F434404

General Info

Members Datasets Scaffolds Average Seq Length
399 323 798 308

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0016361|Ga0501033_0016361_2490_3464
Length 324
Sequence LRLFVRQVIGGTDSEVFDVAATPAHAPYDGSSKPFTIGLKPLALADWIEVDDNLFAHLAEKRRLYAEMPEKVFVEEPDTRTAQQEVLDMLTAHLPERFPRTYAVAGDEVAVRNLPPAQALALDAPLVAASLLVQEDLILMRRGEDGWRLAAGSLCFPSSWTLTEKFGKTLHTIHIPVPGFGPGSRPDELIARMFDGLQGQAMERFNWSIQAGDALYHPLSNIQRDDRATTRPSRFADEEDINASAFIRVERQTLRKLPISRDVLFTIRIHLDPLAVLTRHPDKARLAASFAAQLTALDTAQLDYKGLTADRDRLVDWLQAAAAA

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
19 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
27 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
28 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
29 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
30 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
31 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
33 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
34 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
36 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
48 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
49 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
50 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
51 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
52 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
53 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
54 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
55 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
56 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
57 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
58 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
59 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
60 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
62 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
73 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
74 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
75 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
76 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
77 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
78 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
79 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
80 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
81 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
82 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
85 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
86 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
87 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
88 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
89 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
90 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
91 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
92 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
93 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
94 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
95 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
96 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
97 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
98 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
99 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
100 2512875024
101 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
102 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
103 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
104 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
105 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
106 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
107 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
108 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
109 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
110 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
111 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
112 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
113 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
114 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
115 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
116 2738543024 Aminobacter sp. AP02 Isolate Unclassified
117 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
118 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
119 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
120 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
121 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
122 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
123 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
124 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
125 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
126 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
127 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
128 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
129 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
130 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
131 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
132 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
133 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
134 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
135 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
136 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
137 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
138 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
139 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
140 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
141 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
142 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
143 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
144 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
145 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
146 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
147 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
148 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
149 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
150 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
151 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
152 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
153 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
154 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
155 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
156 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
157 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
158 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
159 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
160 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
161 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
162 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
163 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
164 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
165 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
166 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
167 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
168 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
169 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
170 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
171 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
172 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
173 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
174 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
175 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
176 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
177 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
178 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
179 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
180 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
181 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
182 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
183 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
184 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
185 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
186 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
187 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
188 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
189 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
190 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
191 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
192 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
193 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
194 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
195 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
196 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
197 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
198 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
199 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
200 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
201 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
202 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
203 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
204 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
205 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
206 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
207 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
208 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
209 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
210 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
211 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
212 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
213 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
214 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
215 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
216 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
217 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
218 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
219 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
220 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
221 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
222 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
223 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
224 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
225 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
226 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
227 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
228 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
229 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
230 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
231 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
232 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
233 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
234 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
235 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
236 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
237 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
238 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
239 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
240 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
241 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
242 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
243 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
244 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
245 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
246 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
247 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
248 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
249 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
250 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
251 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
252 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
253 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
254 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
255 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
256 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
257 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
258 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
259 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
260 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
261 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
262 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
263 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
264 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
265 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
266 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
267 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
268 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
269 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
270 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
271 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
272 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
273 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
274 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
275 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
276 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
277 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
278 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
279 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
280 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
281 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
282 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
283 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
284 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
285 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
286 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
287 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
288 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
289 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
290 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
291 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
292 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
293 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
294 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
295 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
296 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
297 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
298 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
299 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
300 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
301 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
302 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
303 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
304 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
305 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
306 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
307 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
308 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
309 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
310 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
311 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
312 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
313 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
314 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
315 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
316 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
317 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
318 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
319 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
320 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
321 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
322 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
323 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 41.85
Metatranscriptomes 0
Isolates 58.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.26
Nodule 51.13
Rhizoplane 0.5
Rhizosphere 35.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0016361 3300049570 Bacteria 5616
2 JGI25165J46597_1000042 3300003214 Bacteria 271606
3 Ga0055542_1000981 3300003762 Bacteria 18535
4 Ga0055529_1001600 3300003763 Bacteria 6140
5 Ga0070674_100130107 3300005356 Bacteria 1875
6 Ga0070659_100278920 3300005366 Bacteria 1390
7 Ga0068867_100101401 3300005459 Bacteria 2199
8 Ga0068853_100013075 3300005539 Bacteria 6770
9 Ga0068853_100103370 3300005539 Bacteria 2522
10 Ga0068853_100472265 3300005539 Bacteria 1182
11 Ga0070665_100048093 3300005548 Bacteria 4283
12 Ga0068855_100159988 3300005563 Bacteria 2557
13 Ga0068857_100114849 3300005577 Bacteria 2422
14 Ga0068856_100637116 3300005614 Bacteria 1087
15 Ga0081455_10102059 3300005937 Bacteria 2301
16 Ga0081539_10016432 3300005985 Bacteria 5285
17 Ga0075365_10009658 3300006038 Bacteria 5567
18 Ga0075365_10037523 3300006038 Bacteria 3146
19 Ga0075363_100000229 3300006048 Bacteria 15640
20 Ga0075370_10086206 3300006353 Bacteria 1808
21 Ga0068865_100387690 3300006881 Bacteria 1141
22 Ga0105241_10047803 3300009174 Bacteria 3255
23 Ga0105248_10642833 3300009177 Bacteria 1197
24 Ga0105237_10005230 3300009545 Bacteria 14682
25 Ga0105238_10005636 3300009551 Bacteria 12375
26 Ga0105238_10067509 3300009551 Bacteria 3577
27 Ga0105239_10039006 3300010375 Bacteria 5203
28 Ga0105239_10471490 3300010375 Bacteria 1426
29 Ga0157370_10173752 3300013104 Bacteria 2002
30 Ga0157369_10074750 3300013105 Bacteria 3634
31 Ga0157369_10246474 3300013105 Bacteria 1865
32 Ga0163163_10210651 3300014325 Bacteria 1993
33 Ga0182006_1025652 3300015261 Bacteria 2419
34 Ga0182005_1034187 3300015265 Bacteria 1383
35 Ga0209646_1014253 3300025246 Bacteria 1199
36 Ga0209026_1000029 3300025250 Bacteria 337109
37 Ga0209148_1000080 3300025254 Bacteria 277806
38 Ga0209759_1000040 3300025256 Bacteria 254501
39 Ga0209233_1000028 3300025261 Bacteria 642062
40 Ga0209455_1000171 3300025272 Bacteria 109696
41 Ga0209758_1004174 3300025297 Bacteria 12281
42 Ga0207647_10061712 3300025904 Bacteria 2286
43 Ga0207695_10083580 3300025913 Bacteria 3225
44 Ga0207671_10007609 3300025914 Bacteria 9372
45 Ga0207671_10056911 3300025914 Bacteria 2898
46 Ga0207694_10020591 3300025924 Bacteria 4993
47 Ga0207694_10097148 3300025924 Bacteria 2330
48 Ga0207709_10167389 3300025935 Bacteria 1539
49 Ga0207667_10155182 3300025949 Bacteria 2356
50 Ga0207639_10006049 3300026041 Bacteria 8212
51 Ga0207639_10077468 3300026041 Bacteria 2621
52 Ga0207678_10072285 3300026067 Bacteria 2956
53 Ga0207648_10061983 3300026089 Bacteria 3261
54 Ga0207674_10056954 3300026116 Bacteria 3965
55 Ga0268266_10034917 3300028379 Bacteria 4277
56 Ga0268266_10221401 3300028379 Bacteria 1740
57 Ga0307513_10346345 3300031456 Bacteria 1235
58 Ga0395900_0091055 3300037418 Bacteria 3134
59 Ga0395900_0105588 3300037418 Bacteria 2894
60 Ga0395898_0560898 3300037466 Bacteria 1084
61 Ga0395905_0044707 3300037471 Bacteria 4155
62 Ga0395905_0110052 3300037471 Bacteria 2587
63 Ga0395905_0240814 3300037471 Bacteria 1690
64 Ga0466972_0004602 3300044658 Bacteria 6911
65 Ga0466960_0009402 3300044901 Bacteria 4028
66 Ga0495620_0072030 3300046515 Bacteria 1412
67 Ga0495668_0098555 3300046616 Bacteria 1600
68 Ga0495625_0237513 3300046660 Bacteria 1188
69 Ga0496108_0155035 3300048911 Bacteria 1978
70 Ga0496119_0046375 3300048922 Bacteria 2715
71 Ga0496120_0001370 3300048923 Bacteria 29844
72 Ga0496124_0144430 3300048927 Bacteria 1874
73 Ga0501031_0000007 3300049568 Bacteria 166008
74 Ga0501031_0008039 3300049568 Bacteria 6869
75 Ga0501031_0093499 3300049568 Bacteria 1962
76 Ga0501031_0155589 3300049568 Bacteria 1494
77 Ga0501031_0210377 3300049568 Bacteria 1267
78 Ga0501032_0000007 3300049569 Bacteria 253881
79 Ga0501032_0001473 3300049569 Bacteria 18750
80 Ga0501032_0011413 3300049569 Bacteria 6383
81 Ga0501032_0094093 3300049569 Bacteria 1987
82 Ga0501032_0144247 3300049569 Bacteria 1567
83 Ga0501033_0000051 3300049570 Bacteria 111291
84 Ga0501033_0001192 3300049570 Bacteria 23475
85 Ga0501033_0004047 3300049570 Bacteria 11840
86 Ga0501033_0007442 3300049570 Bacteria 8527
87 Ga0501034_0000029 3300049571 Bacteria 253881
88 Ga0501034_0007241 3300049571 Bacteria 11841
89 Ga0501036_0000004 3300049572 Bacteria 253881
90 Ga0501036_0116188 3300049572 Bacteria 2260
91 Ga0501036_0397999 3300049572 Bacteria 1149
92 Ga0501037_0000004 3300049573 Bacteria 253989
93 Ga0501037_0000264 3300049573 Bacteria 45296
94 Ga0501037_0140463 3300049573 Bacteria 1729
95 Ga0501038_0000005 3300049574 Bacteria 253881
96 Ga0501038_0148967 3300049574 Bacteria 1909
97 Ga0501039_0000009 3300049575 Bacteria 253881
98 Ga0501042_0007394 3300049578 Bacteria 7193
99 Ga0501043_0000620 3300049579 Bacteria 31329
100 Ga0501043_0001215 3300049579 Bacteria 22693
101 Ga0501043_0015283 3300049579 Bacteria 6013
102 Ga0501043_0019788 3300049579 Bacteria 5285
103 Ga0501043_0118755 3300049579 Bacteria 2074
104 Ga0501043_0304439 3300049579 Bacteria 1217
105 Ga0501046_0205003 3300049580 Bacteria 1466
106 Ga0501047_0039291 3300049581 Bacteria 4577
107 Ga0501047_0144363 3300049581 Bacteria 2257
108 Ga0501047_0249277 3300049581 Bacteria 1624
109 Ga0501048_0006373 3300049582 Bacteria 8968
110 Ga0501067_0092902 3300049583 Bacteria 1675
111 Ga0501068_0028906 3300049584 Bacteria 3281
112 Ga0501069_0000007 3300049585 Bacteria 182820
113 Ga0501069_0004063 3300049585 Bacteria 7556
114 Ga0501069_0013087 3300049585 Bacteria 4423
115 Ga0501070_0000229 3300049586 Bacteria 52795
116 Ga0501070_0001901 3300049586 Bacteria 18471
117 Ga0501070_0003212 3300049586 Bacteria 14212
118 Ga0501070_0023667 3300049586 Bacteria 5146
119 Ga0501070_0045121 3300049586 Bacteria 3666
120 Ga0501070_0104170 3300049586 Bacteria 2346
121 Ga0501070_0328033 3300049586 Bacteria 1244
122 Ga0501071_0082806 3300049587 Bacteria 2350
123 Ga0501071_0103203 3300049587 Bacteria 2103
124 Ga0501071_0319229 3300049587 Bacteria 1179
125 Ga0501072_0028309 3300049588 Bacteria 4375
126 Ga0501073_0035327 3300049589 Bacteria 3554
127 Ga0501074_0000254 3300049590 Bacteria 30127
128 Ga0501074_0033019 3300049590 Bacteria 3751
129 Ga0501074_0226722 3300049590 Bacteria 1330
130 Ga0501080_0000550 3300049742 Bacteria 29619
131 Ga0501080_0000724 3300049742 Bacteria 26629
132 Ga0501080_0017096 3300049742 Bacteria 6699
133 Ga0501080_0099467 3300049742 Bacteria 2699
134 Ga0501083_0000125 3300049744 Bacteria 52499
135 Ga0501083_0108723 3300049744 Bacteria 1824
136 Ga0501083_0328061 3300049744 Bacteria 995
137 Ga0501035_0000014 3300049822 Bacteria 253874
138 Ga0501035_0000274 3300049822 Bacteria 61155
139 Ga0501035_0000373 3300049822 Bacteria 51518
140 Ga0501035_0001928 3300049822 Bacteria 20781
141 Ga0501035_0012975 3300049822 Bacteria 7688
142 Ga0501035_0013614 3300049822 Bacteria 7504
143 Ga0501035_0048214 3300049822 Bacteria 3820
144 Ga0501035_0113729 3300049822 Bacteria 2371
145 Ga0501035_0295753 3300049822 Bacteria 1365
146 Ga0501044_0000009 3300049823 Bacteria 270072
147 Ga0501044_0000012 3300049823 Bacteria 253881
148 Ga0501044_0010493 3300049823 Bacteria 10054
149 Ga0501044_0027624 3300049823 Bacteria 5994
150 Ga0501044_0030256 3300049823 Bacteria 5707
151 Ga0501044_0153515 3300049823 Bacteria 2283
152 Ga0501044_0395832 3300049823 Bacteria 1294
153 Ga0501044_0528251 3300049823 Bacteria 1079
154 Ga0501044_0534597 3300049823 Bacteria 1071
155 Ga0501044_0562666 3300049823 Bacteria 1036
156 Ga0501045_0009505 3300049824 Bacteria 6805
157 nmdc:mga0yw44_1659_c1 3300050492 Bacteria 8980
158 nmdc:mga0yw44_20310_c1 3300050492 Bacteria 3684
159 nmdc:mga06z11_69803_c1 3300050494 Bacteria 1856
160 nmdc:mga06z11_98107_c1 3300050494 Bacteria 1603
161 nmdc:mga07m45_54354_c1 3300050496 Bacteria 2263
162 nmdc:mga0sz30_7642_c1 3300050516 Bacteria 3043
163 Ga0500643_046695 3300053087 Bacteria 1250
164 Ga0500568_0000177 3300053139 Bacteria 55762
165 Ga0500604_0023351 3300053151 Bacteria 1763
166 Ga0500620_001119 3300053155 Bacteria 4764
167 Ga0501082_0190285 3300060353 Bacteria 1785
168 2503199967 2503198000 Bacteria 6884444
169 2509118517 2508501123 Bacteria 6283661
170 2509369566 2509276018 Bacteria 6910194
171 2509394876 2509276022 Bacteria 6200534
172 2510319262 2510065059 Bacteria 6847884
173 2512932565 2512875016 Bacteria 6529530
174 2512960580 2512875024 Bacteria 7195110
175 2513608679 2513237090 Bacteria 7096802
176 2514036330 2513237164 Bacteria 7563725
177 2514416491 2513237305 Bacteria 7293571
178 2514587537 2513237351 Bacteria 6968952
179 2588518644 2588253730 Bacteria 6881675
180 2599936432 2599185301 Bacteria 6161860
181 2643774405 2643221550 Bacteria 4619371
182 2643839069 2643221564 Bacteria 4193379
183 2643984871 2643221595 Bacteria 6565519
184 2644133246 2643221623 Bacteria 5239945
185 2644153201 2643221627 Bacteria 6761570
186 2688597215 2687453392 Bacteria 6880454
187 2694628722 2693429783 Bacteria 7019804
188 2694637364 2693429784 Bacteria 7241525
189 2723574417 2721755686 Bacteria 7343952
190 2739307516 2738543024 Bacteria 5603683
191 2756671505 2756170246 Bacteria 7451806
192 2792747998 2791355123 Bacteria 8049106
193 2844008584 2844002411 Bacteria 7168230
194 2844012595 2844009547 Bacteria 6728125
195 2847674996 2847670302 Bacteria 6165597
196 2847691098 2847686936 Bacteria 6278406
197 2856320714 2856314179 Bacteria 6477897
198 2856323077 2856320880 Bacteria 7263508
199 2856334836 2856328259 Bacteria 6528202
200 2856341613 2856334872 Bacteria 7037011
201 2856368036 2856364286 Bacteria 6939991
202 2857351842 2857349434 Bacteria 7926032
203 2857371262 2857367948 Bacteria 6965560
204 2869163832 2869162929 Bacteria 6399702
205 2869171486 2869169390 Bacteria 6659796
206 2869241547 2869234852 Bacteria 6654993
207 2869247878 2869242130 Bacteria 6609239
208 2869251590 2869249662 Bacteria 6868783
209 2869260130 2869256925 Bacteria 6981691
210 2869265208 2869264136 Bacteria 6880765
211 2869282628 2869278585 Bacteria 7077053
212 2869290345 2869285874 Bacteria 6901219
213 2871432629 2871429161 Bacteria 6547891
214 2871436949 2871435913 Bacteria 6880295
215 2871444655 2871444079 Bacteria 6423508
216 2871452302 2871451962 Bacteria 7336357
217 2871460328 2871459585 Bacteria 6866887
218 2871484512 2871481445 Bacteria 6700002
219 2871493247 2871488783 Bacteria 6929816
220 2871496774 2871495908 Bacteria 6935695
221 2874108814 2874102143 Bacteria 6342645
222 2874113735 2874109183 Bacteria 6517025
223 2874122150 2874116593 Bacteria 6674494
224 2874124087 2874123672 Bacteria 7238285
225 2874134835 2874131515 Bacteria 6820270
226 2874142284 2874139085 Bacteria 7021506
227 2874152596 2874146452 Bacteria 7533118
228 2874159996 2874155637 Bacteria 6724144
229 2874167986 2874162495 Bacteria 6174670
230 2874174815 2874168670 Bacteria 8062617
231 2876365182 2876363079 Bacteria 6544991
232 2876384843 2876377896 Bacteria 6565995
233 2876387480 2876386047 Bacteria 6698674
234 2876397995 2876392853 Bacteria 6660880
235 2876402831 2876399893 Bacteria 6927900
236 2876410726 2876406927 Bacteria 6191900
237 2876418512 2876413966 Bacteria 6831344
238 2876424284 2876420981 Bacteria 6687741
239 2878035983 2878035449 Bacteria 6555736
240 2878744532 2878738818 Bacteria 7136951
241 2878750243 2878745973 Bacteria 6867388
242 2878757292 2878753008 Bacteria 6922523
243 2878760998 2878760144 Bacteria 6823465
244 2878767962 2878767105 Bacteria 6898628
245 2878778622 2878774303 Bacteria 6108671
246 2878787597 2878781027 Bacteria 6834456
247 2881149893 2881147464 Bacteria 7779814
248 2881161041 2881155292 Bacteria 6461656
249 2881166774 2881161766 Bacteria 7127907
250 2881853882 2881853255 Bacteria 6698367
251 2881866788 2881861095 Bacteria 7128710
252 2882632534 2882632389 Bacteria 8154593
253 2882917488 2882912400 Bacteria 6801539
254 2885319790 2885318864 Bacteria 6729568
255 2885329762 2885326080 Bacteria 7134805
256 2885334737 2885334103 Bacteria 7216818
257 2885355400 2885350715 Bacteria 6787678
258 2888338296 2888337043 Bacteria 6629336
259 2889010108 2889010040 Bacteria 6749192
260 2903450182 2903448605 Bacteria 7357801
261 2903501019 2903492973 Bacteria 13473544
262 2903504461 2903492973 Bacteria 13473544
263 2903522083 2903521522 Bacteria 6525694
264 2903528461 2903528002 Bacteria 6586099
265 2903541570 2903540706 Bacteria 7062119
266 2904664646 2904659560 Bacteria 6685615
267 2906312601 2906308376 Bacteria 6841989
268 2906325310 2906321335 Bacteria 6579571
269 2906330708 2906328253 Bacteria 6585166
270 2906369659 2906363423 Bacteria 6856682
271 2906373346 2906370794 Bacteria 6881062
272 2906389933 2906386501 Bacteria 5977019
273 2906395689 2906393657 Bacteria 6790866
274 2906402523 2906401398 Bacteria 6693206
275 2906411327 2906408224 Bacteria 6162342
276 2906419837 2906414383 Bacteria 6580790
277 2906429929 2906427513 Bacteria 6375796
278 2922155898 2922151315 Bacteria 6902399
279 2922165227 2922158528 Bacteria 6573167
280 2922172771 2922172374 Bacteria 6167644
281 2922182915 2922178524 Bacteria 6025201
282 2924719827 2924718760 Bacteria 6331356
283 2924727509 2924726620 Bacteria 6271473
284 2924737904 2924733363 Bacteria 7574837
285 2924747581 2924741084 Bacteria 6661321
286 2924750659 2924748358 Bacteria 6154725
287 2924768115 2924762789 Bacteria 6561353
288 2924782562 2924776078 Bacteria 7492003
289 2924786597 2924784321 Bacteria 7416538
290 2937819254 2937813078 Bacteria 7783518
291 2937827805 2937822353 Bacteria 7290551
292 2937852031 2937848649 Bacteria 6983481
293 2937876294 2937868953 Bacteria 6639878
294 2937881205 2937877337 Bacteria 7246526
295 2937977295 2937972304 Bacteria 7532020
296 2937982515 2937980651 Bacteria 6517427
297 2937995427 2937994558 Bacteria 7036190
298 2938021135 2938014810 Bacteria 6700592
299 2958039411 2958034702 Bacteria 6989922
300 2958052961 2958041894 Bacteria 13082850
301 2958056450 2958041894 Bacteria 13082850
302 2958064918 2958064165 Bacteria 7158582
303 2958088238 2958084443 Bacteria 7312792
304 2958100464 2958092219 Bacteria 6861151
305 2958109870 2958108152 Bacteria 6681128
306 2958115488 2958115193 Bacteria 6923548
307 2958129449 2958122699 Bacteria 7280457
308 2958134733 2958130278 Bacteria 6897202
309 2958139937 2958137437 Bacteria 6050276
310 2958151019 2958144490 Bacteria 6677056
311 2958158727 2958158011 Bacteria 6058449
312 2958165900 2958165035 Bacteria 6906348
313 2958186487 2958179912 Bacteria 6874908
314 2961084986 2961077736 Bacteria 7079850
315 2961119644 2961114664 Bacteria 6680456
316 2961133140 2961127735 Bacteria 7196641
317 2961137251 2961136820 Bacteria 6775228
318 2961164363 2961163497 Bacteria 6901077
319 2961175379 2961170736 Bacteria 7072258
320 2961190234 2961183825 Bacteria 6688536
321 2963646637 2963644680 Bacteria 6530403
322 2965019349 2965018300 Bacteria 6883036
323 2965027591 2965025482 Bacteria 6532201
324 2965033271 2965032056 Bacteria 6887443
325 2965043469 2965040258 Bacteria 6855979
326 2965048959 2965047637 Bacteria 6623551
327 2965062512 2965062239 Bacteria 7412989
328 2965089582 2965089291 Bacteria 6866420
329 2967999619 2967996073 Bacteria 6787468
330 2968007977 2968003550 Bacteria 6929263
331 2968020738 2968016561 Bacteria 7022047
332 2968090570 2968083720 Bacteria 7351627
333 2968094746 2968091066 Bacteria 6052692
334 2968103113 2968097103 Bacteria 6107094
335 2968115899 2968110612 Bacteria 6814636
336 2968133684 2968128360 Bacteria 6270294
337 2968142663 2968138860 Bacteria 6605449
338 2968172764 2968171901 Bacteria 6894245
339 2970474035 2970469710 Bacteria 6969209
340 2970490674 2970489779 Bacteria 6517260
341 2970507967 2970503327 Bacteria 7099517
342 2970515327 2970510686 Bacteria 7006402
343 2970534675 2970532167 Bacteria 6553173
344 2970552292 2970547951 Bacteria 6931819
345 2970555856 2970554993 Bacteria 6814252
346 2970597237 2970593180 Bacteria 7073582
347 2970632736 2970627176 Bacteria 6680862
348 2977826451 2977821940 Bacteria 6906439
349 2977830305 2977828996 Bacteria 7007971
350 2977848389 2977843712 Bacteria 6753583
351 2977855566 2977851361 Bacteria 6694324
352 2977859083 2977858184 Bacteria 6215359
353 2977865143 2977864932 Bacteria 7534097
354 2977880108 2977872689 Bacteria 7270173
355 2977916607 2977915119 Bacteria 6829656
356 2977922955 2977922695 Bacteria 6956781
357 2977940301 2977935797 Bacteria 6252826
358 2977944762 2977942078 Bacteria 7570577
359 2977952131 2977950692 Bacteria 6893264
360 2977962329 2977957713 Bacteria 6877875
361 2977987805 2977986579 Bacteria 6581278
362 2979770007 2979764755 Bacteria 6610066
363 2979779286 2979772303 Bacteria 6618277
364 2979785295 2979779861 Bacteria 6219781
365 2979797576 2979793036 Bacteria 6808957
366 2979813151 2979808191 Bacteria 7179355
367 2987639026 2987636660 Bacteria 8088555
368 2987647026 2987645492 Bacteria 6117018
369 2987660367 2987659509 Bacteria 6966464
370 2987671463 2987666974 Bacteria 6509233
371 2987680975 2987673487 Bacteria 6884027
372 2996312115 2996310559 Bacteria 6357320
373 2996338735 2996336353 Bacteria 5511628
374 2996344243 2996341866 Bacteria 6643098
375 2996352645 2996348954 Bacteria 7239054
376 2996390000 2996386984 Bacteria 6978667
377 3004189418 3004188549 Bacteria 6952365
378 3004204731 3004203850 Bacteria 7307914
379 3004218032 3004211236 Bacteria 7417683
380 3004220920 3004218560 Bacteria 7421728
381 3004234127 3004232784 Bacteria 6662140
382 3004249893 3004248173 Bacteria 6563236
383 3004273926 3004268573 Bacteria 7043476
384 3004279327 3004275668 Bacteria 7114440
385 3004289269 3004289098 Bacteria 6135450
386 3004335766 3004334049 Bacteria 8449246
387 649871769 649633066 Bacteria 6690028
388 8002291642 8002285264 Bacteria 6717907
389 8004302667 8004300914 Bacteria 6132239
390 8004318776 8004312739 Bacteria 7444653
391 8004362200 8004361976 Bacteria 6858373
392 8004378867 8004374579 Bacteria 6898112
393 8004392551 8004387939 Bacteria 7049250
394 8004449136 8004445564 Bacteria 6322258
395 8004645155 8004640170 Bacteria 6723001
396 8004699334 8004695233 Bacteria 6731676
397 8004712080 8004703790 Bacteria 8006957
398 8004718860 8004714634 Bacteria 6776161
399 8004731842 8004727605 Bacteria 6643904
400 Ga0501033_0016361
401 JGI25165J46597_1000042
402 Ga0055542_1000981
403 Ga0055529_1001600
404 Ga0070674_100130107
405 Ga0070659_100278920
406 Ga0068867_100101401
407 Ga0068853_100013075
408 Ga0068853_100103370
409 Ga0068853_100472265
410 Ga0070665_100048093
411 Ga0068855_100159988
412 Ga0068857_100114849
413 Ga0068856_100637116
414 Ga0081455_10102059
415 Ga0081539_10016432
416 Ga0075365_10009658
417 Ga0075365_10037523
418 Ga0075363_100000229
419 Ga0075370_10086206
420 Ga0068865_100387690
421 Ga0105241_10047803
422 Ga0105248_10642833
423 Ga0105237_10005230
424 Ga0105238_10005636
425 Ga0105238_10067509
426 Ga0105239_10039006
427 Ga0105239_10471490
428 Ga0157370_10173752
429 Ga0157369_10074750
430 Ga0157369_10246474
431 Ga0163163_10210651
432 Ga0182006_1025652
433 Ga0182005_1034187
434 Ga0209646_1014253
435 Ga0209026_1000029
436 Ga0209148_1000080
437 Ga0209759_1000040
438 Ga0209233_1000028
439 Ga0209455_1000171
440 Ga0209758_1004174
441 Ga0207647_10061712
442 Ga0207695_10083580
443 Ga0207671_10007609
444 Ga0207671_10056911
445 Ga0207694_10020591
446 Ga0207694_10097148
447 Ga0207709_10167389
448 Ga0207667_10155182
449 Ga0207639_10006049
450 Ga0207639_10077468
451 Ga0207678_10072285
452 Ga0207648_10061983
453 Ga0207674_10056954
454 Ga0268266_10034917
455 Ga0268266_10221401
456 Ga0307513_10346345
457 Ga0395900_0091055
458 Ga0395900_0105588
459 Ga0395898_0560898
460 Ga0395905_0044707
461 Ga0395905_0110052
462 Ga0395905_0240814
463 Ga0466972_0004602
464 Ga0466960_0009402
465 Ga0495620_0072030
466 Ga0495668_0098555
467 Ga0495625_0237513
468 Ga0496108_0155035
469 Ga0496119_0046375
470 Ga0496120_0001370
471 Ga0496124_0144430
472 Ga0501031_0000007
473 Ga0501031_0008039
474 Ga0501031_0093499
475 Ga0501031_0155589
476 Ga0501031_0210377
477 Ga0501032_0000007
478 Ga0501032_0001473
479 Ga0501032_0011413
480 Ga0501032_0094093
481 Ga0501032_0144247
482 Ga0501033_0000051
483 Ga0501033_0001192
484 Ga0501033_0004047
485 Ga0501033_0007442
486 Ga0501034_0000029
487 Ga0501034_0007241
488 Ga0501036_0000004
489 Ga0501036_0116188
490 Ga0501036_0397999
491 Ga0501037_0000004
492 Ga0501037_0000264
493 Ga0501037_0140463
494 Ga0501038_0000005
495 Ga0501038_0148967
496 Ga0501039_0000009
497 Ga0501042_0007394
498 Ga0501043_0000620
499 Ga0501043_0001215
500 Ga0501043_0015283
501 Ga0501043_0019788
502 Ga0501043_0118755
503 Ga0501043_0304439
504 Ga0501046_0205003
505 Ga0501047_0039291
506 Ga0501047_0144363
507 Ga0501047_0249277
508 Ga0501048_0006373
509 Ga0501067_0092902
510 Ga0501068_0028906
511 Ga0501069_0000007
512 Ga0501069_0004063
513 Ga0501069_0013087
514 Ga0501070_0000229
515 Ga0501070_0001901
516 Ga0501070_0003212
517 Ga0501070_0023667
518 Ga0501070_0045121
519 Ga0501070_0104170
520 Ga0501070_0328033
521 Ga0501071_0082806
522 Ga0501071_0103203
523 Ga0501071_0319229
524 Ga0501072_0028309
525 Ga0501073_0035327
526 Ga0501074_0000254
527 Ga0501074_0033019
528 Ga0501074_0226722
529 Ga0501080_0000550
530 Ga0501080_0000724
531 Ga0501080_0017096
532 Ga0501080_0099467
533 Ga0501083_0000125
534 Ga0501083_0108723
535 Ga0501083_0328061
536 Ga0501035_0000014
537 Ga0501035_0000274
538 Ga0501035_0000373
539 Ga0501035_0001928
540 Ga0501035_0012975
541 Ga0501035_0013614
542 Ga0501035_0048214
543 Ga0501035_0113729
544 Ga0501035_0295753
545 Ga0501044_0000009
546 Ga0501044_0000012
547 Ga0501044_0010493
548 Ga0501044_0027624
549 Ga0501044_0030256
550 Ga0501044_0153515
551 Ga0501044_0395832
552 Ga0501044_0528251
553 Ga0501044_0534597
554 Ga0501044_0562666
555 Ga0501045_0009505
556 nmdc:mga0yw44_1659_c1
557 nmdc:mga0yw44_20310_c1
558 nmdc:mga06z11_69803_c1
559 nmdc:mga06z11_98107_c1
560 nmdc:mga07m45_54354_c1
561 nmdc:mga0sz30_7642_c1
562 Ga0500643_046695
563 Ga0500568_0000177
564 Ga0500604_0023351
565 Ga0500620_001119
566 Ga0501082_0190285
567 2503199967
568 2509118517
569 2509369566
570 2509394876
571 2510319262
572 2512932565
573 2512960580
574 2513608679
575 2514036330
576 2514416491
577 2514587537
578 2588518644
579 2599936432
580 2643774405
581 2643839069
582 2643984871
583 2644133246
584 2644153201
585 2688597215
586 2694628722
587 2694637364
588 2723574417
589 2739307516
590 2756671505
591 2792747998
592 2844008584
593 2844012595
594 2847674996
595 2847691098
596 2856320714
597 2856323077
598 2856334836
599 2856341613
600 2856368036
601 2857351842
602 2857371262
603 2869163832
604 2869171486
605 2869241547
606 2869247878
607 2869251590
608 2869260130
609 2869265208
610 2869282628
611 2869290345
612 2871432629
613 2871436949
614 2871444655
615 2871452302
616 2871460328
617 2871484512
618 2871493247
619 2871496774
620 2874108814
621 2874113735
622 2874122150
623 2874124087
624 2874134835
625 2874142284
626 2874152596
627 2874159996
628 2874167986
629 2874174815
630 2876365182
631 2876384843
632 2876387480
633 2876397995
634 2876402831
635 2876410726
636 2876418512
637 2876424284
638 2878035983
639 2878744532
640 2878750243
641 2878757292
642 2878760998
643 2878767962
644 2878778622
645 2878787597
646 2881149893
647 2881161041
648 2881166774
649 2881853882
650 2881866788
651 2882632534
652 2882917488
653 2885319790
654 2885329762
655 2885334737
656 2885355400
657 2888338296
658 2889010108
659 2903450182
660 2903501019
661 2903504461
662 2903522083
663 2903528461
664 2903541570
665 2904664646
666 2906312601
667 2906325310
668 2906330708
669 2906369659
670 2906373346
671 2906389933
672 2906395689
673 2906402523
674 2906411327
675 2906419837
676 2906429929
677 2922155898
678 2922165227
679 2922172771
680 2922182915
681 2924719827
682 2924727509
683 2924737904
684 2924747581
685 2924750659
686 2924768115
687 2924782562
688 2924786597
689 2937819254
690 2937827805
691 2937852031
692 2937876294
693 2937881205
694 2937977295
695 2937982515
696 2937995427
697 2938021135
698 2958039411
699 2958052961
700 2958056450
701 2958064918
702 2958088238
703 2958100464
704 2958109870
705 2958115488
706 2958129449
707 2958134733
708 2958139937
709 2958151019
710 2958158727
711 2958165900
712 2958186487
713 2961084986
714 2961119644
715 2961133140
716 2961137251
717 2961164363
718 2961175379
719 2961190234
720 2963646637
721 2965019349
722 2965027591
723 2965033271
724 2965043469
725 2965048959
726 2965062512
727 2965089582
728 2967999619
729 2968007977
730 2968020738
731 2968090570
732 2968094746
733 2968103113
734 2968115899
735 2968133684
736 2968142663
737 2968172764
738 2970474035
739 2970490674
740 2970507967
741 2970515327
742 2970534675
743 2970552292
744 2970555856
745 2970597237
746 2970632736
747 2977826451
748 2977830305
749 2977848389
750 2977855566
751 2977859083
752 2977865143
753 2977880108
754 2977916607
755 2977922955
756 2977940301
757 2977944762
758 2977952131
759 2977962329
760 2977987805
761 2979770007
762 2979779286
763 2979785295
764 2979797576
765 2979813151
766 2987639026
767 2987647026
768 2987660367
769 2987671463
770 2987680975
771 2996312115
772 2996338735
773 2996344243
774 2996352645
775 2996390000
776 3004189418
777 3004204731
778 3004218032
779 3004220920
780 3004234127
781 3004249893
782 3004273926
783 3004279327
784 3004289269
785 3004335766
786 649871769
787 8002291642
788 8004302667
789 8004318776
790 8004362200
791 8004378867
792 8004392551
793 8004449136
794 8004645155
795 8004699334
796 8004712080
797 8004718860
798 8004731842

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11927

HODM_asu-like

Haem-dependent oxidative N-demethylase, alpha subunit-like

38

315

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lte-assembly1.cif.gz_A crystal structure of the alpha subunit of heme dependent oxidative n-demethylase (hodm) 0.7154 10 305
5lte-assembly1.cif.gz_A crystal structure of the alpha subunit of heme dependent oxidative n-demethylase (hodm) 0.6862 10 305
8ck4-assembly1.cif.gz_A structure of hif2a-arnt heterodimer in complex with (4s)-1-(3,5-difluorophenyl)-5,5-difluoro-3-methanesulfonyl-4,5,6,7-tetrahydro-2-benzothiophen-4-ol 0.6009 119 253
3lif-assembly2.cif.gz_B crystal structure of the extracellular domain of the putative histidine kinase rphk1s-z16 0.5639 233 264
8ck4-assembly1.cif.gz_A structure of hif2a-arnt heterodimer in complex with (4s)-1-(3,5-difluorophenyl)-5,5-difluoro-3-methanesulfonyl-4,5,6,7-tetrahydro-2-benzothiophen-4-ol 0.5443 119 253
ID Description Score Start End Superfamily
3cswD01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.6745 233 251 3.30.470.10
af_Q9Z1L5_477_622_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.6403 185 254 3.30.450.20
3lifB02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.6128 233 254 3.30.450.20
af_A0A1D8PJC6_408_551_2.60.40.1670 Mainly Beta;Sandwich;Immunoglobulin-like;beta-sandwich domain of Sec23/24 0.5976 219 255 2.60.40.1670
af_I1NDE0_256_535_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.5729 180 255 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3S1DBH0-F1-model_v4 DUF3445 domain-containing protein 0.92 211 306
AF-A0A530A437-F1-model_v4 deleted 0.8928 191 309
AF-A0A3S1DBH0-F1-model_v4 DUF3445 domain-containing protein 0.8854 211 306
AF-A0A530A437-F1-model_v4 deleted 0.8792 191 309
AF-U5H0E0-F1-model_v4 Uncharacterized protein 0.8758 21 84

Map