga0207679_10020859 3300025945 Bacteria 4431
268 Ga0207667_10001931 3300025949 Bacteria 25993
269 Ga0207667_10060670 3300025949 Bacteria 3958
270 Ga0207667_10128611 3300025949 Bacteria 2609
271 Ga0207667_10181858 3300025949 Bacteria 2159
272 Ga0207651_10058718 3300025960 Bacteria 2660
273 Ga0207651_10193240 3300025960 Unclassified 1625
274 Ga0207712_10003499 3300025961 Bacteria 9907
275 Ga0207712_10003647 3300025961 Bacteria 9701
276 Ga0207712_10010604 3300025961 Bacteria 5850
277 Ga0207658_10002346 3300025986 Bacteria 13910
278 Ga0207658_10112232 3300025986 Unclassified 2157
279 Ga0207677_10008418 3300026023 Bacteria 5757
280 Ga0207677_10018506 3300026023 Bacteria 4182
281 Ga0207677_10029703 3300026023 Unclassified 3478
282 Ga0207677_10149087 3300026023 Bacteria 1802
283 Ga0207639_10008430 3300026041 Bacteria 7063
284 Ga0207639_10019290 3300026041 Bacteria 4862
285 Ga0207639_10067147 3300026041 Bacteria 2790
286 Ga0207639_10254037 3300026041 Bacteria 1534
287 Ga0207708_10053090 3300026075 Bacteria 3087
288 Ga0207641_10001587 3300026088 Bacteria 22194
289 Ga0207648_10000123 3300026089 Bacteria 76156
290 Ga0207648_10000260 3300026089 Bacteria 57280
291 Ga0207648_10019700 3300026089 Bacteria 6088
292 Ga0207648_10045330 3300026089 Bacteria 3857
293 Ga0207648_10111037 3300026089 Bacteria 2407
294 Ga0207674_10001616 3300026116 Bacteria 28994
295 Ga0207674_10007805 3300026116 Bacteria 12445
296 Ga0207674_10017392 3300026116 Bacteria 7846
297 Ga0207674_10019078 3300026116 Bacteria 7434
298 Ga0207675_100086308 3300026118 Bacteria 2947
299 Ga0207675_100128241 3300026118 Bacteria 2404
300 Ga0207683_10002148 3300026121 Bacteria 17325
301 Ga0207683_10019309 3300026121 Bacteria 5819
302 Ga0207698_10012345 3300026142 Bacteria 5587
303 Ga0207698_10040322 3300026142 Bacteria 3468
304 Ga0207698_10133105 3300026142 Bacteria 2128
305 Ga0207698_10209732 3300026142 Bacteria 1752
306 Ga0268266_10000111 3300028379 Bacteria 169743
307 Ga0268265_10126513 3300028380 Bacteria 2116
308 Ga0268264_10006048 3300028381 Bacteria 10229
309 Ga0268264_10011391 3300028381 Bacteria 7346
310 Ga0307515_10000001 3300028794 Bacteria 4259510
311 Ga0307515_10005328 3300028794 Bacteria 26136
312 Ga0307515_10009352 3300028794 Bacteria 18961
313 Ga0265327_10000122 3300031251 Bacteria 169992
314 Ga0265327_10000383 3300031251 Bacteria 83372
315 Ga0307405_10000025 3300031731 Bacteria 123095
316 Ga0307407_10000016 3300031903 Bacteria 141499
317 Ga0307416_100000036 3300032002 Bacteria 141505
318 Ga0307414_10010950 3300032004 Bacteria 5296
319 Ga0373924_0032524 3300035410 Unclassified 2102
320 Ga0373933_0025519 3300035724 Unclassified 3390
321 Ga0373947_0064175 3300035725 Bacteria 2239
322 Ga0373937_0043154 3300036401 Bacteria 4115
323 Ga0395899_0000289 3300037312 Bacteria 64799
324 Ga0395900_0000370 3300037418 Bacteria 64745
325 Ga0395900_0117241 3300037418 Bacteria 2732
326 Ga0395905_0000529 3300037471 Bacteria 52320
327 Ga0395905_0002186 3300037471 Bacteria 22096
328 Ga0395905_0036043 3300037471 Bacteria 4646
329 Ga0395905_0071095 3300037471 Bacteria 3262
330 Ga0395905_0082945 3300037471 Bacteria 3004
331 Ga0436364_1538660 3300037853 Bacteria 2661
332 Ga0395901_0002303 3300038443 Bacteria 19465
333 Ga0395901_0013745 3300038443 Bacteria 8228
334 Ga0436365_1289625 3300039437 Bacteria 1763
335 Ga0439448_0002688 3300042005 Bacteria 4857
336 Ga0439449_0012198 3300042007 Bacteria 3231
337 Ga0453683_0090112 3300044673 Bacteria 1922
338 Ga0495594_0088886 3300046499 Bacteria 1730
339 Ga0495606_0026176 3300046507 Bacteria 4160
340 Ga0495610_0000039 3300046512 Bacteria 166799
341 Ga0495610_0000103 3300046512 Bacteria 98502
342 Ga0495628_0066093 3300046516 Unclassified 2827
343 Ga0495644_0008689 3300046523 Bacteria 3909
344 Ga0495587_0105021 3300046536 Unclassified 1625
345 Ga0495645_0215900 3300046543 Bacteria 1293
346 Ga0495633_0000027 3300046558 Bacteria 204613
347 Ga0495667_0106776 3300046559 Unclassified 1809
348 Ga0495604_0094785 3300047317 Unclassified 2206
349 Ga0495674_0293559 3300047319 Bacteria 1329
350 Ga0495672_0060219 3300047320 Bacteria 2194
351 Ga0495680_0150217 3300047322 Bacteria 1699
352 Ga0495684_0078407 3300047471 Bacteria 2507
353 Ga0496110_0142314 3300048913 Bacteria 2168
354 Ga0496122_0000837 3300048925 Bacteria 58147
355 Ga0496123_0007556 3300048926 Bacteria 10187
356 Ga0496125_0033596 3300048928 Bacteria 4536
357 Ga0501032_0024195 3300049569 Bacteria 4195
358 Ga0501032_0120988 3300049569 Unclassified 1730
359 Ga0501036_0002153 3300049572 Bacteria 15381
360 Ga0501036_0009142 3300049572 Bacteria 8147
361 Ga0501037_0030605 3300049573 Bacteria 3977
362 Ga0501038_0054614 3300049574 Bacteria 3435
363 Ga0501038_0220991 3300049574 Unclassified 1511
364 Ga0501039_0020511 3300049575 Bacteria 5064
365 Ga0501043_0049446 3300049579 Bacteria 3305
366 Ga0501046_0073834 3300049580 Unclassified 2646
367 Ga0501047_0029964 3300049581 Bacteria 5245
368 Ga0501048_0081209 3300049582 Unclassified 2287
369 Ga0501074_0005654 3300049590 Bacteria 9008
370 Ga0501252_001105 3300049682 Bacteria 2389
371 Ga0501080_0284673 3300049742 Bacteria 1502
372 Ga0501083_0002034 3300049744 Bacteria 13918
373 Ga0501035_0036875 3300049822 Bacteria 4430
374 Ga0501044_0112162 3300049823 Bacteria 2734
375 Ga0501045_0076092 3300049824 Bacteria 2473
376 nmdc:mga0k408_3088_c1 3300050493 Bacteria 8817
377 nmdc:mga09592_181121_c1 3300050508 Bacteria 1823
378 nmdc:mga09592_8732_c1 3300050508 Bacteria 8245
379 nmdc:mga0qj67_34529_c1 3300050509 Bacteria 3950
380 Ga0495619_0028005 3300053085 Bacteria 3633
381 Ga0500641_0005802 3300053096 Bacteria 4373
382 Ga0500618_000012 3300053125 Bacteria 185382
383 Ga0500568_0000495 3300053139 Bacteria 29013

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035725 Ga0373947_0064175 Ga0373947_0064175_1045_2160 344
2 3300046536 Ga0495587_0105021 Ga0495587_0105021_73_1188 344
3 3300046543 Ga0495645_0215900 Ga0495645_0215900_138_1253 344
4 3300047319 Ga0495674_0293559 Ga0495674_0293559_150_1265 344
5 3300049822 Ga0501035_0036875 Ga0501035_0036875_3088_4413 388
6 3300014326 Ga0157380_10098526 Ga0157380_100985262 392
7 3300009093 Ga0105240_10092113 Ga0105240_100921132 396
8 3300005841 Ga0068863_100116834 Ga0068863_1001168341 404
9 3300005355 Ga0070671_100019643 Ga0070671_1000196432 407
10 3300006358 Ga0068871_100268113 Ga0068871_1002681131 407
11 3300013297 Ga0157378_10016493 Ga0157378_100164934 407
12 3300025931 Ga0207644_10039019 Ga0207644_100390192 407
13 3300025960 Ga0207651_10058718 Ga0207651_100587182 407
14 3300026023 Ga0207677_10018506 Ga0207677_100185063 407
15 3300049569 Ga0501032_0024195 Ga0501032_0024195_185_1567 407
16 3300049572 Ga0501036_0002153 Ga0501036_0002153_5487_6869 407
17 3300049573 Ga0501037_0030605 Ga0501037_0030605_1437_2819 407
18 3300049574 Ga0501038_0054614 Ga0501038_0054614_1045_2427 407
19 3300049575 Ga0501039_0020511 Ga0501039_0020511_3240_4622 407
20 3300049579 Ga0501043_0049446 Ga0501043_0049446_280_1662 407
21 3300042005 Ga0439448_0002688 Ga0439448_0002688_1525_2793 408
22 3300005340 Ga0070689_100041611 Ga0070689_1000416112 411
23 3300005365 Ga0070688_100024331 Ga0070688_1000243313 411
24 3300005466 Ga0070685_10010307 Ga0070685_100103072 411
25 3300005617 Ga0068859_100154660 Ga0068859_1001546602 411
26 3300006931 Ga0097620_100154677 Ga0097620_1001546772 411
27 3300013306 Ga0163162_10000116 Ga0163162_1000011641 411
28 3300017792 Ga0163161_10102411 Ga0163161_101024112 411
29 3300025893 Ga0207682_10015382 Ga0207682_100153822 411
30 3300025925 Ga0207650_10022366 Ga0207650_100223663 411
31 3300026121 Ga0207683_10019309 Ga0207683_100193093 411
32 3300005471 Ga0070698_100025539 Ga0070698_1000255394 413
33 3300028794 Ga0307515_10005328 Ga0307515_1000532823 413
34 3300028794 Ga0307515_10009352 Ga0307515_1000935214 413
35 3300005334 Ga0068869_100004176 Ga0068869_1000041763 414
36 3300005334 Ga0068869_100108420 Ga0068869_1001084201 414
37 3300005340 Ga0070689_100154437 Ga0070689_1001544372 414
38 3300005364 Ga0070673_100184490 Ga0070673_1001844901 414
39 3300005456 Ga0070678_100084463 Ga0070678_1000844631 414
40 3300005457 Ga0070662_100028178 Ga0070662_1000281784 414
41 3300005471 Ga0070698_100010788 Ga0070698_1000107882 414
42 3300005842 Ga0068858_100212120 Ga0068858_1002121202 414
43 3300006237 Ga0097621_100189993 Ga0097621_1001899931 414
44 3300009093 Ga0105240_10177290 Ga0105240_101772902 414
45 3300013306 Ga0163162_10000728 Ga0163162_1000072823 414
46 3300014326 Ga0157380_10007169 Ga0157380_100071692 414
47 3300017792 Ga0163161_10164258 Ga0163161_101642582 414
48 3300025903 Ga0207680_10113868 Ga0207680_101138681 414
49 3300026041 Ga0207639_10254037 Ga0207639_102540371 414
50 3300046499 Ga0495594_0088886 Ga0495594_0088886_350_1675 414
51 3300049569 Ga0501032_0120988 Ga0501032_0120988_380_1705 414
52 3300050508 nmdc:mga09592_8732_c1 nmdc:mga09592_8732_c1_538_1863 414
53 3300050509 nmdc:mga0qj67_34529_c1 nmdc:mga0qj67_34529_c1_2184_3509 414
54 3300009093 Ga0105240_10020923 Ga0105240_100209233 415
55 3300009174 Ga0105241_10014081 Ga0105241_100140813 415
56 3300009176 Ga0105242_10024058 Ga0105242_100240582 415
57 3300009545 Ga0105237_10015491 Ga0105237_100154914 415
58 3300009545 Ga0105237_10101954 Ga0105237_101019542 415
59 3300009551 Ga0105238_10018039 Ga0105238_100180392 415
60 3300010375 Ga0105239_10011135 Ga0105239_100111353 415
61 3300010375 Ga0105239_10123644 Ga0105239_101236442 415
62 3300011119 Ga0105246_10075759 Ga0105246_100757592 415
63 3300013105 Ga0157369_10208957 Ga0157369_102089572 415
64 3300013296 Ga0157374_10001036 Ga0157374_1000103619 415
65 3300013296 Ga0157374_10003671 Ga0157374_100036713 415
66 3300037312 Ga0395899_0000289 Ga0395899_0000289_42884_44152 415
67 3300037418 Ga0395900_0000370 Ga0395900_0000370_46807_48075 415
68 3300037418 Ga0395900_0117241 Ga0395900_0117241_404_1672 415
69 3300037471 Ga0395905_0000529 Ga0395905_0000529_4476_5744 415
70 3300037471 Ga0395905_0002186 Ga0395905_0002186_16197_17465 415
71 3300038443 Ga0395901_0002303 Ga0395901_0002303_4070_5338 415
72 3300038443 Ga0395901_0013745 Ga0395901_0013745_3348_4616 415
73 3300053096 Ga0500641_0005802 Ga0500641_0005802_2088_3470 415
74 3300013307 Ga0157372_10368905 Ga0157372_103689052 416
75 3300009545 Ga0105237_10004538 Ga0105237_100045387 419
76 3300010375 Ga0105239_10018874 Ga0105239_100188743 419
77 3300037853 Ga0436364_1538660 Ga0436364_1538660_730_2055 421
78 3300005985 Ga0081539_10000910 Ga0081539_1000091026 423
79 3300005334 Ga0068869_100068450 Ga0068869_1000684502 424
80 3300005459 Ga0068867_100018187 Ga0068867_1000181873 424
81 3300009176 Ga0105242_10169099 Ga0105242_101690992 424
82 3300026089 Ga0207648_10000260 Ga0207648_1000026041 424
83 3300005458 Ga0070681_10040334 Ga0070681_100403342 425
84 3300009093 Ga0105240_10004401 Ga0105240_100044015 425
85 3300025912 Ga0207707_10123322 Ga0207707_101233222 425
86 3300046523 Ga0495644_0008689 Ga0495644_0008689_2460_3782 428
87 3300042007 Ga0439449_0012198 Ga0439449_0012198_150_1520 429
88 iso_pu_bacteria 2585427687 2586210206 429
89 iso_pu_bacteria 2738541283 2738758854 429
90 iso_pu_bacteria 2738541284 2738762068 429
91 iso_pu_bacteria 2738541302 2738854235 429
92 iso_pu_bacteria 2738543023 2739301952 429
93 iso_pu_bacteria 2739367663 2739647943 429
94 iso_pu_bacteria 2818991437 2819550187 429
95 iso_pu_bacteria 2842722452 2842726778 429
96 iso_pu_bacteria 2842909656 2842911619 429
97 iso_pu_bacteria 2849281842 2849285158 429
98 iso_pu_bacteria 2852623160 2852623984 429
99 iso_pu_bacteria 2857627736 2857630437 429
100 iso_pu_bacteria 2884933994 2884937113 429
101 iso_pu_bacteria 2904445276 2904449824 429
102 iso_pu_bacteria 2945997725 2946002908 429
103 3300005548 Ga0070665_100000034 Ga0070665_100000034325 430
104 3300005563 Ga0068855_100108828 Ga0068855_1001088282 430
105 3300028379 Ga0268266_10000111 Ga0268266_10000111151 430
106 3300031251 Ga0265327_10000122 Ga0265327_100001226 430
107 3300031251 Ga0265327_10000383 Ga0265327_1000038355 430
108 3300046558 Ga0495633_0000027 Ga0495633_0000027_34229_35542 430
109 3300053125 Ga0500618_000012 Ga0500618_000012_33291_34604 430
110 3300003320 rootH2_10274592 rootH2_102745921 431
111 3300003322 rootL2_10274355 rootL2_102743551 431
112 3300003323 rootH1_10008561 rootH1_100085612 431
113 3300003323 rootH1_10118507 rootH1_1011850710 431
114 3300003354 JGI25160J50197_1013841 JGI25160J50197_10138411 431
115 3300005614 Ga0068856_100044380 Ga0068856_1000443802 431
116 3300025302 Ga0207426_1000105 Ga0207426_1000105188 431
117 3300025940 Ga0207691_10112628 Ga0207691_101126282 431
118 3300046507 Ga0495606_0026176 Ga0495606_0026176_1961_3277 431
119 3300003323 rootH1_10003476 rootH1_100034763 432
120 3300003781 Ga0055536_1000016 Ga0055536_100001638 432
121 3300005337 Ga0070682_100000037 Ga0070682_10000003725 432
122 3300005338 Ga0068868_100045425 Ga0068868_1000454251 432
123 3300005367 Ga0070667_100001618 Ga0070667_10000161814 432
124 3300005367 Ga0070667_100029842 Ga0070667_1000298422 432
125 3300005539 Ga0068853_100035193 Ga0068853_1000351933 432
126 3300005563 Ga0068855_100064369 Ga0068855_1000643693 432
127 3300005577 Ga0068857_100019945 Ga0068857_1000199453 432
128 3300005578 Ga0068854_100028784 Ga0068854_1000287842 432
129 3300005616 Ga0068852_100007910 Ga0068852_1000079104 432
130 3300005617 Ga0068859_100000018 Ga0068859_100000018262 432
131 3300005617 Ga0068859_100079413 Ga0068859_1000794132 432
132 3300005841 Ga0068863_100015643 Ga0068863_1000156432 432
133 3300005843 Ga0068860_100003468 Ga0068860_10000346815 432
134 3300005843 Ga0068860_100004436 Ga0068860_10000443610 432
135 3300006931 Ga0097620_100000018 Ga0097620_100000018262 432
136 3300006931 Ga0097620_100079414 Ga0097620_1000794142 432
137 3300009093 Ga0105240_10009243 Ga0105240_100092432 432
138 3300009093 Ga0105240_10013679 Ga0105240_1001367910 432
139 3300009174 Ga0105241_10001132 Ga0105241_100011322 432
140 3300009174 Ga0105241_10095524 Ga0105241_100955241 432
141 3300009545 Ga0105237_10002418 Ga0105237_1000241820 432
142 3300009545 Ga0105237_10054974 Ga0105237_100549743 432
143 3300009545 Ga0105237_10293241 Ga0105237_102932412 432
144 3300009551 Ga0105238_10142254 Ga0105238_101422542 432
145 3300010375 Ga0105239_10000059 Ga0105239_1000005952 432
146 3300013104 Ga0157370_10011877 Ga0157370_100118772 432
147 3300013104 Ga0157370_10030279 Ga0157370_100302792 432
148 3300013104 Ga0157370_10057554 Ga0157370_100575542 432
149 3300013105 Ga0157369_10074435 Ga0157369_100744352 432
150 3300013297 Ga0157378_10038883 Ga0157378_100388832 432
151 3300013306 Ga0163162_10001022 Ga0163162_1000102221 432
152 3300013307 Ga0157372_10000915 Ga0157372_100009156 432
153 3300014968 Ga0157379_10006351 Ga0157379_100063513 432
154 3300025292 Ga0209676_1000106 Ga0209676_1000106166 432
155 3300025298 Ga0209050_1000456 Ga0209050_100045638 432
156 3300025911 Ga0207654_10001629 Ga0207654_100016298 432
157 3300025914 Ga0207671_10002601 Ga0207671_100026016 432
158 3300025914 Ga0207671_10005892 Ga0207671_100058924 432
159 3300025914 Ga0207671_10027635 Ga0207671_100276353 432
160 3300025914 Ga0207671_10186379 Ga0207671_101863792 432
161 3300025924 Ga0207694_10060487 Ga0207694_100604872 432
162 3300025949 Ga0207667_10001931 Ga0207667_1000193120 432
163 3300025949 Ga0207667_10181858 Ga0207667_101818582 432
164 3300025986 Ga0207658_10002346 Ga0207658_100023464 432
165 3300026041 Ga0207639_10067147 Ga0207639_100671472 432
166 3300026116 Ga0207674_10001616 Ga0207674_100016166 432
167 3300026142 Ga0207698_10012345 Ga0207698_100123453 432
168 3300028381 Ga0268264_10006048 Ga0268264_100060485 432
169 3300047317 Ga0495604_0094785 Ga0495604_0094785_30_1409 432
170 3300047320 Ga0495672_0060219 Ga0495672_0060219_534_1856 432
171 3300002459 JGI24751J29686_10012971 JGI24751J29686_100129712 433
172 3300002773 JGI25152J39213_1000006 JGI25152J39213_1000006124 433
173 3300002774 JGI25150J39212_1000005 JGI25150J39212_1000005110 433
174 3300003187 JGI25151J46595_10000004 JGI25151J46595_10000004278 433
175 3300003215 JGI25153J46596_10000004 JGI25153J46596_10000004278 433
176 3300003322 rootL2_10235903 rootL2_102359032 433
177 3300005288 Ga0065714_10064640 Ga0065714_1006464010 433
178 3300005288 Ga0065714_10073212 Ga0065714_100732121 433
179 3300005327 Ga0070658_10000045 Ga0070658_1000004545 433
180 3300005328 Ga0070676_10013860 Ga0070676_100138601 433
181 3300005329 Ga0070683_100005163 Ga0070683_1000051634 433
182 3300005329 Ga0070683_100012705 Ga0070683_1000127051 433
183 3300005330 Ga0070690_100017882 Ga0070690_1000178822 433
184 3300005330 Ga0070690_100019337 Ga0070690_1000193373 433
185 3300005330 Ga0070690_100055381 Ga0070690_1000553812 433
186 3300005334 Ga0068869_100002835 Ga0068869_1000028353 433
187 3300005334 Ga0068869_100068142 Ga0068869_1000681422 433
188 3300005335 Ga0070666_10014834 Ga0070666_100148346 433
189 3300005338 Ga0068868_100002223 Ga0068868_1000022235 433
190 3300005338 Ga0068868_100046999 Ga0068868_1000469992 433
191 3300005338 Ga0068868_100200627 Ga0068868_1002006271 433
192 3300005339 Ga0070660_100010017 Ga0070660_1000100172 433
193 3300005344 Ga0070661_100141943 Ga0070661_1001419432 433
194 3300005354 Ga0070675_100040186 Ga0070675_1000401861 433
195 3300005355 Ga0070671_100118737 Ga0070671_1001187372 433
196 3300005364 Ga0070673_100024191 Ga0070673_1000241912 433
197 3300005367 Ga0070667_100042079 Ga0070667_1000420794 433
198 3300005441 Ga0070700_100053389 Ga0070700_1000533892 433
199 3300005455 Ga0070663_100146555 Ga0070663_1001465552 433
200 3300005459 Ga0068867_100054370 Ga0068867_1000543702 433
201 3300005466 Ga0070685_10015920 Ga0070685_100159202 433
202 3300005471 Ga0070698_100026883 Ga0070698_1000268834 433
203 3300005530 Ga0070679_100093937 Ga0070679_1000939372 433
204 3300005535 Ga0070684_100005282 Ga0070684_1000052821 433
205 3300005535 Ga0070684_100022045 Ga0070684_1000220452 433
206 3300005535 Ga0070684_100095318 Ga0070684_1000953182 433
207 3300005539 Ga0068853_100037208 Ga0068853_1000372081 433
208 3300005539 Ga0068853_100062374 Ga0068853_1000623741 433
209 3300005563 Ga0068855_100065661 Ga0068855_1000656612 433
210 3300005564 Ga0070664_100003366 Ga0070664_1000033664 433
211 3300005564 Ga0070664_100005390 Ga0070664_1000053907 433
212 3300005564 Ga0070664_100115909 Ga0070664_1001159092 433
213 3300005564 Ga0070664_100284215 Ga0070664_1002842151 433
214 3300005577 Ga0068857_100012251 Ga0068857_1000122511 433
215 3300005577 Ga0068857_100034940 Ga0068857_1000349402 433
216 3300005616 Ga0068852_100016172 Ga0068852_1000161721 433
217 3300005616 Ga0068852_100022874 Ga0068852_1000228744 433
218 3300005616 Ga0068852_100089035 Ga0068852_1000890352 433
219 3300005616 Ga0068852_100175452 Ga0068852_1001754522 433
220 3300005617 Ga0068859_100040068 Ga0068859_1000400682 433
221 3300005617 Ga0068859_100090695 Ga0068859_1000906951 433
222 3300005841 Ga0068863_100016742 Ga0068863_1000167424 433
223 3300005841 Ga0068863_100068164 Ga0068863_1000681642 433
224 3300005842 Ga0068858_100043435 Ga0068858_1000434352 433
225 3300005843 Ga0068860_100005855 Ga0068860_1000058555 433
226 3300005843 Ga0068860_100036026 Ga0068860_1000360261 433
227 3300005843 Ga0068860_100184952 Ga0068860_1001849522 433
228 3300006358 Ga0068871_100119418 Ga0068871_1001194181 433
229 3300006358 Ga0068871_100170847 Ga0068871_1001708471 433
230 3300006844 Ga0075428_100066559 Ga0075428_1000665592 433
231 3300006846 Ga0075430_100037921 Ga0075430_1000379213 433
232 3300006880 Ga0075429_100198940 Ga0075429_1001989402 433
233 3300006931 Ga0097620_100040068 Ga0097620_1000400684 433
234 3300006931 Ga0097620_100090692 Ga0097620_1000906924 433
235 3300009093 Ga0105240_10278708 Ga0105240_102787082 433
236 3300009148 Ga0105243_10104431 Ga0105243_101044312 433
237 3300009176 Ga0105242_10020223 Ga0105242_100202233 433
238 3300009177 Ga0105248_10425383 Ga0105248_104253831 433
239 3300009545 Ga0105237_10001570 Ga0105237_100015707 433
240 3300009553 Ga0105249_10008923 Ga0105249_100089235 433
241 3300009553 Ga0105249_10009250 Ga0105249_100092507 433
242 3300009553 Ga0105249_10115415 Ga0105249_101154151 433
243 3300010375 Ga0105239_10053892 Ga0105239_100538922 433
244 3300010375 Ga0105239_10073701 Ga0105239_100737012 433
245 3300013100 Ga0157373_10006242 Ga0157373_100062424 433
246 3300013102 Ga0157371_10000027 Ga0157371_10000027228 433
247 3300013104 Ga0157370_10000084 Ga0157370_1000008430 433
248 3300013104 Ga0157370_10000961 Ga0157370_100009612 433
249 3300013104 Ga0157370_10120200 Ga0157370_101202001 433
250 3300013104 Ga0157370_10204297 Ga0157370_102042971 433
251 3300013105 Ga0157369_10000169 Ga0157369_1000016922 433
252 3300013105 Ga0157369_10189143 Ga0157369_101891432 433
253 3300013296 Ga0157374_10005265 Ga0157374_100052654 433
254 3300013297 Ga0157378_10008532 Ga0157378_100085325 433
255 3300013297 Ga0157378_10019500 Ga0157378_100195002 433
256 3300013306 Ga0163162_10000349 Ga0163162_1000034912 433
257 3300013306 Ga0163162_10004179 Ga0163162_100041793 433
258 3300013306 Ga0163162_10182301 Ga0163162_101823012 433
259 3300013306 Ga0163162_10194024 Ga0163162_101940241 433
260 3300013307 Ga0157372_10002859 Ga0157372_100028597 433
261 3300013307 Ga0157372_10045444 Ga0157372_100454442 433
262 3300013307 Ga0157372_10216722 Ga0157372_102167222 433
263 3300013308 Ga0157375_10016912 Ga0157375_100169126 433
264 3300013308 Ga0157375_10024211 Ga0157375_100242114 433
265 3300013308 Ga0157375_10129621 Ga0157375_101296212 433
266 3300013308 Ga0157375_10157260 Ga0157375_101572602 433
267 3300014325 Ga0163163_10000462 Ga0163163_1000046229 433
268 3300014497 Ga0182008_10000631 Ga0182008_1000063120 433
269 3300014497 Ga0182008_10000840 Ga0182008_100008405 433
270 3300014968 Ga0157379_10117789 Ga0157379_101177891 433
271 3300014968 Ga0157379_10205278 Ga0157379_102052781 433
272 3300014969 Ga0157376_10176859 Ga0157376_101768591 433
273 3300015261 Ga0182006_1000236 Ga0182006_100023641 433
274 3300015261 Ga0182006_1000346 Ga0182006_100034614 433
275 3300015262 Ga0182007_10000016 Ga0182007_1000001612 433
276 3300015682 Ga0183373_1012 Ga0183373_101219 433
277 3300017792 Ga0163161_10000281 Ga0163161_100002818 433
278 3300017792 Ga0163161_10003150 Ga0163161_100031504 433
279 3300017792 Ga0163161_10043964 Ga0163161_100439642 433
280 3300017792 Ga0163161_10054796 Ga0163161_100547962 433
281 3300025245 Ga0207425_1000008 Ga0207425_1000008159 433
282 3300025258 Ga0209129_1000040 Ga0209129_1000040106 433
283 3300025294 Ga0209025_1000020 Ga0209025_1000020159 433
284 3300025297 Ga0209758_1000022 Ga0209758_1000022159 433
285 3300025904 Ga0207647_10005656 Ga0207647_100056562 433
286 3300025904 Ga0207647_10085613 Ga0207647_100856132 433
287 3300025907 Ga0207645_10046317 Ga0207645_100463172 433
288 3300025909 Ga0207705_10000080 Ga0207705_1000008082 433
289 3300025913 Ga0207695_10085691 Ga0207695_100856912 433
290 3300025918 Ga0207662_10036227 Ga0207662_100362273 433
291 3300025918 Ga0207662_10076106 Ga0207662_100761061 433
292 3300025919 Ga0207657_10017621 Ga0207657_100176214 433
293 3300025920 Ga0207649_10012880 Ga0207649_100128802 433
294 3300025931 Ga0207644_10047472 Ga0207644_100474722 433
295 3300025931 Ga0207644_10143181 Ga0207644_101431811 433
296 3300025933 Ga0207706_10086234 Ga0207706_100862342 433
297 3300025934 Ga0207686_10000871 Ga0207686_100008713 433
298 3300025934 Ga0207686_10016813 Ga0207686_100168132 433
299 3300025936 Ga0207670_10037170 Ga0207670_100371704 433
300 3300025940 Ga0207691_10010452 Ga0207691_100104524 433
301 3300025940 Ga0207691_10021442 Ga0207691_100214424 433
302 3300025942 Ga0207689_10003204 Ga0207689_100032046 433
303 3300025942 Ga0207689_10006469 Ga0207689_100064698 433
304 3300025942 Ga0207689_10022257 Ga0207689_100222576 433
305 3300025944 Ga0207661_10006593 Ga0207661_100065936 433
306 3300025944 Ga0207661_10022026 Ga0207661_100220262 433
307 3300025944 Ga0207661_10029721 Ga0207661_100297212 433
308 3300025945 Ga0207679_10012957 Ga0207679_100129571 433
309 3300025945 Ga0207679_10016811 Ga0207679_100168112 433
310 3300025945 Ga0207679_10020859 Ga0207679_100208594 433
311 3300025949 Ga0207667_10060670 Ga0207667_100606702 433
312 3300025960 Ga0207651_10193240 Ga0207651_101932401 433
313 3300025961 Ga0207712_10003499 Ga0207712_100034996 433
314 3300025961 Ga0207712_10003647 Ga0207712_100036476 433
315 3300025961 Ga0207712_10010604 Ga0207712_100106046 433
316 3300025986 Ga0207658_10112232 Ga0207658_101122321 433
317 3300026023 Ga0207677_10008418 Ga0207677_100084182 433
318 3300026023 Ga0207677_10029703 Ga0207677_100297032 433
319 3300026041 Ga0207639_10019290 Ga0207639_100192902 433
320 3300026075 Ga0207708_10053090 Ga0207708_100530902 433
321 3300026088 Ga0207641_10001587 Ga0207641_100015878 433
322 3300026089 Ga0207648_10019700 Ga0207648_100197004 433
323 3300026089 Ga0207648_10045330 Ga0207648_100453303 433
324 3300026089 Ga0207648_10111037 Ga0207648_101110372 433
325 3300026116 Ga0207674_10007805 Ga0207674_100078052 433
326 3300026116 Ga0207674_10017392 Ga0207674_100173922 433
327 3300026116 Ga0207674_10019078 Ga0207674_100190786 433
328 3300026118 Ga0207675_100086308 Ga0207675_1000863082 433
329 3300026118 Ga0207675_100128241 Ga0207675_1001282412 433
330 3300026121 Ga0207683_10002148 Ga0207683_100021487 433
331 3300026142 Ga0207698_10040322 Ga0207698_100403223 433
332 3300026142 Ga0207698_10133105 Ga0207698_101331052 433
333 3300026142 Ga0207698_10209732 Ga0207698_102097322 433
334 3300028380 Ga0268265_10126513 Ga0268265_101265131 433
335 3300028381 Ga0268264_10011391 Ga0268264_100113914 433
336 3300028794 Ga0307515_10000001 Ga0307515_10000001456 433
337 3300031731 Ga0307405_10000025 Ga0307405_1000002570 433
338 3300031903 Ga0307407_10000016 Ga0307407_1000001642 433
339 3300032002 Ga0307416_100000036 Ga0307416_10000003642 433
340 3300032004 Ga0307414_10010950 Ga0307414_100109502 433
341 3300035410 Ga0373924_0032524 Ga0373924_0032524_63_1445 433
342 3300035724 Ga0373933_0025519 Ga0373933_0025519_521_1903 433
343 3300036401 Ga0373937_0043154 Ga0373937_0043154_1284_2666 433
344 3300037471 Ga0395905_0036043 Ga0395905_0036043_2640_4040 433
345 3300037471 Ga0395905_0071095 Ga0395905_0071095_1192_2592 433
346 3300037471 Ga0395905_0082945 Ga0395905_0082945_1373_2764 433
347 3300039437 Ga0436365_1289625 Ga0436365_1289625_113_1510 433
348 3300044673 Ga0453683_0090112 Ga0453683_0090112_509_1906 433
349 3300046512 Ga0495610_0000039 Ga0495610_0000039_146832_148208 433
350 3300046512 Ga0495610_0000103 Ga0495610_0000103_16704_18080 433
351 3300046516 Ga0495628_0066093 Ga0495628_0066093_1283_2665 433
352 3300046559 Ga0495667_0106776 Ga0495667_0106776_354_1736 433
353 3300047322 Ga0495680_0150217 Ga0495680_0150217_227_1609 433
354 3300047471 Ga0495684_0078407 Ga0495684_0078407_970_2352 433
355 3300048913 Ga0496110_0142314 Ga0496110_0142314_151_1533 433
356 3300048925 Ga0496122_0000837 Ga0496122_0000837_51268_52596 433
357 3300048926 Ga0496123_0007556 Ga0496123_0007556_650_1978 433
358 3300048928 Ga0496125_0033596 Ga0496125_0033596_3083_4411 433
359 3300049572 Ga0501036_0009142 Ga0501036_0009142_1125_2507 433
360 3300049574 Ga0501038_0220991 Ga0501038_0220991_97_1479 433
361 3300049580 Ga0501046_0073834 Ga0501046_0073834_884_2266 433
362 3300049581 Ga0501047_0029964 Ga0501047_0029964_935_2317 433
363 3300049582 Ga0501048_0081209 Ga0501048_0081209_183_1565 433
364 3300049590 Ga0501074_0005654 Ga0501074_0005654_1157_2539 433
365 3300049682 Ga0501252_001105 Ga0501252_001105_447_1844 433
366 3300049742 Ga0501080_0284673 Ga0501080_0284673_19_1419 433
367 3300049744 Ga0501083_0002034 Ga0501083_0002034_9974_11356 433
368 3300049823 Ga0501044_0112162 Ga0501044_0112162_588_1970 433
369 3300049824 Ga0501045_0076092 Ga0501045_0076092_889_2271 433
370 3300050493 nmdc:mga0k408_3088_c1 nmdc:mga0k408_3088_c1_7274_8650 433
371 3300050508 nmdc:mga09592_181121_c1 nmdc:mga09592_181121_c1_200_1582 433
372 3300053085 Ga0495619_0028005 Ga0495619_0028005_1826_3208 433
373 3300053139 Ga0500568_0000495 Ga0500568_0000495_5291_6673 433
374 iso_pu_bacteria 2739367651 2739587331 433
375 iso_pu_bacteria 2739367656 2739617498 433
376 3300001990 JGI24737J22298_10011875 JGI24737J22298_100118752 434
377 3300003320 rootH2_10008353 rootH2_1000835311 434
378 3300003323 rootH1_10001823 rootH1_100018231 434
379 3300005328 Ga0070676_10000440 Ga0070676_1000044011 434
380 3300005364 Ga0070673_100000911 Ga0070673_10000091114 434
381 3300005366 Ga0070659_100129043 Ga0070659_1001290432 434
382 3300005459 Ga0068867_100003077 Ga0068867_1000030772 434
383 3300005539 Ga0068853_100010180 Ga0068853_1000101803 434
384 3300005543 Ga0070672_100072445 Ga0070672_1000724452 434
385 3300005616 Ga0068852_100002097 Ga0068852_1000020976 434
386 3300006237 Ga0097621_100001767 Ga0097621_1000017672 434
387 3300006358 Ga0068871_100000674 Ga0068871_1000006743 434
388 3300006881 Ga0068865_100000852 Ga0068865_1000008522 434
389 3300025904 Ga0207647_10000238 Ga0207647_1000023835 434
390 3300025907 Ga0207645_10000169 Ga0207645_1000016912 434
391 3300025911 Ga0207654_10006884 Ga0207654_100068842 434
392 3300025913 Ga0207695_10020922 Ga0207695_100209224 434
393 3300025914 Ga0207671_10118176 Ga0207671_101181762 434
394 3300025932 Ga0207690_10160023 Ga0207690_101600232 434
395 3300025933 Ga0207706_10000306 Ga0207706_100003065 434
396 3300025938 Ga0207704_10000153 Ga0207704_1000015328 434
397 3300025949 Ga0207667_10128611 Ga0207667_101286112 434
398 3300026023 Ga0207677_10149087 Ga0207677_101490872 434
399 3300026041 Ga0207639_10008430 Ga0207639_100084303 434
400 3300026089 Ga0207648_10000123 Ga0207648_1000012341 434

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

55

432

0.83

PF13347

MFS_2

MFS/sugar transport protein

79

426

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bb6-assembly2.cif.gz_B crystal structure of arabidopsis thaliana sucrose transporter suc1 0.8497 9 429
7ckr-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. 0.8496 15 427
8bb6-assembly2.cif.gz_B crystal structure of arabidopsis thaliana sucrose transporter suc1 0.824 9 429
7ckr-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. 0.8172 15 427
6g9x-assembly2.cif.gz_B crystal structure of a mfs transporter at 2.54 angstroem resolution 0.8064 19 430
ID Description Score Start End Superfamily
af_F1R4M7_275_416_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9162 242 362 1.20.1250.20
af_E7EYD2_580_800_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8998 242 426 1.20.1250.20
af_Q8BIV7_496_746_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8972 228 426 1.20.1250.20
af_Q39232_26_507_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8814 10 429 1.20.1250.20
af_A0A1D6Q3P6_44_529_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8797 16 429 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V7VBQ4-F1-model_v4 MFS transporter 0.9918 229 431 GO:0016020
AF-A0A350YX58-F1-model_v4 MFS transporter 0.9738 245 430 GO:0016020
GO:0022857
AF-A0A699Y9E3-F1-model_v4 deleted 0.9702 229 430
AF-A0A519S2Y0-F1-model_v4 MFS transporter 0.9682 232 430 GO:0016020
GO:0022857
AF-A0A3C1ABJ5-F1-model_v4 MFS transporter 0.968 225 433 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
85.95 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map