F434391

General Info

Members Datasets Scaffolds Average Seq Length
399 192 798 114

Family's Representative Sequence

Representative Sequence 3300048088|Ga0495602_1070919|Ga0495602_1070919_22_354
Length 110
Sequence MKQRSRLDLLQGTLDLLILRALQTEPMHGWAISERIQQTSEVLHVNQGSLYPALHRLEHQGWIEAEWGISELGRRARFYRLNKAGRKQLELEADQWARLTAAISRVLDLA

Samples

Sample ID Description Type Environment
1 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
125 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
126 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
127 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.02
Nodule 0
Rhizoplane 1.25
Rhizosphere 90.48
Stem 0
Stem Tuber 0
Unclassified 27.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495602_1070919 3300048088 Unclassified 529
2 rootH1_10290127 3300003323 Bacteria 5296
3 Ga0065707_10124533 3300005295 Bacteria 2042
4 Ga0070658_10552365 3300005327 Bacteria 997
5 Ga0070683_100008840 3300005329 Bacteria 8572
6 Ga0070683_100468726 3300005329 Unclassified 1202
7 Ga0068869_100073629 3300005334 Bacteria 2533
8 Ga0070666_10645196 3300005335 Bacteria 774
9 Ga0070687_100543883 3300005343 Unclassified 789
10 Ga0070671_100263644 3300005355 Bacteria 1464
11 Ga0070673_100098796 3300005364 Bacteria 2400
12 Ga0070673_100413700 3300005364 Unclassified 1208
13 Ga0070659_100494303 3300005366 Bacteria 1042
14 Ga0070659_101042664 3300005366 Bacteria 719
15 Ga0070659_101407058 3300005366 Bacteria 620
16 Ga0070705_100212220 3300005440 Unclassified 1335
17 Ga0070694_100645580 3300005444 Bacteria 856
18 Ga0070708_100131020 3300005445 Bacteria 2321
19 Ga0070678_100682036 3300005456 Unclassified 924
20 Ga0070685_11064640 3300005466 Unclassified 610
21 Ga0070707_101372738 3300005468 Unclassified 673
22 Ga0070698_100023255 3300005471 Bacteria 6479
23 Ga0070698_100901850 3300005471 Unclassified 830
24 Ga0070699_100124167 3300005518 Bacteria 2272
25 Ga0070699_100449338 3300005518 Unclassified 1168
26 Ga0070684_100009089 3300005535 Bacteria 7812
27 Ga0070684_101774010 3300005535 Unclassified 582
28 Ga0070697_100019473 3300005536 Bacteria 5361
29 Ga0068853_101239942 3300005539 Unclassified 720
30 Ga0070686_100205899 3300005544 Bacteria 1413
31 Ga0070686_101044733 3300005544 Bacteria 672
32 Ga0070696_100723505 3300005546 Bacteria 813
33 Ga0070665_100212835 3300005548 Bacteria 1934
34 Ga0068855_100820491 3300005563 Bacteria 987
35 Ga0068857_100374400 3300005577 Unclassified 1321
36 Ga0068857_100633667 3300005577 Bacteria 1012
37 Ga0068856_100247004 3300005614 Unclassified 1800
38 Ga0068859_100400750 3300005617 Bacteria 1468
39 Ga0068859_101279458 3300005617 Bacteria 808
40 Ga0068864_100575095 3300005618 Unclassified 1091
41 Ga0068866_10039750 3300005718 Bacteria 2324
42 Ga0068866_10094183 3300005718 Bacteria 1638
43 Ga0068863_100831549 3300005841 Bacteria 922
44 Ga0068863_101031880 3300005841 Unclassified 826
45 Ga0068860_100142694 3300005843 Bacteria 2303
46 Ga0068860_101659998 3300005843 Bacteria 661
47 Ga0068862_100349504 3300005844 Bacteria 1371
48 Ga0081455_10052875 3300005937 Unclassified 3474
49 Ga0081455_10562679 3300005937 Bacteria 751
50 Ga0081540_1191844 3300005983 Bacteria 753
51 Ga0075365_10223206 3300006038 Bacteria 1322
52 Ga0075368_10006570 3300006042 Bacteria 4069
53 Ga0075368_10054669 3300006042 Bacteria 1591
54 Ga0075368_10083220 3300006042 Bacteria 1304
55 Ga0075364_10005410 3300006051 Bacteria 7414
56 Ga0075364_10519606 3300006051 Bacteria 814
57 Ga0070712_100851161 3300006175 Bacteria 784
58 Ga0075367_10033537 3300006178 Bacteria 2960
59 Ga0075367_10050650 3300006178 Bacteria 2452
60 Ga0075367_10115932 3300006178 Bacteria 1647
61 Ga0075366_10016917 3300006195 Bacteria 4191
62 Ga0097621_100929137 3300006237 Bacteria 811
63 Ga0097621_101391736 3300006237 Unclassified 664
64 Ga0075370_10081301 3300006353 Bacteria 1862
65 Ga0075370_10312777 3300006353 Unclassified 935
66 Ga0075428_100593902 3300006844 Unclassified 1183
67 Ga0075428_100983566 3300006844 Unclassified 893
68 Ga0075428_101506129 3300006844 Bacteria 705
69 Ga0075428_102205193 3300006844 Unclassified 568
70 Ga0075428_102243757 3300006844 Bacteria 563
71 Ga0075430_100030112 3300006846 Unclassified 4608
72 Ga0075430_100073563 3300006846 Bacteria 2866
73 Ga0075430_100290759 3300006846 Bacteria 1352
74 Ga0075430_100347459 3300006846 Unclassified 1225
75 Ga0075431_100008764 3300006847 Bacteria 10135
76 Ga0075431_100040293 3300006847 Unclassified 4814
77 Ga0075431_100043027 3300006847 Unclassified 4660
78 Ga0075431_100749740 3300006847 Bacteria 952
79 Ga0075433_10049055 3300006852 Unclassified 3672
80 Ga0075434_100009309 3300006871 Bacteria 9151
81 Ga0075434_100398546 3300006871 Bacteria 1397
82 Ga0075434_100722617 3300006871 Unclassified 1013
83 Ga0075429_100017283 3300006880 Bacteria 6238
84 Ga0075429_100253059 3300006880 Bacteria 1542
85 Ga0075429_100448347 3300006880 Bacteria 1131
86 Ga0075429_100822288 3300006880 Unclassified 813
87 Ga0075429_100911812 3300006880 Bacteria 769
88 Ga0075429_101399513 3300006880 Bacteria 609
89 Ga0068865_101106728 3300006881 Bacteria 698
90 Ga0075436_100095611 3300006914 Bacteria 2067
91 Ga0097620_100400777 3300006931 Bacteria 1468
92 Ga0097620_101279769 3300006931 Bacteria 808
93 Ga0075435_100458499 3300007076 Unclassified 1100
94 Ga0075435_100664696 3300007076 Bacteria 905
95 Ga0105240_10001021 3300009093 Bacteria 49928
96 Ga0105240_10991329 3300009093 Bacteria 899
97 Ga0111539_10028950 3300009094 Bacteria 6755
98 Ga0114129_10000410 3300009147 Bacteria 50569
99 Ga0114129_10039232 3300009147 Bacteria 6676
100 Ga0114129_10191761 3300009147 Unclassified 2775
101 Ga0114129_10421324 3300009147 Bacteria 1756
102 Ga0114129_10679675 3300009147 Bacteria 1325
103 Ga0114129_10711375 3300009147 Bacteria 1290
104 Ga0114129_11590144 3300009147 Bacteria 801
105 Ga0105243_10239795 3300009148 Bacteria 1613
106 Ga0105241_11202389 3300009174 Unclassified 718
107 Ga0105242_10075612 3300009176 Bacteria 2805
108 Ga0105242_10442446 3300009176 Bacteria 1223
109 Ga0105248_10059133 3300009177 Bacteria 4305
110 Ga0105248_10473342 3300009177 Unclassified 1412
111 Ga0105248_11294070 3300009177 Bacteria 825
112 Ga0105248_11312421 3300009177 Bacteria 818
113 Ga0105237_10004754 3300009545 Bacteria 15616
114 Ga0105237_10142224 3300009545 Unclassified 2394
115 Ga0105237_10809840 3300009545 Bacteria 943
116 Ga0105238_10577492 3300009551 Unclassified 1130
117 Ga0105249_11342503 3300009553 Bacteria 787
118 Ga0105239_10212809 3300010375 Bacteria 2167
119 Ga0105239_10746996 3300010375 Unclassified 1120
120 Ga0105246_10229993 3300011119 Unclassified 1459
121 Ga0157369_10163943 3300013105 Bacteria 2345
122 Ga0157374_11896229 3300013296 Unclassified 622
123 Ga0157378_10001974 3300013297 Bacteria 18343
124 Ga0157378_10767966 3300013297 Bacteria 988
125 Ga0163162_10016859 3300013306 Bacteria 7141
126 Ga0163162_10390838 3300013306 Bacteria 1524
127 Ga0157372_10049925 3300013307 Bacteria 4654
128 Ga0157372_10201518 3300013307 Unclassified 2305
129 Ga0157372_11765397 3300013307 Unclassified 712
130 Ga0157375_10743662 3300013308 Unclassified 1132
131 Ga0157375_12864240 3300013308 Bacteria 577
132 Ga0163163_11243749 3300014325 Unclassified 807
133 Ga0163163_13103072 3300014325 Unclassified 518
134 Ga0157380_11350714 3300014326 Unclassified 762
135 Ga0157380_12137808 3300014326 Unclassified 623
136 Ga0157376_11280728 3300014969 Bacteria 763
137 Ga0157376_11534261 3300014969 Unclassified 699
138 Ga0224572_1005925 3300024225 Bacteria 2198
139 Ga0207653_10284066 3300025885 Bacteria 639
140 Ga0207642_10027419 3300025899 Bacteria 2331
141 Ga0207642_10787179 3300025899 Bacteria 604
142 Ga0207680_10169266 3300025903 Bacteria 1470
143 Ga0207695_10006325 3300025913 Bacteria 15405
144 Ga0207695_10230665 3300025913 Unclassified 1756
145 Ga0207671_10046761 3300025914 Bacteria 3202
146 Ga0207671_10115156 3300025914 Unclassified 2049
147 Ga0207694_10324049 3300025924 Bacteria 1272
148 Ga0207690_10319572 3300025932 Bacteria 1220
149 Ga0207690_11880045 3300025932 Unclassified 500
150 Ga0207686_10077769 3300025934 Bacteria 2155
151 Ga0207686_10342783 3300025934 Bacteria 1123
152 Ga0207709_10232985 3300025935 Bacteria 1335
153 Ga0207669_10066697 3300025937 Bacteria 2239
154 Ga0207704_10532399 3300025938 Bacteria 952
155 Ga0207711_10159314 3300025941 Bacteria 2042
156 Ga0207711_10330882 3300025941 Bacteria 1409
157 Ga0207711_11376121 3300025941 Bacteria 648
158 Ga0207689_10253107 3300025942 Bacteria 1456
159 Ga0207661_10013699 3300025944 Bacteria 5922
160 Ga0207679_11055042 3300025945 Bacteria 745
161 Ga0207667_10146441 3300025949 Bacteria 2431
162 Ga0207651_10137285 3300025960 Bacteria 1883
163 Ga0207658_10981538 3300025986 Unclassified 770
164 Ga0207678_10494062 3300026067 Bacteria 1066
165 Ga0207702_10186980 3300026078 Unclassified 1911
166 Ga0207641_10876774 3300026088 Bacteria 890
167 Ga0207648_10270582 3300026089 Bacteria 1518
168 Ga0207674_10511861 3300026116 Bacteria 1159
169 Ga0207674_10868902 3300026116 Unclassified 869
170 Ga0209813_10074724 3300027866 Bacteria 1109
171 Ga0207428_10001904 3300027907 Bacteria 21126
172 Ga0268266_10077176 3300028379 Bacteria 2896
173 Ga0268265_10333059 3300028380 Bacteria 1379
174 Ga0268264_10256624 3300028381 Bacteria 1626
175 Ga0268264_11697608 3300028381 Bacteria 642
176 Ga0265323_10045974 3300028653 Bacteria 1566
177 Ga0265338_10231406 3300028800 Bacteria 1374
178 Ga0265338_10458018 3300028800 Bacteria 902
179 Ga0265320_10117462 3300031240 Bacteria 1215
180 Ga0265325_10266071 3300031241 Bacteria 772
181 Ga0265340_10036556 3300031247 Bacteria 2433
182 Ga0265340_10188795 3300031247 Unclassified 930
183 Ga0265339_10000023 3300031249 Bacteria 169980
184 Ga0265339_10201096 3300031249 Bacteria 983
185 Ga0265331_10011016 3300031250 Bacteria 4963
186 Ga0265316_10232107 3300031344 Bacteria 1358
187 Ga0265316_10411491 3300031344 Bacteria 973
188 Ga0307408_102205264 3300031548 Bacteria 532
189 Ga0265313_10017717 3300031595 Bacteria 4030
190 Ga0265342_10001352 3300031712 Bacteria 22957
191 Ga0265342_10091805 3300031712 Bacteria 1739
192 Ga0307516_10685621 3300031730 Unclassified 681
193 Ga0307405_11104044 3300031731 Bacteria 682
194 Ga0307406_11153264 3300031901 Bacteria 671
195 Ga0307412_12313483 3300031911 Bacteria 502
196 Ga0307416_101056019 3300032002 Bacteria 916
197 Ga0373943_0243237 3300035170 Bacteria 1009
198 Ga0373943_0470383 3300035170 Bacteria 732
199 Ga0436364_0811322 3300037853 Unclassified 642
200 Ga0436365_1083321 3300039437 Unclassified 509
201 Ga0451837_1292494 3300041494 Bacteria 670
202 Ga0450888_018880 3300042126 Bacteria 865
203 Ga0439446_0288574 3300042156 Bacteria 574
204 Ga0439435_0002508 3300042436 Bacteria 3664
205 Ga0466959_0002068 3300045049 Bacteria 12696
206 Ga0495592_0605393 3300046454 Bacteria 668
207 Ga0495592_0880067 3300046454 Unclassified 527
208 Ga0495639_0045838 3300046475 Bacteria 1979
209 Ga0495640_0252926 3300046533 Bacteria 1103
210 Ga0495586_0152678 3300046535 Bacteria 1300
211 Ga0495587_0547821 3300046536 Bacteria 638
212 Ga0495621_0219801 3300046539 Unclassified 769
213 Ga0495634_0260204 3300046642 Bacteria 1059
214 Ga0495658_0021672 3300046683 Bacteria 3391
215 Ga0495669_0580545 3300046684 Unclassified 545
216 Ga0495674_0214154 3300047319 Bacteria 1595
217 Ga0496101_0427077 3300048904 Bacteria 1045
218 Ga0496101_0825786 3300048904 Unclassified 731
219 Ga0496102_0001656 3300048905 Bacteria 19581
220 Ga0496107_0177608 3300048910 Unclassified 1581
221 Ga0496110_1131441 3300048913 Bacteria 691
222 Ga0501031_0068499 3300049568 Unclassified 2312
223 Ga0501031_0109946 3300049568 Bacteria 1800
224 Ga0501031_0413640 3300049568 Bacteria 872
225 Ga0501032_0025639 3300049569 Bacteria 4064
226 Ga0501032_0032892 3300049569 Bacteria 3553
227 Ga0501032_0079403 3300049569 Bacteria 2185
228 Ga0501033_0033443 3300049570 Bacteria 3859
229 Ga0501034_0001343 3300049571 Bacteria 33241
230 Ga0501034_0076257 3300049571 Bacteria 3359
231 Ga0501034_0094422 3300049571 Unclassified 2987
232 Ga0501034_0135185 3300049571 Bacteria 2446
233 Ga0501034_0242684 3300049571 Bacteria 1747
234 Ga0501034_0987143 3300049571 Unclassified 726
235 Ga0501034_1588725 3300049571 Unclassified 527
236 Ga0501036_0019282 3300049572 Bacteria 5724
237 Ga0501036_0056452 3300049572 Unclassified 3327
238 Ga0501036_0127613 3300049572 Bacteria 2148
239 Ga0501036_0144643 3300049572 Bacteria 2006
240 Ga0501036_0209393 3300049572 Bacteria 1638
241 Ga0501036_0243365 3300049572 Bacteria 1508
242 Ga0501037_0184492 3300049573 Unclassified 1479
243 Ga0501037_0252687 3300049573 Bacteria 1233
244 Ga0501038_0024893 3300049574 Bacteria 5335
245 Ga0501038_0043450 3300049574 Unclassified 3908
246 Ga0501038_0120226 3300049574 Bacteria 2167
247 Ga0501038_0187422 3300049574 Bacteria 1666
248 Ga0501038_0633517 3300049574 Bacteria 806
249 Ga0501038_1087878 3300049574 Bacteria 584
250 Ga0501039_0035049 3300049575 Bacteria 3873
251 Ga0501039_0056338 3300049575 Bacteria 3045
252 Ga0501040_0164535 3300049576 Bacteria 1569
253 Ga0501040_0201613 3300049576 Bacteria 1413
254 Ga0501041_0097201 3300049577 Bacteria 1821
255 Ga0501041_0584105 3300049577 Bacteria 713
256 Ga0501042_0163659 3300049578 Bacteria 1605
257 Ga0501042_0369901 3300049578 Unclassified 1037
258 Ga0501043_0037893 3300049579 Bacteria 3792
259 Ga0501043_0062358 3300049579 Bacteria 2927
260 Ga0501043_0114836 3300049579 Bacteria 2113
261 Ga0501046_0004294 3300049580 Bacteria 12971
262 Ga0501046_0005991 3300049580 Bacteria 10818
263 Ga0501046_0032140 3300049580 Bacteria 4251
264 Ga0501046_0106058 3300049580 Bacteria 2151
265 Ga0501046_0110838 3300049580 Bacteria 2096
266 Ga0501046_0602180 3300049580 Bacteria 780
267 Ga0501046_0615295 3300049580 Unclassified 770
268 Ga0501046_0859475 3300049580 Bacteria 634
269 Ga0501047_0008809 3300049581 Bacteria 9520
270 Ga0501047_0014171 3300049581 Bacteria 7575
271 Ga0501047_0092113 3300049581 Unclassified 2909
272 Ga0501047_0107205 3300049581 Bacteria 2675
273 Ga0501047_0110807 3300049581 Bacteria 2627
274 Ga0501047_0145512 3300049581 Bacteria 2247
275 Ga0501047_0203756 3300049581 Bacteria 1838
276 Ga0501048_0102600 3300049582 Bacteria 2018
277 Ga0501048_0175381 3300049582 Bacteria 1519
278 Ga0501048_0176052 3300049582 Unclassified 1516
279 Ga0501067_0035561 3300049583 Bacteria 2766
280 Ga0501067_0062967 3300049583 Unclassified 2054
281 Ga0501067_0128588 3300049583 Unclassified 1409
282 Ga0501068_0070841 3300049584 Unclassified 2127
283 Ga0501068_0159191 3300049584 Unclassified 1423
284 Ga0501068_0289862 3300049584 Bacteria 1047
285 Ga0501068_1061622 3300049584 Bacteria 535
286 Ga0501069_0014311 3300049585 Bacteria 4240
287 Ga0501070_0057844 3300049586 Unclassified 3215
288 Ga0501070_0189664 3300049586 Unclassified 1690
289 Ga0501070_1384228 3300049586 Bacteria 535
290 Ga0501071_0042103 3300049587 Bacteria 3270
291 Ga0501071_0861997 3300049587 Unclassified 699
292 Ga0501072_0036919 3300049588 Bacteria 3832
293 Ga0501072_0038289 3300049588 Bacteria 3763
294 Ga0501072_0044681 3300049588 Bacteria 3483
295 Ga0501072_0082515 3300049588 Bacteria 2548
296 Ga0501073_0019930 3300049589 Unclassified 4838
297 Ga0501073_0095027 3300049589 Bacteria 2070
298 Ga0501073_0123015 3300049589 Bacteria 1798
299 Ga0501073_0126664 3300049589 Bacteria 1770
300 Ga0501073_0136013 3300049589 Bacteria 1703
301 Ga0501073_0180586 3300049589 Bacteria 1460
302 Ga0501073_0394037 3300049589 Bacteria 957
303 Ga0501073_0589691 3300049589 Unclassified 768
304 Ga0501073_1005032 3300049589 Bacteria 574
305 Ga0501074_0202009 3300049590 Bacteria 1416
306 Ga0501074_0849303 3300049590 Unclassified 643
307 Ga0501075_0040258 3300049591 Bacteria 3499
308 Ga0501075_0973753 3300049591 Unclassified 644
309 Ga0501075_1343789 3300049591 Unclassified 541
310 Ga0501076_0016167 3300049592 Bacteria 5651
311 Ga0501076_0151751 3300049592 Bacteria 1885
312 Ga0501076_0758990 3300049592 Bacteria 800
313 Ga0501076_1143844 3300049592 Unclassified 641
314 Ga0501076_1193386 3300049592 Bacteria 626
315 Ga0501077_0328464 3300049593 Unclassified 975
316 Ga0501079_0287182 3300049741 Bacteria 1286
317 Ga0501080_0001423 3300049742 Bacteria 20080
318 Ga0501080_0049044 3300049742 Bacteria 3930
319 Ga0501080_0201680 3300049742 Bacteria 1826
320 Ga0501080_0275212 3300049742 Bacteria 1531
321 Ga0501080_0860275 3300049742 Unclassified 792
322 Ga0501083_0019538 3300049744 Bacteria 4718
323 Ga0501083_0025294 3300049744 Bacteria 4109
324 Ga0501083_0052026 3300049744 Unclassified 2753
325 Ga0501083_0058717 3300049744 Unclassified 2574
326 Ga0501035_0017569 3300049822 Bacteria 6600
327 Ga0501035_0150989 3300049822 Bacteria 2016
328 Ga0501044_0048942 3300049823 Bacteria 4363
329 Ga0501044_0141595 3300049823 Bacteria 2393
330 Ga0501044_0251939 3300049823 Unclassified 1706
331 Ga0501044_1382957 3300049823 Bacteria 569
332 Ga0501045_0047774 3300049824 Bacteria 3118
333 Ga0501045_1072763 3300049824 Unclassified 590
334 nmdc:mga00v17_18231_c1 3300050491 Bacteria 3983
335 nmdc:mga00v17_212315_c1 3300050491 Bacteria 1252
336 nmdc:mga0yw44_99811_c1 3300050492 Bacteria 1325
337 nmdc:mga0k408_43032_c1 3300050493 Bacteria 2601
338 nmdc:mga06z11_2189_c1 3300050494 Bacteria 7418
339 nmdc:mga06z11_239281_c1 3300050494 Bacteria 1066
340 nmdc:mga06z11_283244_c1 3300050494 Unclassified 982
341 nmdc:mga06z11_727523_c1 3300050494 Bacteria 605
342 nmdc:mga04h51_102757_c1 3300050495 Bacteria 1044
343 nmdc:mga04h51_31906_c1 3300050495 Bacteria 1667
344 nmdc:mga04h51_439802_c1 3300050495 Unclassified 551
345 nmdc:mga07m45_12867_c1 3300050496 Bacteria 4427
346 nmdc:mga07m45_389605_c1 3300050496 Bacteria 809
347 nmdc:mga05p37_22065_c1 3300050507 Bacteria 7716
348 nmdc:mga05p37_380132_c1 3300050507 Bacteria 1655
349 nmdc:mga05p37_430851_c1 3300050507 Bacteria 1532
350 nmdc:mga05p37_5209_c1 3300050507 Bacteria 15256
351 nmdc:mga05p37_54_c2 3300050507 Bacteria 73831
352 nmdc:mga05p37_6161_c1 3300050507 Bacteria 14116
353 nmdc:mga05p37_701160_c1 3300050507 Bacteria 1124
354 nmdc:mga09592_1012124_c1 3300050508 Bacteria 694
355 nmdc:mga09592_109273_c1 3300050508 Bacteria 2372
356 nmdc:mga09592_1472597_c1 3300050508 Unclassified 555
357 nmdc:mga09592_177663_c2 3300050508 Unclassified 1450
358 nmdc:mga09592_210038_c1 3300050508 Bacteria 1686
359 nmdc:mga09592_332960_c1 3300050508 Unclassified 1314
360 nmdc:mga09592_36431_c1 3300050508 Bacteria 4120
361 nmdc:mga09592_892973_c1 3300050508 Unclassified 747
362 nmdc:mga09592_995740_c1 3300050508 Bacteria 701
363 nmdc:mga0qj67_141874_c1 3300050509 Unclassified 1948
364 nmdc:mga0qj67_159395_c1 3300050509 Unclassified 1832
365 nmdc:mga0qj67_161507_c1 3300050509 Bacteria 1819
366 nmdc:mga0qj67_95778_c1 3300050509 Unclassified 2389
367 nmdc:mga06r32_38792_c1 3300050510 Bacteria 4516
368 nmdc:mga06r32_68904_c1 3300050510 Unclassified 3418
369 nmdc:mga06r32_82237_c1 3300050510 Bacteria 3137
370 nmdc:mga06r32_94471_c1 3300050510 Bacteria 2926
371 nmdc:mga06r32_9551_c1 3300050510 Bacteria 8759
372 nmdc:mga06r32_965261_c1 3300050510 Bacteria 806
373 nmdc:mga08y16_1113107_c1 3300050511 Bacteria 764
374 nmdc:mga08y16_1431544_c1 3300050511 Bacteria 653
375 nmdc:mga08y16_40349_c1 3300050511 Bacteria 4894
376 nmdc:mga08y16_691991_c1 3300050511 Unclassified 1020
377 nmdc:mga08y16_875435_c1 3300050511 Bacteria 886
378 nmdc:mga0n895_1299976_c1 3300050512 Unclassified 698
379 nmdc:mga0n895_23869_c1 3300050512 Bacteria 5755
380 nmdc:mga0rr50_350146_c1 3300050513 Bacteria 1242
381 nmdc:mga0a205_1577178_c1 3300050515 Bacteria 505
382 nmdc:mga0a205_60917_c1 3300050515 Unclassified 3645
383 nmdc:mga0a205_639394_c1 3300050515 Unclassified 915
384 Ga0500641_0007002 3300053096 Bacteria 4015
385 Ga0500616_0000086 3300053153 Bacteria 192348
386 Ga0501084_0000357 3300054114 Bacteria 34859
387 Ga0501084_0035410 3300054114 Bacteria 4173
388 Ga0501084_0120035 3300054114 Bacteria 2210
389 Ga0501084_0162696 3300054114 Bacteria 1883
390 Ga0501084_0388707 3300054114 Unclassified 1179
391 Ga0501084_1089860 3300054114 Bacteria 671
392 Ga0501084_1701247 3300054114 Bacteria 527
393 Ga0501082_0001634 3300060353 Bacteria 19766
394 Ga0501082_0007402 3300060353 Bacteria 9471
395 Ga0501082_0059488 3300060353 Unclassified 3292
396 Ga0501082_0088551 3300060353 Bacteria 2671
397 Ga0501082_0344560 3300060353 Bacteria 1298
398 Ga0501082_0430744 3300060353 Bacteria 1152
399 Ga0501082_0741399 3300060353 Unclassified 860
400 Ga0495602_1070919
401 rootH1_10290127
402 Ga0065707_10124533
403 Ga0070658_10552365
404 Ga0070683_100008840
405 Ga0070683_100468726
406 Ga0068869_100073629
407 Ga0070666_10645196
408 Ga0070687_100543883
409 Ga0070671_100263644
410 Ga0070673_100098796
411 Ga0070673_100413700
412 Ga0070659_100494303
413 Ga0070659_101042664
414 Ga0070659_101407058
415 Ga0070705_100212220
416 Ga0070694_100645580
417 Ga0070708_100131020
418 Ga0070678_100682036
419 Ga0070685_11064640
420 Ga0070707_101372738
421 Ga0070698_100023255
422 Ga0070698_100901850
423 Ga0070699_100124167
424 Ga0070699_100449338
425 Ga0070684_100009089
426 Ga0070684_101774010
427 Ga0070697_100019473
428 Ga0068853_101239942
429 Ga0070686_100205899
430 Ga0070686_101044733
431 Ga0070696_100723505
432 Ga0070665_100212835
433 Ga0068855_100820491
434 Ga0068857_100374400
435 Ga0068857_100633667
436 Ga0068856_100247004
437 Ga0068859_100400750
438 Ga0068859_101279458
439 Ga0068864_100575095
440 Ga0068866_10039750
441 Ga0068866_10094183
442 Ga0068863_100831549
443 Ga0068863_101031880
444 Ga0068860_100142694
445 Ga0068860_101659998
446 Ga0068862_100349504
447 Ga0081455_10052875
448 Ga0081455_10562679
449 Ga0081540_1191844
450 Ga0075365_10223206
451 Ga0075368_10006570
452 Ga0075368_10054669
453 Ga0075368_10083220
454 Ga0075364_10005410
455 Ga0075364_10519606
456 Ga0070712_100851161
457 Ga0075367_10033537
458 Ga0075367_10050650
459 Ga0075367_10115932
460 Ga0075366_10016917
461 Ga0097621_100929137
462 Ga0097621_101391736
463 Ga0075370_10081301
464 Ga0075370_10312777
465 Ga0075428_100593902
466 Ga0075428_100983566
467 Ga0075428_101506129
468 Ga0075428_102205193
469 Ga0075428_102243757
470 Ga0075430_100030112
471 Ga0075430_100073563
472 Ga0075430_100290759
473 Ga0075430_100347459
474 Ga0075431_100008764
475 Ga0075431_100040293
476 Ga0075431_100043027
477 Ga0075431_100749740
478 Ga0075433_10049055
479 Ga0075434_100009309
480 Ga0075434_100398546
481 Ga0075434_100722617
482 Ga0075429_100017283
483 Ga0075429_100253059
484 Ga0075429_100448347
485 Ga0075429_100822288
486 Ga0075429_100911812
487 Ga0075429_101399513
488 Ga0068865_101106728
489 Ga0075436_100095611
490 Ga0097620_100400777
491 Ga0097620_101279769
492 Ga0075435_100458499
493 Ga0075435_100664696
494 Ga0105240_10001021
495 Ga0105240_10991329
496 Ga0111539_10028950
497 Ga0114129_10000410
498 Ga0114129_10039232
499 Ga0114129_10191761
500 Ga0114129_10421324
501 Ga0114129_10679675
502 Ga0114129_10711375
503 Ga0114129_11590144
504 Ga0105243_10239795
505 Ga0105241_11202389
506 Ga0105242_10075612
507 Ga0105242_10442446
508 Ga0105248_10059133
509 Ga0105248_10473342
510 Ga0105248_11294070
511 Ga0105248_11312421
512 Ga0105237_10004754
513 Ga0105237_10142224
514 Ga0105237_10809840
515 Ga0105238_10577492
516 Ga0105249_11342503
517 Ga0105239_10212809
518 Ga0105239_10746996
519 Ga0105246_10229993
520 Ga0157369_10163943
521 Ga0157374_11896229
522 Ga0157378_10001974
523 Ga0157378_10767966
524 Ga0163162_10016859
525 Ga0163162_10390838
526 Ga0157372_10049925
527 Ga0157372_10201518
528 Ga0157372_11765397
529 Ga0157375_10743662
530 Ga0157375_12864240
531 Ga0163163_11243749
532 Ga0163163_13103072
533 Ga0157380_11350714
534 Ga0157380_12137808
535 Ga0157376_11280728
536 Ga0157376_11534261
537 Ga0224572_1005925
538 Ga0207653_10284066
539 Ga0207642_10027419
540 Ga0207642_10787179
541 Ga0207680_10169266
542 Ga0207695_10006325
543 Ga0207695_10230665
544 Ga0207671_10046761
545 Ga0207671_10115156
546 Ga0207694_10324049
547 Ga0207690_10319572
548 Ga0207690_11880045
549 Ga0207686_10077769
550 Ga0207686_10342783
551 Ga0207709_10232985
552 Ga0207669_10066697
553 Ga0207704_10532399
554 Ga0207711_10159314
555 Ga0207711_10330882
556 Ga0207711_11376121
557 Ga0207689_10253107
558 Ga0207661_10013699
559 Ga0207679_11055042
560 Ga0207667_10146441
561 Ga0207651_10137285
562 Ga0207658_10981538
563 Ga0207678_10494062
564 Ga0207702_10186980
565 Ga0207641_10876774
566 Ga0207648_10270582
567 Ga0207674_10511861
568 Ga0207674_10868902
569 Ga0209813_10074724
570 Ga0207428_10001904
571 Ga0268266_10077176
572 Ga0268265_10333059
573 Ga0268264_10256624
574 Ga0268264_11697608
575 Ga0265323_10045974
576 Ga0265338_10231406
577 Ga0265338_10458018
578 Ga0265320_10117462
579 Ga0265325_10266071
580 Ga0265340_10036556
581 Ga0265340_10188795
582 Ga0265339_10000023
583 Ga0265339_10201096
584 Ga0265331_10011016
585 Ga0265316_10232107
586 Ga0265316_10411491
587 Ga0307408_102205264
588 Ga0265313_10017717
589 Ga0265342_10001352
590 Ga0265342_10091805
591 Ga0307516_10685621
592 Ga0307405_11104044
593 Ga0307406_11153264
594 Ga0307412_12313483
595 Ga0307416_101056019
596 Ga0373943_0243237
597 Ga0373943_0470383
598 Ga0436364_0811322
599 Ga0436365_1083321
600 Ga0451837_1292494
601 Ga0450888_018880
602 Ga0439446_0288574
603 Ga0439435_0002508
604 Ga0466959_0002068
605 Ga0495592_0605393
606 Ga0495592_0880067
607 Ga0495639_0045838
608 Ga0495640_0252926
609 Ga0495586_0152678
610 Ga0495587_0547821
611 Ga0495621_0219801
612 Ga0495634_0260204
613 Ga0495658_0021672
614 Ga0495669_0580545
615 Ga0495674_0214154
616 Ga0496101_0427077
617 Ga0496101_0825786
618 Ga0496102_0001656
619 Ga0496107_0177608
620 Ga0496110_1131441
621 Ga0501031_0068499
622 Ga0501031_0109946
623 Ga0501031_0413640
624 Ga0501032_0025639
625 Ga0501032_0032892
626 Ga0501032_0079403
627 Ga0501033_0033443
628 Ga0501034_0001343
629 Ga0501034_0076257
630 Ga0501034_0094422
631 Ga0501034_0135185
632 Ga0501034_0242684
633 Ga0501034_0987143
634 Ga0501034_1588725
635 Ga0501036_0019282
636 Ga0501036_0056452
637 Ga0501036_0127613
638 Ga0501036_0144643
639 Ga0501036_0209393
640 Ga0501036_0243365
641 Ga0501037_0184492
642 Ga0501037_0252687
643 Ga0501038_0024893
644 Ga0501038_0043450
645 Ga0501038_0120226
646 Ga0501038_0187422
647 Ga0501038_0633517
648 Ga0501038_1087878
649 Ga0501039_0035049
650 Ga0501039_0056338
651 Ga0501040_0164535
652 Ga0501040_0201613
653 Ga0501041_0097201
654 Ga0501041_0584105
655 Ga0501042_0163659
656 Ga0501042_0369901
657 Ga0501043_0037893
658 Ga0501043_0062358
659 Ga0501043_0114836
660 Ga0501046_0004294
661 Ga0501046_0005991
662 Ga0501046_0032140
663 Ga0501046_0106058
664 Ga0501046_0110838
665 Ga0501046_0602180
666 Ga0501046_0615295
667 Ga0501046_0859475
668 Ga0501047_0008809
669 Ga0501047_0014171
670 Ga0501047_0092113
671 Ga0501047_0107205
672 Ga0501047_0110807
673 Ga0501047_0145512
674 Ga0501047_0203756
675 Ga0501048_0102600
676 Ga0501048_0175381
677 Ga0501048_0176052
678 Ga0501067_0035561
679 Ga0501067_0062967
680 Ga0501067_0128588
681 Ga0501068_0070841
682 Ga0501068_0159191
683 Ga0501068_0289862
684 Ga0501068_1061622
685 Ga0501069_0014311
686 Ga0501070_0057844
687 Ga0501070_0189664
688 Ga0501070_1384228
689 Ga0501071_0042103
690 Ga0501071_0861997
691 Ga0501072_0036919
692 Ga0501072_0038289
693 Ga0501072_0044681
694 Ga0501072_0082515
695 Ga0501073_0019930
696 Ga0501073_0095027
697 Ga0501073_0123015
698 Ga0501073_0126664
699 Ga0501073_0136013
700 Ga0501073_0180586
701 Ga0501073_0394037
702 Ga0501073_0589691
703 Ga0501073_1005032
704 Ga0501074_0202009
705 Ga0501074_0849303
706 Ga0501075_0040258
707 Ga0501075_0973753
708 Ga0501075_1343789
709 Ga0501076_0016167
710 Ga0501076_0151751
711 Ga0501076_0758990
712 Ga0501076_1143844
713 Ga0501076_1193386
714 Ga0501077_0328464
715 Ga0501079_0287182
716 Ga0501080_0001423
717 Ga0501080_0049044
718 Ga0501080_0201680
719 Ga0501080_0275212
720 Ga0501080_0860275
721 Ga0501083_0019538
722 Ga0501083_0025294
723 Ga0501083_0052026
724 Ga0501083_0058717
725 Ga0501035_0017569
726 Ga0501035_0150989
727 Ga0501044_0048942
728 Ga0501044_0141595
729 Ga0501044_0251939
730 Ga0501044_1382957
731 Ga0501045_0047774
732 Ga0501045_1072763
733 nmdc:mga00v17_18231_c1
734 nmdc:mga00v17_212315_c1
735 nmdc:mga0yw44_99811_c1
736 nmdc:mga0k408_43032_c1
737 nmdc:mga06z11_2189_c1
738 nmdc:mga06z11_239281_c1
739 nmdc:mga06z11_283244_c1
740 nmdc:mga06z11_727523_c1
741 nmdc:mga04h51_102757_c1
742 nmdc:mga04h51_31906_c1
743 nmdc:mga04h51_439802_c1
744 nmdc:mga07m45_12867_c1
745 nmdc:mga07m45_389605_c1
746 nmdc:mga05p37_22065_c1
747 nmdc:mga05p37_380132_c1
748 nmdc:mga05p37_430851_c1
749 nmdc:mga05p37_5209_c1
750 nmdc:mga05p37_54_c2
751 nmdc:mga05p37_6161_c1
752 nmdc:mga05p37_701160_c1
753 nmdc:mga09592_1012124_c1
754 nmdc:mga09592_109273_c1
755 nmdc:mga09592_1472597_c1
756 nmdc:mga09592_177663_c2
757 nmdc:mga09592_210038_c1
758 nmdc:mga09592_332960_c1
759 nmdc:mga09592_36431_c1
760 nmdc:mga09592_892973_c1
761 nmdc:mga09592_995740_c1
762 nmdc:mga0qj67_141874_c1
763 nmdc:mga0qj67_159395_c1
764 nmdc:mga0qj67_161507_c1
765 nmdc:mga0qj67_95778_c1
766 nmdc:mga06r32_38792_c1
767 nmdc:mga06r32_68904_c1
768 nmdc:mga06r32_82237_c1
769 nmdc:mga06r32_94471_c1
770 nmdc:mga06r32_9551_c1
771 nmdc:mga06r32_965261_c1
772 nmdc:mga08y16_1113107_c1
773 nmdc:mga08y16_1431544_c1
774 nmdc:mga08y16_40349_c1
775 nmdc:mga08y16_691991_c1
776 nmdc:mga08y16_875435_c1
777 nmdc:mga0n895_1299976_c1
778 nmdc:mga0n895_23869_c1
779 nmdc:mga0rr50_350146_c1
780 nmdc:mga0a205_1577178_c1
781 nmdc:mga0a205_60917_c1
782 nmdc:mga0a205_639394_c1
783 Ga0500641_0007002
784 Ga0500616_0000086
785 Ga0501084_0000357
786 Ga0501084_0035410
787 Ga0501084_0120035
788 Ga0501084_0162696
789 Ga0501084_0388707
790 Ga0501084_1089860
791 Ga0501084_1701247
792 Ga0501082_0001634
793 Ga0501082_0007402
794 Ga0501082_0059488
795 Ga0501082_0088551
796 Ga0501082_0344560
797 Ga0501082_0430744
798 Ga0501082_0741399

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

18

91

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9405 23 119
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.94 24 120
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9384 23 119
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9206 23 122
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9077 15 120
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9384 23 119 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9175 23 120 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9083 22 120 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8851 26 105 1.10.10.10
af_O50432_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.875 26 105 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2Z5G063-F1-model_v4 Transcriptional regulator, PadR family 0.9919 18 123
AF-W0RR40-F1-model_v4 Transcriptional regulator, PadR-family 0.9911 23 121
AF-A0A3N5LS61-F1-model_v4 PadR family transcriptional regulator 0.9872 23 125
AF-W0RSI0-F1-model_v4 Transcriptional regulator, PadR-family 0.9864 23 122
AF-W0RTV1-F1-model_v4 Transcriptional regulator, PadR-family 0.9856 23 121

Map