F434414

General Info

Members Datasets Scaffolds Average Seq Length
399 222 798 388

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0037082|Ga0501046_0037082_1583_2761
Length 392
Sequence VSATLLDVGAVRARFTALDRPLAFFDGPGGTQCPDEVIDAIADYLRHDNANIGAPYETSRRTDALVDRARERAGSFLGCAPGEVAFGQSMTALNFLLTRALARELEAGDEVLVTRLDHDANVAPWLALADDVGIVVRFVDVDDDLALDLDDLAATPRTKVVAFPAAANSVGTKPDVAQIVELAHEAGALAWVDAVHYGPHGPTDVSAWGCDVLVCSPYKFFGPHMGMAFGREEVLRRWRAYKVRPAADEPVGRRFDLGTSQHELLAGFVAAVDYVHSIGWDAVVEHETALGRRFLDGLPEGVTLHGLPTMEGRVPTFCFSVPGRTARSVAEHLAERDVAVWWGNYYALETMRHLGLDEDDGAVRAGIVHYNTAHEVDRLLTGLSELVSPPAG

Samples

Sample ID Description Type Environment
1 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
140 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 8.27
Rhizosphere 90.73
Stem 0
Stem Tuber 0
Unclassified 4.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501046_0037082 3300049580 Bacteria 3919
2 JGI25406J46586_10013333 3300003203 Bacteria 3534
3 Ga0070683_100027790 3300005329 Bacteria 5105
4 Ga0070683_100063078 3300005329 Bacteria 3446
5 Ga0070683_100246668 3300005329 Bacteria 1698
6 Ga0070683_100249938 3300005329 Bacteria 1686
7 Ga0070690_100016975 3300005330 Bacteria 4370
8 Ga0070670_100000812 3300005331 Bacteria 24328
9 Ga0070670_100131310 3300005331 Bacteria 2163
10 Ga0070680_100068594 3300005336 Bacteria 2911
11 Ga0070682_100003427 3300005337 Bacteria 8791
12 Ga0070682_100012485 3300005337 Bacteria 4873
13 Ga0068868_100094478 3300005338 Bacteria 2412
14 Ga0068868_100120422 3300005338 Bacteria 2140
15 Ga0070660_100002178 3300005339 Bacteria 13502
16 Ga0070660_100003886 3300005339 Bacteria 10322
17 Ga0070689_100013330 3300005340 Bacteria 5945
18 Ga0070691_10026342 3300005341 Bacteria 2710
19 Ga0070661_100020795 3300005344 Bacteria 4682
20 Ga0070661_100211959 3300005344 Bacteria 1483
21 Ga0070668_100013366 3300005347 Bacteria 6127
22 Ga0070668_100131954 3300005347 Bacteria 2006
23 Ga0070675_100008900 3300005354 Bacteria 7804
24 Ga0070675_100101967 3300005354 Bacteria 2418
25 Ga0070671_100212976 3300005355 Bacteria 1639
26 Ga0070674_100004345 3300005356 Bacteria 8078
27 Ga0070674_100009501 3300005356 Bacteria 5823
28 Ga0070674_100014466 3300005356 Bacteria 4905
29 Ga0070674_100076047 3300005356 Unclassified 2386
30 Ga0070673_100025387 3300005364 Bacteria 4361
31 Ga0070673_100033450 3300005364 Bacteria 3882
32 Ga0070673_100234373 3300005364 Unclassified 1593
33 Ga0070688_100002714 3300005365 Bacteria 8981
34 Ga0070659_100006948 3300005366 Bacteria 8196
35 Ga0070659_100009139 3300005366 Bacteria 7269
36 Ga0070710_10002754 3300005437 Bacteria 8366
37 Ga0070701_10007890 3300005438 Bacteria 4576
38 Ga0070701_10016488 3300005438 Bacteria 3436
39 Ga0070701_10105911 3300005438 Unclassified 1564
40 Ga0070700_100000793 3300005441 Bacteria 15518
41 Ga0070700_100030613 3300005441 Bacteria 3218
42 Ga0070694_100044356 3300005444 Bacteria 2975
43 Ga0070663_100023996 3300005455 Bacteria 4097
44 Ga0070663_100083867 3300005455 Bacteria 2348
45 Ga0070678_100035505 3300005456 Bacteria 3481
46 Ga0070681_10023042 3300005458 Bacteria 6261
47 Ga0068867_100001828 3300005459 Bacteria 14831
48 Ga0068867_100079043 3300005459 Bacteria 2475
49 Ga0070685_10001941 3300005466 Bacteria 10742
50 Ga0070685_10003556 3300005466 Bacteria 7909
51 Ga0070685_10031896 3300005466 Unclassified 2947
52 Ga0070706_100007699 3300005467 Bacteria 10070
53 Ga0070707_100030516 3300005468 Bacteria 5133
54 Ga0070699_100032392 3300005518 Bacteria 4513
55 Ga0070679_100029641 3300005530 Bacteria 5398
56 Ga0070679_100036893 3300005530 Bacteria 4852
57 Ga0070679_100244633 3300005530 Bacteria 1751
58 Ga0070684_100007864 3300005535 Bacteria 8315
59 Ga0070684_100037973 3300005535 Bacteria 4134
60 Ga0070684_100061889 3300005535 Bacteria 3277
61 Ga0068853_100018929 3300005539 Bacteria 5702
62 Ga0070672_100046128 3300005543 Bacteria 3375
63 Ga0070672_100082295 3300005543 Bacteria 2582
64 Ga0070686_100007343 3300005544 Bacteria 6144
65 Ga0070686_100029961 3300005544 Bacteria 3315
66 Ga0070696_100005437 3300005546 Bacteria 8494
67 Ga0070693_100040101 3300005547 Bacteria 2627
68 Ga0070665_100009747 3300005548 Bacteria 9712
69 Ga0070704_100077321 3300005549 Bacteria 2438
70 Ga0068855_100122091 3300005563 Bacteria 2981
71 Ga0068855_100331579 3300005563 Bacteria 1680
72 Ga0070664_100058350 3300005564 Bacteria 3283
73 Ga0070664_100070835 3300005564 Bacteria 2987
74 Ga0070664_100196626 3300005564 Bacteria 1797
75 Ga0070664_100228382 3300005564 Bacteria 1668
76 Ga0068857_100017674 3300005577 Bacteria 6254
77 Ga0068857_100049275 3300005577 Unclassified 3737
78 Ga0068857_100066175 3300005577 Bacteria 3215
79 Ga0068854_100181337 3300005578 Unclassified 1645
80 Ga0068856_100033258 3300005614 Bacteria 5048
81 Ga0068856_100046087 3300005614 Bacteria 4295
82 Ga0068856_100148569 3300005614 Bacteria 2351
83 Ga0070702_100007615 3300005615 Bacteria 5190
84 Ga0068852_100081379 3300005616 Bacteria 2874
85 Ga0068852_100081570 3300005616 Unclassified 2871
86 Ga0068852_100342332 3300005616 Bacteria 1458
87 Ga0068859_100060646 3300005617 Bacteria 3812
88 Ga0068859_100120582 3300005617 Unclassified 2689
89 Ga0068859_100309131 3300005617 Bacteria 1674
90 Ga0068859_100393929 3300005617 Bacteria 1481
91 Ga0068864_100120083 3300005618 Bacteria 2349
92 Ga0068866_10000474 3300005718 Bacteria 18425
93 Ga0068861_100024595 3300005719 Bacteria 4357
94 Ga0068860_100072989 3300005843 Bacteria 3262
95 Ga0068862_100260592 3300005844 Bacteria 1582
96 Ga0081455_10024022 3300005937 Bacteria 5655
97 Ga0081455_10030937 3300005937 Bacteria 4853
98 Ga0081539_10002547 3300005985 Bacteria 25323
99 Ga0075365_10046998 3300006038 Bacteria 2836
100 Ga0075364_10019830 3300006051 Bacteria 4225
101 Ga0075432_10000385 3300006058 Bacteria 12758
102 Ga0070716_100186109 3300006173 Bacteria 1368
103 Ga0070712_100003615 3300006175 Bacteria 9533
104 Ga0097621_100002348 3300006237 Bacteria 12972
105 Ga0068871_100080743 3300006358 Bacteria 2693
106 Ga0075428_100005889 3300006844 Bacteria 13621
107 Ga0075428_100030191 3300006844 Bacteria 5996
108 Ga0075430_100000493 3300006846 Bacteria 29659
109 Ga0075431_100060380 3300006847 Bacteria 3912
110 Ga0075429_100054425 3300006880 Bacteria 3481
111 Ga0068865_100001504 3300006881 Bacteria 13602
112 Ga0068865_100025249 3300006881 Bacteria 3906
113 Ga0068865_100267580 3300006881 Bacteria 1356
114 Ga0097620_100060647 3300006931 Bacteria 3812
115 Ga0097620_100120586 3300006931 Unclassified 2689
116 Ga0097620_100309153 3300006931 Bacteria 1674
117 Ga0097620_100393959 3300006931 Bacteria 1481
118 Ga0075435_100054064 3300007076 Bacteria 3240
119 Ga0075435_100089964 3300007076 Unclassified 2532
120 Ga0111539_10013333 3300009094 Bacteria 10272
121 Ga0111539_10058504 3300009094 Bacteria 4573
122 Ga0111539_10318209 3300009094 Bacteria 1811
123 Ga0105245_10011311 3300009098 Bacteria 7769
124 Ga0105245_10035074 3300009098 Bacteria 4451
125 Ga0105245_10156593 3300009098 Bacteria 2158
126 Ga0105247_10122823 3300009101 Unclassified 1685
127 Ga0114129_10028037 3300009147 Bacteria 7976
128 Ga0114129_10171349 3300009147 Bacteria 2959
129 Ga0114129_10207642 3300009147 Bacteria 2649
130 Ga0114129_10262857 3300009147 Bacteria 2312
131 Ga0105243_10007510 3300009148 Bacteria 8379
132 Ga0105243_10008700 3300009148 Bacteria 7782
133 Ga0105243_10016007 3300009148 Bacteria 5673
134 Ga0105243_10022388 3300009148 Bacteria 4802
135 Ga0105243_10156578 3300009148 Bacteria 1960
136 Ga0105241_10004858 3300009174 Bacteria 9912
137 Ga0105242_10003264 3300009176 Bacteria 12643
138 Ga0105242_10060285 3300009176 Bacteria 3117
139 Ga0105248_10322033 3300009177 Bacteria 1741
140 Ga0105238_10100802 3300009551 Bacteria 2870
141 Ga0105238_10120587 3300009551 Bacteria 2602
142 Ga0105249_10005145 3300009553 Bacteria 11288
143 Ga0105239_10008816 3300010375 Bacteria 11413
144 Ga0105239_10225613 3300010375 Bacteria 2102
145 Ga0105246_10014751 3300011119 Bacteria 4920
146 Ga0105246_10019286 3300011119 Bacteria 4356
147 Ga0105246_10031993 3300011119 Bacteria 3485
148 Ga0157369_10029925 3300013105 Bacteria 6011
149 Ga0157378_10007113 3300013297 Bacteria 9774
150 Ga0157378_10109337 3300013297 Bacteria 2532
151 Ga0157378_10245061 3300013297 Bacteria 1714
152 Ga0163162_10001280 3300013306 Bacteria 23542
153 Ga0163162_10307981 3300013306 Bacteria 1716
154 Ga0157372_10008017 3300013307 Bacteria 11233
155 Ga0157375_10010432 3300013308 Bacteria 8178
156 Ga0157375_10017974 3300013308 Bacteria 6401
157 Ga0157380_10001356 3300014326 Bacteria 15945
158 Ga0157380_10018633 3300014326 Bacteria 5156
159 Ga0157377_10000519 3300014745 Bacteria 16326
160 Ga0157377_10047246 3300014745 Bacteria 2411
161 Ga0157379_10246036 3300014968 Bacteria 1622
162 Ga0157376_10127570 3300014969 Unclassified 2265
163 Ga0163161_10213357 3300017792 Bacteria 1492
164 Ga0207653_10044579 3300025885 Bacteria 1463
165 Ga0207692_10003764 3300025898 Bacteria 5957
166 Ga0207688_10002164 3300025901 Bacteria 10568
167 Ga0207688_10045335 3300025901 Bacteria 2453
168 Ga0207688_10060801 3300025901 Bacteria 2129
169 Ga0207647_10055459 3300025904 Bacteria 2435
170 Ga0207643_10005108 3300025908 Bacteria 7024
171 Ga0207643_10074605 3300025908 Bacteria 1957
172 Ga0207684_10012564 3300025910 Bacteria 7360
173 Ga0207654_10010112 3300025911 Bacteria 4799
174 Ga0207707_10028140 3300025912 Bacteria 4913
175 Ga0207693_10001256 3300025915 Bacteria 22567
176 Ga0207693_10269134 3300025915 Bacteria 1335
177 Ga0207660_10046030 3300025917 Bacteria 3077
178 Ga0207662_10077908 3300025918 Bacteria 2017
179 Ga0207657_10002716 3300025919 Bacteria 19059
180 Ga0207657_10035573 3300025919 Bacteria 4464
181 Ga0207652_10226973 3300025921 Bacteria 1683
182 Ga0207646_10024412 3300025922 Bacteria 5539
183 Ga0207650_10002728 3300025925 Bacteria 12193
184 Ga0207659_10078276 3300025926 Bacteria 2436
185 Ga0207687_10002894 3300025927 Bacteria 11655
186 Ga0207687_10016688 3300025927 Bacteria 4826
187 Ga0207687_10047954 3300025927 Bacteria 2963
188 Ga0207687_10081635 3300025927 Bacteria 2337
189 Ga0207687_10208096 3300025927 Bacteria 1533
190 Ga0207690_10134986 3300025932 Bacteria 1811
191 Ga0207690_10242620 3300025932 Unclassified 1388
192 Ga0207706_10004673 3300025933 Bacteria 12839
193 Ga0207706_10228522 3300025933 Bacteria 1628
194 Ga0207686_10036743 3300025934 Bacteria 2952
195 Ga0207709_10000790 3300025935 Bacteria 24700
196 Ga0207709_10028607 3300025935 Bacteria 3224
197 Ga0207709_10040120 3300025935 Bacteria 2801
198 Ga0207709_10126888 3300025935 Bacteria 1732
199 Ga0207669_10009385 3300025937 Bacteria 4657
200 Ga0207669_10020683 3300025937 Bacteria 3457
201 Ga0207669_10212847 3300025937 Unclassified 1412
202 Ga0207704_10032508 3300025938 Bacteria 2953
203 Ga0207691_10011774 3300025940 Bacteria 8394
204 Ga0207691_10026121 3300025940 Bacteria 5480
205 Ga0207691_10055869 3300025940 Bacteria 3597
206 Ga0207689_10165159 3300025942 Bacteria 1824
207 Ga0207689_10205967 3300025942 Bacteria 1624
208 Ga0207661_10003189 3300025944 Bacteria 11370
209 Ga0207661_10209583 3300025944 Bacteria 1717
210 Ga0207679_10005354 3300025945 Bacteria 8046
211 Ga0207667_10136273 3300025949 Bacteria 2528
212 Ga0207651_10056693 3300025960 Bacteria 2698
213 Ga0207651_10080532 3300025960 Bacteria 2344
214 Ga0207712_10002935 3300025961 Bacteria 10891
215 Ga0207668_10066526 3300025972 Bacteria 2555
216 Ga0207668_10158415 3300025972 Unclassified 1761
217 Ga0207677_10083103 3300026023 Bacteria 2304
218 Ga0207678_10028168 3300026067 Bacteria 4905
219 Ga0207678_10099833 3300026067 Bacteria 2480
220 Ga0207678_10176702 3300026067 Bacteria 1823
221 Ga0207708_10000415 3300026075 Bacteria 33470
222 Ga0207708_10008245 3300026075 Bacteria 7716
223 Ga0207708_10060567 3300026075 Bacteria 2889
224 Ga0207708_10108359 3300026075 Bacteria 2154
225 Ga0207702_10041514 3300026078 Bacteria 3858
226 Ga0207648_10000705 3300026089 Bacteria 37489
227 Ga0207648_10034674 3300026089 Bacteria 4448
228 Ga0207648_10034951 3300026089 Bacteria 4431
229 Ga0207676_10044859 3300026095 Bacteria 3413
230 Ga0207674_10047235 3300026116 Bacteria 4415
231 Ga0207674_10058731 3300026116 Unclassified 3895
232 Ga0207675_100026869 3300026118 Bacteria 5357
233 Ga0207675_100196860 3300026118 Bacteria 1934
234 Ga0207683_10001271 3300026121 Bacteria 22865
235 Ga0207683_10010532 3300026121 Bacteria 7890
236 Ga0207683_10011785 3300026121 Bacteria 7459
237 Ga0207683_10013062 3300026121 Bacteria 7087
238 Ga0207683_10043442 3300026121 Bacteria 3928
239 Ga0207683_10090786 3300026121 Unclassified 2721
240 Ga0207428_10002295 3300027907 Bacteria 19175
241 Ga0207428_10014315 3300027907 Bacteria 6902
242 Ga0373962_0024232 3300035242 Bacteria 1621
243 Ga0373933_0190666 3300035724 Bacteria 1309
244 Ga0395900_0106193 3300037418 Bacteria 2884
245 Ga0395900_0260168 3300037418 Bacteria 1733
246 Ga0395900_0275492 3300037418 Bacteria 1676
247 Ga0395898_0003692 3300037466 Bacteria 17010
248 Ga0395898_0043342 3300037466 Bacteria 4434
249 Ga0395898_0052934 3300037466 Bacteria 3965
250 Ga0395898_0069735 3300037466 Bacteria 3400
251 Ga0395898_0073238 3300037466 Bacteria 3309
252 Ga0395898_0203723 3300037466 Bacteria 1888
253 Ga0395898_0372646 3300037466 Bacteria 1361
254 Ga0395905_0009155 3300037471 Bacteria 9698
255 Ga0395905_0037499 3300037471 Bacteria 4550
256 Ga0395905_0121875 3300037471 Unclassified 2451
257 Ga0395905_0127202 3300037471 Bacteria 2396
258 Ga0395905_0298112 3300037471 Bacteria 1499
259 Ga0395901_0019342 3300038443 Bacteria 6961
260 Ga0395901_0030573 3300038443 Bacteria 5549
261 Ga0395901_0037301 3300038443 Bacteria 5027
262 Ga0395901_0093519 3300038443 Bacteria 3148
263 Ga0395901_0116173 3300038443 Bacteria 2811
264 Ga0395901_0142804 3300038443 Bacteria 2516
265 Ga0439466_0026303 3300041411 Unclassified 2025
266 Ga0439434_0002336 3300042435 Bacteria 5520
267 Ga0466961_0009423 3300044693 Bacteria 6216
268 Ga0466963_0045240 3300044694 Bacteria 2899
269 Ga0466964_0000511 3300044706 Bacteria 12093
270 Ga0466971_0022841 3300044719 Bacteria 2787
271 Ga0466968_0010205 3300044735 Bacteria 3635
272 Ga0466968_0011330 3300044735 Bacteria 3471
273 Ga0466968_0049886 3300044735 Bacteria 1784
274 Ga0466957_0007646 3300044842 Bacteria 6112
275 Ga0466957_0010438 3300044842 Bacteria 5334
276 Ga0466957_0036319 3300044842 Bacteria 2961
277 Ga0466957_0039650 3300044842 Bacteria 2842
278 Ga0466960_0009169 3300044901 Bacteria 4071
279 Ga0466959_0049734 3300045049 Bacteria 3079
280 Ga0466958_0026088 3300045836 Bacteria 3451
281 Ga0466958_0054054 3300045836 Bacteria 2435
282 Ga0466967_0001803 3300045976 Bacteria 12843
283 Ga0466967_0003947 3300045976 Bacteria 9863
284 Ga0495603_0019282 3300046455 Bacteria 4129
285 Ga0495629_0039680 3300046459 Bacteria 3313
286 Ga0495582_0026753 3300046473 Bacteria 3162
287 Ga0495582_0038539 3300046473 Bacteria 2630
288 Ga0495605_0042235 3300046474 Bacteria 2268
289 Ga0495639_0022429 3300046475 Bacteria 2769
290 Ga0495631_0055812 3300046518 Bacteria 1721
291 Ga0495637_0039051 3300046520 Bacteria 2052
292 Ga0495665_0032553 3300046531 Bacteria 2789
293 Ga0495634_0103190 3300046642 Bacteria 1841
294 Ga0495635_0036174 3300046663 Bacteria 3423
295 Ga0495635_0125929 3300046663 Bacteria 1747
296 Ga0495588_0039761 3300046674 Bacteria 2397
297 Ga0495657_0013721 3300046675 Bacteria 5968
298 Ga0495657_0075080 3300046675 Bacteria 2198
299 Ga0495647_0030024 3300046681 Bacteria 2014
300 Ga0495613_0033630 3300046689 Bacteria 3809
301 Ga0495589_0027568 3300046794 Bacteria 2872
302 Ga0495581_0010883 3300047315 Bacteria 5260
303 Ga0495581_0017710 3300047315 Bacteria 4139
304 Ga0495676_0098542 3300047321 Bacteria 2168
305 Ga0495680_0056885 3300047322 Bacteria 3027
306 Ga0496101_0078959 3300048904 Bacteria 2429
307 Ga0496101_0117293 3300048904 Bacteria 2010
308 Ga0496101_0143805 3300048904 Bacteria 1820
309 Ga0496102_0007554 3300048905 Bacteria 9292
310 Ga0496102_0011258 3300048905 Bacteria 7707
311 Ga0496103_0005318 3300048906 Bacteria 7715
312 Ga0496103_0043891 3300048906 Bacteria 2753
313 Ga0496104_0006333 3300048907 Bacteria 10411
314 Ga0496104_0068967 3300048907 Bacteria 3360
315 Ga0496105_0000889 3300048908 Bacteria 20439
316 Ga0496105_0126715 3300048908 Bacteria 2105
317 Ga0496106_0006358 3300048909 Bacteria 8747
318 Ga0496107_0003570 3300048910 Bacteria 10422
319 Ga0496107_0054919 3300048910 Bacteria 2875
320 Ga0496108_0009618 3300048911 Bacteria 7837
321 Ga0496108_0115247 3300048911 Bacteria 2301
322 Ga0496109_0005323 3300048912 Bacteria 10756
323 Ga0496109_0009703 3300048912 Bacteria 8217
324 Ga0496109_0126248 3300048912 Bacteria 2385
325 Ga0496109_0144269 3300048912 Bacteria 2227
326 Ga0496110_0000993 3300048913 Bacteria 19905
327 Ga0496111_0014266 3300048914 Bacteria 5423
328 Ga0496112_0008798 3300048915 Bacteria 9060
329 Ga0496112_0027537 3300048915 Bacteria 5480
330 Ga0496112_0081349 3300048915 Bacteria 3203
331 Ga0496112_0101180 3300048915 Bacteria 2852
332 Ga0496113_0155056 3300048916 Bacteria 1808
333 Ga0496114_0010965 3300048917 Bacteria 7226
334 Ga0496114_0039759 3300048917 Bacteria 3892
335 Ga0496114_0061557 3300048917 Bacteria 3140
336 Ga0496114_0109459 3300048917 Bacteria 2366
337 Ga0496115_0005172 3300048918 Bacteria 9488
338 Ga0496115_0015454 3300048918 Bacteria 5790
339 Ga0501033_0226621 3300049570 Bacteria 1329
340 Ga0501036_0017664 3300049572 Bacteria 5969
341 Ga0501036_0088827 3300049572 Bacteria 2612
342 Ga0501038_0029093 3300049574 Bacteria 4900
343 Ga0501039_0024304 3300049575 Bacteria 4653
344 Ga0501039_0052063 3300049575 Bacteria 3168
345 Ga0501040_0012877 3300049576 Bacteria 5494
346 Ga0501040_0072782 3300049576 Bacteria 2374
347 Ga0501041_0031217 3300049577 Bacteria 3217
348 Ga0501042_0033612 3300049578 Bacteria 3635
349 Ga0501042_0065129 3300049578 Bacteria 2605
350 Ga0501042_0078624 3300049578 Bacteria 2363
351 Ga0501048_0005235 3300049582 Bacteria 9883
352 Ga0501048_0165667 3300049582 Bacteria 1565
353 Ga0501067_0015311 3300049583 Bacteria 4244
354 Ga0501068_0063573 3300049584 Bacteria 2245
355 Ga0501069_0082997 3300049585 Bacteria 1806
356 Ga0501071_0031041 3300049587 Bacteria 3784
357 Ga0501071_0040040 3300049587 Bacteria 3354
358 Ga0501072_0003870 3300049588 Bacteria 11317
359 Ga0501072_0024126 3300049588 Bacteria 4728
360 Ga0501072_0207990 3300049588 Bacteria 1560
361 Ga0501073_0164003 3300049589 Bacteria 1539
362 Ga0501074_0018004 3300049590 Bacteria 5132
363 Ga0501075_0009402 3300049591 Bacteria 6838
364 Ga0501075_0037026 3300049591 Bacteria 3643
365 Ga0501076_0022696 3300049592 Bacteria 4825
366 Ga0501077_0006679 3300049593 Bacteria 7089
367 Ga0501079_0068244 3300049741 Bacteria 2744
368 Ga0501079_0297590 3300049741 Bacteria 1262
369 Ga0501080_0016871 3300049742 Bacteria 6744
370 Ga0501080_0127677 3300049742 Bacteria 2354
371 Ga0501081_0015360 3300049743 Bacteria 5051
372 Ga0501081_0023349 3300049743 Bacteria 4144
373 Ga0501083_0011479 3300049744 Bacteria 6216
374 Ga0501035_0083513 3300049822 Bacteria 2818
375 Ga0501044_0347723 3300049823 Bacteria 1403
376 Ga0501045_0013692 3300049824 Bacteria 5733
377 Ga0501045_0027617 3300049824 Bacteria 4091
378 Ga0501045_0049198 3300049824 Bacteria 3074
379 nmdc:mga00v17_132368_c1 3300050491 Bacteria 1594
380 nmdc:mga0yw44_6739_c1 3300050492 Bacteria 5579
381 nmdc:mga05p37_116375_c1 3300050507 Bacteria 3285
382 nmdc:mga05p37_241240_c1 3300050507 Bacteria 2173
383 nmdc:mga05p37_38210_c2 3300050507 Bacteria 4431
384 nmdc:mga05p37_464684_c1 3300050507 Bacteria 1461
385 nmdc:mga05p37_54652_c1 3300050507 Bacteria 4912
386 nmdc:mga09592_13818_c1 3300050508 Bacteria 6597
387 nmdc:mga0qj67_6269_c1 3300050509 Bacteria 8723
388 nmdc:mga06r32_55414_c1 3300050510 Bacteria 3803
389 nmdc:mga08y16_19405_c1 3300050511 Bacteria 7168
390 nmdc:mga0rr50_213572_c1 3300050513 Bacteria 1590
391 nmdc:mga0a205_323091_c1 3300050515 Bacteria 1414
392 Ga0495595_0040692 3300053084 Bacteria 2124
393 Ga0495619_0094400 3300053085 Bacteria 2029
394 Ga0501084_0002213 3300054114 Bacteria 15603
395 Ga0501084_0023822 3300054114 Bacteria 5106
396 Ga0501084_0133912 3300054114 Bacteria 2086
397 Ga0501082_0020736 3300060353 Bacteria 5667
398 Ga0501082_0058410 3300060353 Bacteria 3323
399 Ga0530510_0013859 3300061734 Bacteria 5677
400 Ga0501046_0037082
401 JGI25406J46586_10013333
402 Ga0070683_100027790
403 Ga0070683_100063078
404 Ga0070683_100246668
405 Ga0070683_100249938
406 Ga0070690_100016975
407 Ga0070670_100000812
408 Ga0070670_100131310
409 Ga0070680_100068594
410 Ga0070682_100003427
411 Ga0070682_100012485
412 Ga0068868_100094478
413 Ga0068868_100120422
414 Ga0070660_100002178
415 Ga0070660_100003886
416 Ga0070689_100013330
417 Ga0070691_10026342
418 Ga0070661_100020795
419 Ga0070661_100211959
420 Ga0070668_100013366
421 Ga0070668_100131954
422 Ga0070675_100008900
423 Ga0070675_100101967
424 Ga0070671_100212976
425 Ga0070674_100004345
426 Ga0070674_100009501
427 Ga0070674_100014466
428 Ga0070674_100076047
429 Ga0070673_100025387
430 Ga0070673_100033450
431 Ga0070673_100234373
432 Ga0070688_100002714
433 Ga0070659_100006948
434 Ga0070659_100009139
435 Ga0070710_10002754
436 Ga0070701_10007890
437 Ga0070701_10016488
438 Ga0070701_10105911
439 Ga0070700_100000793
440 Ga0070700_100030613
441 Ga0070694_100044356
442 Ga0070663_100023996
443 Ga0070663_100083867
444 Ga0070678_100035505
445 Ga0070681_10023042
446 Ga0068867_100001828
447 Ga0068867_100079043
448 Ga0070685_10001941
449 Ga0070685_10003556
450 Ga0070685_10031896
451 Ga0070706_100007699
452 Ga0070707_100030516
453 Ga0070699_100032392
454 Ga0070679_100029641
455 Ga0070679_100036893
456 Ga0070679_100244633
457 Ga0070684_100007864
458 Ga0070684_100037973
459 Ga0070684_100061889
460 Ga0068853_100018929
461 Ga0070672_100046128
462 Ga0070672_100082295
463 Ga0070686_100007343
464 Ga0070686_100029961
465 Ga0070696_100005437
466 Ga0070693_100040101
467 Ga0070665_100009747
468 Ga0070704_100077321
469 Ga0068855_100122091
470 Ga0068855_100331579
471 Ga0070664_100058350
472 Ga0070664_100070835
473 Ga0070664_100196626
474 Ga0070664_100228382
475 Ga0068857_100017674
476 Ga0068857_100049275
477 Ga0068857_100066175
478 Ga0068854_100181337
479 Ga0068856_100033258
480 Ga0068856_100046087
481 Ga0068856_100148569
482 Ga0070702_100007615
483 Ga0068852_100081379
484 Ga0068852_100081570
485 Ga0068852_100342332
486 Ga0068859_100060646
487 Ga0068859_100120582
488 Ga0068859_100309131
489 Ga0068859_100393929
490 Ga0068864_100120083
491 Ga0068866_10000474
492 Ga0068861_100024595
493 Ga0068860_100072989
494 Ga0068862_100260592
495 Ga0081455_10024022
496 Ga0081455_10030937
497 Ga0081539_10002547
498 Ga0075365_10046998
499 Ga0075364_10019830
500 Ga0075432_10000385
501 Ga0070716_100186109
502 Ga0070712_100003615
503 Ga0097621_100002348
504 Ga0068871_100080743
505 Ga0075428_100005889
506 Ga0075428_100030191
507 Ga0075430_100000493
508 Ga0075431_100060380
509 Ga0075429_100054425
510 Ga0068865_100001504
511 Ga0068865_100025249
512 Ga0068865_100267580
513 Ga0097620_100060647
514 Ga0097620_100120586
515 Ga0097620_100309153
516 Ga0097620_100393959
517 Ga0075435_100054064
518 Ga0075435_100089964
519 Ga0111539_10013333
520 Ga0111539_10058504
521 Ga0111539_10318209
522 Ga0105245_10011311
523 Ga0105245_10035074
524 Ga0105245_10156593
525 Ga0105247_10122823
526 Ga0114129_10028037
527 Ga0114129_10171349
528 Ga0114129_10207642
529 Ga0114129_10262857
530 Ga0105243_10007510
531 Ga0105243_10008700
532 Ga0105243_10016007
533 Ga0105243_10022388
534 Ga0105243_10156578
535 Ga0105241_10004858
536 Ga0105242_10003264
537 Ga0105242_10060285
538 Ga0105248_10322033
539 Ga0105238_10100802
540 Ga0105238_10120587
541 Ga0105249_10005145
542 Ga0105239_10008816
543 Ga0105239_10225613
544 Ga0105246_10014751
545 Ga0105246_10019286
546 Ga0105246_10031993
547 Ga0157369_10029925
548 Ga0157378_10007113
549 Ga0157378_10109337
550 Ga0157378_10245061
551 Ga0163162_10001280
552 Ga0163162_10307981
553 Ga0157372_10008017
554 Ga0157375_10010432
555 Ga0157375_10017974
556 Ga0157380_10001356
557 Ga0157380_10018633
558 Ga0157377_10000519
559 Ga0157377_10047246
560 Ga0157379_10246036
561 Ga0157376_10127570
562 Ga0163161_10213357
563 Ga0207653_10044579
564 Ga0207692_10003764
565 Ga0207688_10002164
566 Ga0207688_10045335
567 Ga0207688_10060801
568 Ga0207647_10055459
569 Ga0207643_10005108
570 Ga0207643_10074605
571 Ga0207684_10012564
572 Ga0207654_10010112
573 Ga0207707_10028140
574 Ga0207693_10001256
575 Ga0207693_10269134
576 Ga0207660_10046030
577 Ga0207662_10077908
578 Ga0207657_10002716
579 Ga0207657_10035573
580 Ga0207652_10226973
581 Ga0207646_10024412
582 Ga0207650_10002728
583 Ga0207659_10078276
584 Ga0207687_10002894
585 Ga0207687_10016688
586 Ga0207687_10047954
587 Ga0207687_10081635
588 Ga0207687_10208096
589 Ga0207690_10134986
590 Ga0207690_10242620
591 Ga0207706_10004673
592 Ga0207706_10228522
593 Ga0207686_10036743
594 Ga0207709_10000790
595 Ga0207709_10028607
596 Ga0207709_10040120
597 Ga0207709_10126888
598 Ga0207669_10009385
599 Ga0207669_10020683
600 Ga0207669_10212847
601 Ga0207704_10032508
602 Ga0207691_10011774
603 Ga0207691_10026121
604 Ga0207691_10055869
605 Ga0207689_10165159
606 Ga0207689_10205967
607 Ga0207661_10003189
608 Ga0207661_10209583
609 Ga0207679_10005354
610 Ga0207667_10136273
611 Ga0207651_10056693
612 Ga0207651_10080532
613 Ga0207712_10002935
614 Ga0207668_10066526
615 Ga0207668_10158415
616 Ga0207677_10083103
617 Ga0207678_10028168
618 Ga0207678_10099833
619 Ga0207678_10176702
620 Ga0207708_10000415
621 Ga0207708_10008245
622 Ga0207708_10060567
623 Ga0207708_10108359
624 Ga0207702_10041514
625 Ga0207648_10000705
626 Ga0207648_10034674
627 Ga0207648_10034951
628 Ga0207676_10044859
629 Ga0207674_10047235
630 Ga0207674_10058731
631 Ga0207675_100026869
632 Ga0207675_100196860
633 Ga0207683_10001271
634 Ga0207683_10010532
635 Ga0207683_10011785
636 Ga0207683_10013062
637 Ga0207683_10043442
638 Ga0207683_10090786
639 Ga0207428_10002295
640 Ga0207428_10014315
641 Ga0373962_0024232
642 Ga0373933_0190666
643 Ga0395900_0106193
644 Ga0395900_0260168
645 Ga0395900_0275492
646 Ga0395898_0003692
647 Ga0395898_0043342
648 Ga0395898_0052934
649 Ga0395898_0069735
650 Ga0395898_0073238
651 Ga0395898_0203723
652 Ga0395898_0372646
653 Ga0395905_0009155
654 Ga0395905_0037499
655 Ga0395905_0121875
656 Ga0395905_0127202
657 Ga0395905_0298112
658 Ga0395901_0019342
659 Ga0395901_0030573
660 Ga0395901_0037301
661 Ga0395901_0093519
662 Ga0395901_0116173
663 Ga0395901_0142804
664 Ga0439466_0026303
665 Ga0439434_0002336
666 Ga0466961_0009423
667 Ga0466963_0045240
668 Ga0466964_0000511
669 Ga0466971_0022841
670 Ga0466968_0010205
671 Ga0466968_0011330
672 Ga0466968_0049886
673 Ga0466957_0007646
674 Ga0466957_0010438
675 Ga0466957_0036319
676 Ga0466957_0039650
677 Ga0466960_0009169
678 Ga0466959_0049734
679 Ga0466958_0026088
680 Ga0466958_0054054
681 Ga0466967_0001803
682 Ga0466967_0003947
683 Ga0495603_0019282
684 Ga0495629_0039680
685 Ga0495582_0026753
686 Ga0495582_0038539
687 Ga0495605_0042235
688 Ga0495639_0022429
689 Ga0495631_0055812
690 Ga0495637_0039051
691 Ga0495665_0032553
692 Ga0495634_0103190
693 Ga0495635_0036174
694 Ga0495635_0125929
695 Ga0495588_0039761
696 Ga0495657_0013721
697 Ga0495657_0075080
698 Ga0495647_0030024
699 Ga0495613_0033630
700 Ga0495589_0027568
701 Ga0495581_0010883
702 Ga0495581_0017710
703 Ga0495676_0098542
704 Ga0495680_0056885
705 Ga0496101_0078959
706 Ga0496101_0117293
707 Ga0496101_0143805
708 Ga0496102_0007554
709 Ga0496102_0011258
710 Ga0496103_0005318
711 Ga0496103_0043891
712 Ga0496104_0006333
713 Ga0496104_0068967
714 Ga0496105_0000889
715 Ga0496105_0126715
716 Ga0496106_0006358
717 Ga0496107_0003570
718 Ga0496107_0054919
719 Ga0496108_0009618
720 Ga0496108_0115247
721 Ga0496109_0005323
722 Ga0496109_0009703
723 Ga0496109_0126248
724 Ga0496109_0144269
725 Ga0496110_0000993
726 Ga0496111_0014266
727 Ga0496112_0008798
728 Ga0496112_0027537
729 Ga0496112_0081349
730 Ga0496112_0101180
731 Ga0496113_0155056
732 Ga0496114_0010965
733 Ga0496114_0039759
734 Ga0496114_0061557
735 Ga0496114_0109459
736 Ga0496115_0005172
737 Ga0496115_0015454
738 Ga0501033_0226621
739 Ga0501036_0017664
740 Ga0501036_0088827
741 Ga0501038_0029093
742 Ga0501039_0024304
743 Ga0501039_0052063
744 Ga0501040_0012877
745 Ga0501040_0072782
746 Ga0501041_0031217
747 Ga0501042_0033612
748 Ga0501042_0065129
749 Ga0501042_0078624
750 Ga0501048_0005235
751 Ga0501048_0165667
752 Ga0501067_0015311
753 Ga0501068_0063573
754 Ga0501069_0082997
755 Ga0501071_0031041
756 Ga0501071_0040040
757 Ga0501072_0003870
758 Ga0501072_0024126
759 Ga0501072_0207990
760 Ga0501073_0164003
761 Ga0501074_0018004
762 Ga0501075_0009402
763 Ga0501075_0037026
764 Ga0501076_0022696
765 Ga0501077_0006679
766 Ga0501079_0068244
767 Ga0501079_0297590
768 Ga0501080_0016871
769 Ga0501080_0127677
770 Ga0501081_0015360
771 Ga0501081_0023349
772 Ga0501083_0011479
773 Ga0501035_0083513
774 Ga0501044_0347723
775 Ga0501045_0013692
776 Ga0501045_0027617
777 Ga0501045_0049198
778 nmdc:mga00v17_132368_c1
779 nmdc:mga0yw44_6739_c1
780 nmdc:mga05p37_116375_c1
781 nmdc:mga05p37_241240_c1
782 nmdc:mga05p37_38210_c2
783 nmdc:mga05p37_464684_c1
784 nmdc:mga05p37_54652_c1
785 nmdc:mga09592_13818_c1
786 nmdc:mga0qj67_6269_c1
787 nmdc:mga06r32_55414_c1
788 nmdc:mga08y16_19405_c1
789 nmdc:mga0rr50_213572_c1
790 nmdc:mga0a205_323091_c1
791 Ga0495595_0040692
792 Ga0495619_0094400
793 Ga0501084_0002213
794 Ga0501084_0023822
795 Ga0501084_0133912
796 Ga0501082_0020736
797 Ga0501082_0058410
798 Ga0530510_0013859

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

23

379

0.95

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

66

201

0.8

PF00155

Aminotran_1_2

Aminotransferase class I and II

24

208

0.77

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

43

386

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q76-assembly1.cif.gz_B crystal structure of nfs2 c384s mutant, the plastidial cysteine desulfurase from arabidopsis thaliana 0.9424 8 388
7mkv-assembly1.cif.gz_A engineered plp-dependent decarboxylative aldolase from aspergillus flavus, ustd2.0, bound as the internal aldimine 0.9392 6 387
8odq-assembly1.cif.gz_D sufs-sufu complex from mycobacterium tuberculosis 0.9368 6 388
1t3i-assembly1.cif.gz_A structure of slr0077/sufs, the essential cysteine desulfurase from synechocystis pcc 6803 0.9334 8 388
1t3i-assembly1.cif.gz_B structure of slr0077/sufs, the essential cysteine desulfurase from synechocystis pcc 6803 0.9325 8 388
ID Description Score Start End Superfamily
af_A0A368UH16_90_350_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9525 34 279 3.40.640.10
3caiA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9474 33 280 3.40.640.10
af_P9WQ67_32_395_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9368 35 385 3.40.640.10
af_Q2FZY5_42_298_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9368 34 276 3.40.640.10
1i29A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9252 37 280 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A354BEL8-F1-model_v4 Cysteine desulfurase CsdA 0.9814 105 185
AF-A0A538E6P2-F1-model_v4 Cysteine desulfurase-like protein 0.9798 38 389
AF-A0A538E6P2-F1-model_v4 Cysteine desulfurase-like protein 0.9743 38 389
AF-A0A7J4M440-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9701 13 219 GO:0008483
AF-A0A1Z4IV31-F1-model_v4 deleted 0.97 5 387

Map