F434372

General Info

Members Datasets Scaffolds Average Seq Length
399 202 798 134

Family's Representative Sequence

Representative Sequence 3300046473|Ga0495582_0491931|Ga0495582_0491931_144_557
Length 137
Sequence LATVATMADLDELALGLPQVTKELSDDGRPSYQVHGKMFCFHRGRRPDAVDPDTGERLSDVLMFRVTDLEEKELLLASGGVYFTTPHFKGYPAVLVRIPDLDRLSRDELQDLVVDAWLSRAQKRVAKAWLAANEPGD

Samples

Sample ID Description Type Environment
1 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
101 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
102 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
103 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
104 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
105 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
106 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
107 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
108 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
109 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
110 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
111 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
112 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
113 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
125 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 15.54
Rhizosphere 83.71
Stem 0
Stem Tuber 0
Unclassified 8.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495582_0491931 3300046473 Bacteria 709
2 Ga0070658_10125932 3300005327 Bacteria 2132
3 Ga0070683_100013281 3300005329 Bacteria 7179
4 Ga0070683_100107422 3300005329 Bacteria 2631
5 Ga0070680_100004550 3300005336 Bacteria 10424
6 Ga0070682_100099441 3300005337 Bacteria 1918
7 Ga0070660_100001247 3300005339 Bacteria 17309
8 Ga0070687_100598872 3300005343 Bacteria 757
9 Ga0070661_100852901 3300005344 Bacteria 750
10 Ga0070668_100340968 3300005347 Bacteria 1266
11 Ga0070673_100264738 3300005364 Bacteria 1503
12 Ga0070703_10092587 3300005406 Bacteria 1051
13 Ga0070714_100183009 3300005435 Bacteria 1907
14 Ga0070714_100441191 3300005435 Bacteria 1235
15 Ga0070713_100081284 3300005436 Bacteria 2765
16 Ga0070713_100114203 3300005436 Bacteria 2359
17 Ga0070710_10122680 3300005437 Bacteria 1574
18 Ga0070710_10130981 3300005437 Bacteria 1529
19 Ga0070710_10704647 3300005437 Bacteria 713
20 Ga0070705_100030600 3300005440 Bacteria 2973
21 Ga0070700_100230503 3300005441 Bacteria 1318
22 Ga0070663_100772129 3300005455 Bacteria 822
23 Ga0070678_100214467 3300005456 Bacteria 1597
24 Ga0070681_10201704 3300005458 Bacteria 1907
25 Ga0070681_10714002 3300005458 Unclassified 918
26 Ga0070685_10026307 3300005466 Bacteria 3206
27 Ga0070679_100051799 3300005530 Bacteria 4089
28 Ga0070679_100158161 3300005530 Bacteria 2240
29 Ga0070679_100203955 3300005530 Bacteria 1942
30 Ga0070679_100544333 3300005530 Bacteria 1104
31 Ga0070684_100000317 3300005535 Bacteria 33255
32 Ga0070684_100001562 3300005535 Bacteria 16525
33 Ga0070684_100019782 3300005535 Bacteria 5575
34 Ga0070684_100213878 3300005535 Bacteria 1757
35 Ga0070697_100327781 3300005536 Bacteria 1319
36 Ga0068853_100978770 3300005539 Bacteria 814
37 Ga0070672_100376817 3300005543 Bacteria 1213
38 Ga0070672_100451501 3300005543 Bacteria 1107
39 Ga0070686_100039159 3300005544 Bacteria 2952
40 Ga0070695_100012517 3300005545 Bacteria 5091
41 Ga0070695_100120857 3300005545 Bacteria 1792
42 Ga0070696_100204211 3300005546 Bacteria 1476
43 Ga0070693_100027128 3300005547 Bacteria 3099
44 Ga0070693_100080310 3300005547 Bacteria 1943
45 Ga0070693_100917063 3300005547 Unclassified 657
46 Ga0070704_100006852 3300005549 Bacteria 6748
47 Ga0068855_100543237 3300005563 Bacteria 1259
48 Ga0068855_100555407 3300005563 Bacteria 1242
49 Ga0070664_100022828 3300005564 Bacteria 5161
50 Ga0070664_100146847 3300005564 Unclassified 2080
51 Ga0068857_100000561 3300005577 Bacteria 27093
52 Ga0068857_100069652 3300005577 Unclassified 3133
53 Ga0068857_100073950 3300005577 Bacteria 3037
54 Ga0068854_100073921 3300005578 Bacteria 2499
55 Ga0068856_100100706 3300005614 Bacteria 2882
56 Ga0068856_100394898 3300005614 Bacteria 1403
57 Ga0068852_100311434 3300005616 Bacteria 1526
58 Ga0068851_10468869 3300005834 Bacteria 751
59 Ga0068863_101131217 3300005841 Bacteria 788
60 Ga0081455_10040073 3300005937 Bacteria 4134
61 Ga0081455_10322146 3300005937 Bacteria 1100
62 Ga0081455_10603441 3300005937 Unclassified 715
63 Ga0081538_10012008 3300005981 Bacteria 6977
64 Ga0081538_10030550 3300005981 Bacteria 3655
65 Ga0081538_10069274 3300005981 Bacteria 1955
66 Ga0070717_10355613 3300006028 Unclassified 1310
67 Ga0075365_10154682 3300006038 Unclassified 1596
68 Ga0070715_10005066 3300006163 Bacteria 4371
69 Ga0070716_100206527 3300006173 Bacteria 1309
70 Ga0070716_100361119 3300006173 Bacteria 1031
71 Ga0070712_100078499 3300006175 Bacteria 2383
72 Ga0070712_100382489 3300006175 Bacteria 1159
73 Ga0075433_10000289 3300006852 Bacteria 30082
74 Ga0075433_10138838 3300006852 Bacteria 2160
75 Ga0075433_10816382 3300006852 Bacteria 815
76 Ga0075434_100000777 3300006871 Bacteria 25288
77 Ga0075434_100010740 3300006871 Bacteria 8600
78 Ga0075436_100043903 3300006914 Bacteria 3081
79 Ga0075436_100076274 3300006914 Bacteria 2321
80 Ga0075435_100380793 3300007076 Bacteria 1212
81 Ga0105240_10035806 3300009093 Bacteria 6392
82 Ga0105240_10392255 3300009093 Bacteria 1565
83 Ga0105245_10035790 3300009098 Bacteria 4407
84 Ga0105245_10368395 3300009098 Unclassified 1428
85 Ga0105245_10485322 3300009098 Bacteria 1250
86 Ga0105245_10604049 3300009098 Bacteria 1124
87 Ga0105245_11048536 3300009098 Unclassified 861
88 Ga0114129_10275165 3300009147 Bacteria 2251
89 Ga0105243_10144025 3300009148 Bacteria 2037
90 Ga0105243_10192611 3300009148 Bacteria 1782
91 Ga0105243_10353671 3300009148 Bacteria 1350
92 Ga0105243_11371145 3300009148 Unclassified 727
93 Ga0105243_11933693 3300009148 Bacteria 623
94 Ga0105241_10177000 3300009174 Bacteria 1766
95 Ga0105242_10539253 3300009176 Bacteria 1116
96 Ga0105238_10106797 3300009551 Bacteria 2781
97 Ga0105238_10315347 3300009551 Bacteria 1549
98 Ga0105238_12244192 3300009551 Bacteria 581
99 Ga0105249_10463778 3300009553 Bacteria 1307
100 Ga0105239_10402367 3300010375 Bacteria 1549
101 Ga0105246_10137104 3300011119 Bacteria 1835
102 Ga0105246_10685049 3300011119 Bacteria 896
103 Ga0157370_10005142 3300013104 Bacteria 14750
104 Ga0157369_10002414 3300013105 Bacteria 22442
105 Ga0157369_10148690 3300013105 Bacteria 2476
106 Ga0157369_10687040 3300013105 Unclassified 1054
107 Ga0157374_10076029 3300013296 Bacteria 3174
108 Ga0157374_11149245 3300013296 Bacteria 797
109 Ga0157378_10060591 3300013297 Bacteria 3377
110 Ga0157378_10488903 3300013297 Bacteria 1227
111 Ga0163162_10706316 3300013306 Bacteria 1130
112 Ga0157372_10054414 3300013307 Bacteria 4464
113 Ga0157372_10299158 3300013307 Bacteria 1872
114 Ga0157372_12288531 3300013307 Bacteria 621
115 Ga0163163_10642867 3300014325 Bacteria 1124
116 Ga0157379_11887790 3300014968 Bacteria 588
117 Ga0157376_10614606 3300014969 Bacteria 1083
118 Ga0157376_11187158 3300014969 Bacteria 791
119 Ga0206354_11523398 3300020081 Bacteria 2122
120 Ga0206353_10092031 3300020082 Bacteria 2804
121 Ga0206353_11440038 3300020082 Bacteria 1206
122 Ga0224712_10027095 3300022467 Bacteria 2035
123 Ga0207656_10402128 3300025321 Bacteria 688
124 Ga0207685_10286974 3300025905 Bacteria 810
125 Ga0207705_10107068 3300025909 Bacteria 2062
126 Ga0207707_10096145 3300025912 Bacteria 2589
127 Ga0207707_10175192 3300025912 Bacteria 1874
128 Ga0207695_10211221 3300025913 Bacteria 1851
129 Ga0207695_10356769 3300025913 Bacteria 1349
130 Ga0207671_10679921 3300025914 Bacteria 819
131 Ga0207693_10173480 3300025915 Bacteria 1697
132 Ga0207693_10194308 3300025915 Unclassified 1596
133 Ga0207663_10703735 3300025916 Bacteria 800
134 Ga0207660_10113726 3300025917 Bacteria 2040
135 Ga0207660_10115991 3300025917 Bacteria 2022
136 Ga0207657_10007251 3300025919 Bacteria 11385
137 Ga0207652_10180821 3300025921 Bacteria 1895
138 Ga0207652_10217256 3300025921 Bacteria 1722
139 Ga0207652_10605193 3300025921 Bacteria 982
140 Ga0207694_10075873 3300025924 Bacteria 2632
141 Ga0207687_10014632 3300025927 Bacteria 5136
142 Ga0207687_10286608 3300025927 Bacteria 1322
143 Ga0207687_10392107 3300025927 Bacteria 1140
144 Ga0207687_10895674 3300025927 Bacteria 759
145 Ga0207700_10192186 3300025928 Bacteria 1716
146 Ga0207686_10179498 3300025934 Bacteria 1500
147 Ga0207686_11211311 3300025934 Bacteria 618
148 Ga0207709_10049040 3300025935 Bacteria 2575
149 Ga0207709_10196834 3300025935 Unclassified 1436
150 Ga0207665_10018758 3300025939 Bacteria 4546
151 Ga0207691_10877695 3300025940 Bacteria 751
152 Ga0207711_11410390 3300025941 Unclassified 639
153 Ga0207679_10024200 3300025945 Bacteria 4162
154 Ga0207667_10326721 3300025949 Bacteria 1566
155 Ga0207667_10407248 3300025949 Bacteria 1385
156 Ga0207667_10473164 3300025949 Bacteria 1272
157 Ga0207640_10292716 3300025981 Bacteria 1284
158 Ga0207678_10807008 3300026067 Bacteria 829
159 Ga0207708_10423311 3300026075 Bacteria 1104
160 Ga0207648_10326890 3300026089 Unclassified 1379
161 Ga0207674_10002357 3300026116 Bacteria 23889
162 Ga0207674_10113020 3300026116 Bacteria 2689
163 Ga0207674_10227389 3300026116 Bacteria 1814
164 Ga0207683_10073787 3300026121 Bacteria 3019
165 Ga0207683_10309210 3300026121 Bacteria 1446
166 Ga0265338_10006521 3300028800 Bacteria 14840
167 Ga0265338_10325936 3300028800 Bacteria 1111
168 Ga0373930_0007911 3300034816 Bacteria 1845
169 Ga0373950_0003166 3300034818 Bacteria 2329
170 Ga0373958_0008734 3300034819 Bacteria 1650
171 Ga0373959_0004420 3300034820 Bacteria 2266
172 Ga0373928_0009091 3300035084 Bacteria 1939
173 Ga0373929_0031502 3300035085 Bacteria 1136
174 Ga0373940_0043589 3300035088 Bacteria 1240
175 Ga0373949_0004584 3300035090 Bacteria 3151
176 Ga0373932_0003076 3300035112 Bacteria 4070
177 Ga0373939_0037471 3300035114 Bacteria 1440
178 Ga0373960_0015385 3300035121 Bacteria 1952
179 Ga0373942_0013738 3300035207 Bacteria 1951
180 Ga0373961_0055081 3300035241 Bacteria 1190
181 Ga0373962_0010403 3300035242 Bacteria 2319
182 Ga0373924_0565189 3300035410 Bacteria 512
183 Ga0373931_0019400 3300035691 Unclassified 3393
184 Ga0373937_0046387 3300036401 Bacteria 3974
185 Ga0395899_0061888 3300037312 Bacteria 2756
186 Ga0395899_0104768 3300037312 Unclassified 2038
187 Ga0395899_0192858 3300037312 Bacteria 1425
188 Ga0395899_0238079 3300037312 Bacteria 1254
189 Ga0395899_0678952 3300037312 Unclassified 648
190 Ga0395900_0007576 3300037418 Bacteria 11210
191 Ga0395900_0028444 3300037418 Bacteria 5725
192 Ga0395900_0039392 3300037418 Bacteria 4869
193 Ga0395900_0284418 3300037418 Bacteria 1645
194 Ga0395900_0305212 3300037418 Bacteria 1576
195 Ga0395900_1904608 3300037418 Unclassified 505
196 Ga0395898_0008666 3300037466 Bacteria 10730
197 Ga0395898_0382068 3300037466 Bacteria 1343
198 Ga0395898_0666380 3300037466 Bacteria 983
199 Ga0395898_0746541 3300037466 Bacteria 920
200 Ga0395905_0243750 3300037471 Bacteria 1679
201 Ga0395905_0507418 3300037471 Bacteria 1106
202 Ga0395905_0749466 3300037471 Bacteria 879
203 Ga0395905_0827279 3300037471 Bacteria 829
204 Ga0395905_0973622 3300037471 Unclassified 751
205 Ga0395901_0006587 3300038443 Bacteria 11735
206 Ga0395901_0018541 3300038443 Bacteria 7105
207 Ga0395901_0044593 3300038443 Bacteria 4599
208 Ga0395901_0060579 3300038443 Bacteria 3938
209 Ga0395901_0123185 3300038443 Bacteria 2724
210 Ga0395901_0371881 3300038443 Bacteria 1472
211 Ga0395901_0764964 3300038443 Bacteria 958
212 Ga0395901_0843199 3300038443 Unclassified 902
213 Ga0395901_1899532 3300038443 Bacteria 543
214 Ga0451855_0783939 3300041511 Bacteria 627
215 Ga0451853_3664646 3300041512 Bacteria 623
216 Ga0439448_0117391 3300042005 Archaea 912
217 Ga0439440_0112697 3300042993 Bacteria 750
218 Ga0466965_0535293 3300044683 Bacteria 660
219 Ga0466961_0519990 3300044693 Bacteria 718
220 Ga0466963_0002377 3300044694 Bacteria 10512
221 Ga0466963_0002609 3300044694 Bacteria 10112
222 Ga0466963_0024654 3300044694 Bacteria 3829
223 Ga0466963_0439861 3300044694 Bacteria 920
224 Ga0466963_0645005 3300044694 Bacteria 747
225 Ga0466963_0808033 3300044694 Unclassified 661
226 Ga0466964_0096065 3300044706 Bacteria 1298
227 Ga0466971_0077105 3300044719 Bacteria 1517
228 Ga0466971_0158028 3300044719 Bacteria 1060
229 Ga0466957_0026811 3300044842 Bacteria 3420
230 Ga0466957_0071668 3300044842 Bacteria 2144
231 Ga0466957_0091752 3300044842 Bacteria 1904
232 Ga0466960_0001316 3300044901 Bacteria 9011
233 Ga0466958_0026979 3300045836 Bacteria 3396
234 Ga0466958_0029896 3300045836 Bacteria 3233
235 Ga0466958_0773330 3300045836 Unclassified 626
236 Ga0466967_0000214 3300045976 Bacteria 24584
237 Ga0466967_0005114 3300045976 Bacteria 9013
238 Ga0466967_0011845 3300045976 Bacteria 6633
239 Ga0466967_0016022 3300045976 Bacteria 5896
240 Ga0466967_0194652 3300045976 Bacteria 1917
241 Ga0466967_0274349 3300045976 Bacteria 1616
242 Ga0466967_0278176 3300045976 Bacteria 1605
243 Ga0466967_0525614 3300045976 Bacteria 1163
244 Ga0495629_0684869 3300046459 Unclassified 681
245 Ga0495653_0399665 3300046463 Bacteria 874
246 Ga0495608_0554537 3300046511 Bacteria 692
247 Ga0495652_0195463 3300046529 Unclassified 1540
248 Ga0495652_0859608 3300046529 Bacteria 601
249 Ga0495645_0488012 3300046543 Unclassified 772
250 Ga0495667_0047455 3300046559 Bacteria 2838
251 Ga0495659_0094276 3300046664 Bacteria 1153
252 Ga0495599_0072573 3300046678 Bacteria 2149
253 Ga0495623_0443534 3300046679 Bacteria 692
254 Ga0495658_0358789 3300046683 Bacteria 927
255 Ga0495613_0478199 3300046689 Bacteria 841
256 Ga0495581_0543687 3300047315 Bacteria 674
257 Ga0495604_0055732 3300047317 Unclassified 3046
258 Ga0495674_0204648 3300047319 Bacteria 1636
259 Ga0495602_0186749 3300048088 Unclassified 1593
260 Ga0496100_0044024 3300048903 Bacteria 2857
261 Ga0496100_0082522 3300048903 Bacteria 2174
262 Ga0496100_0091691 3300048903 Bacteria 2074
263 Ga0496100_1220433 3300048903 Unclassified 593
264 Ga0496101_0031252 3300048904 Bacteria 3741
265 Ga0496101_0032145 3300048904 Bacteria 3692
266 Ga0496101_0037003 3300048904 Bacteria 3460
267 Ga0496101_0133994 3300048904 Bacteria 1883
268 Ga0496101_0187271 3300048904 Bacteria 1596
269 Ga0496101_1332876 3300048904 Bacteria 561
270 Ga0496102_0258239 3300048905 Bacteria 1643
271 Ga0496102_0542579 3300048905 Bacteria 1085
272 Ga0496102_0687555 3300048905 Bacteria 946
273 Ga0496102_0710867 3300048905 Bacteria 928
274 Ga0496103_0051314 3300048906 Bacteria 2553
275 Ga0496103_0520521 3300048906 Bacteria 760
276 Ga0496104_0140707 3300048907 Bacteria 2318
277 Ga0496104_0184544 3300048907 Bacteria 1997
278 Ga0496104_0262161 3300048907 Bacteria 1641
279 Ga0496104_0413376 3300048907 Bacteria 1261
280 Ga0496104_1377211 3300048907 Bacteria 608
281 Ga0496105_0053097 3300048908 Bacteria 3347
282 Ga0496105_0179794 3300048908 Bacteria 1732
283 Ga0496105_0598100 3300048908 Bacteria 856
284 Ga0496106_0026206 3300048909 Bacteria 4338
285 Ga0496106_0076370 3300048909 Bacteria 2568
286 Ga0496107_0075588 3300048910 Bacteria 2452
287 Ga0496107_0096802 3300048910 Bacteria 2160
288 Ga0496107_0170758 3300048910 Bacteria 1614
289 Ga0496107_0215469 3300048910 Bacteria 1428
290 Ga0496107_0533696 3300048910 Bacteria 869
291 Ga0496107_0655191 3300048910 Unclassified 774
292 Ga0496108_0015539 3300048911 Bacteria 6208
293 Ga0496108_0481197 3300048911 Bacteria 1084
294 Ga0496108_0836012 3300048911 Bacteria 793
295 Ga0496109_0005540 3300048912 Bacteria 10574
296 Ga0496109_0018755 3300048912 Bacteria 6084
297 Ga0496109_0030546 3300048912 Bacteria 4829
298 Ga0496109_0386877 3300048912 Bacteria 1321
299 Ga0496110_0028003 3300048913 Bacteria 4835
300 Ga0496110_0251267 3300048913 Bacteria 1609
301 Ga0496110_0721806 3300048913 Bacteria 899
302 Ga0496111_0042849 3300048914 Unclassified 3251
303 Ga0496111_0102569 3300048914 Bacteria 2103
304 Ga0496112_0046370 3300048915 Bacteria 4263
305 Ga0496112_0274617 3300048915 Bacteria 1633
306 Ga0496112_0288522 3300048915 Bacteria 1587
307 Ga0496112_1184935 3300048915 Bacteria 681
308 Ga0496113_0029572 3300048916 Bacteria 3958
309 Ga0496113_0053845 3300048916 Bacteria 3009
310 Ga0496113_0650576 3300048916 Bacteria 843
311 Ga0496114_0021921 3300048917 Bacteria 5201
312 Ga0496114_0058980 3300048917 Bacteria 3206
313 Ga0496114_0070395 3300048917 Bacteria 2938
314 Ga0496114_0323905 3300048917 Unclassified 1362
315 Ga0496114_0597878 3300048917 Bacteria 973
316 Ga0496114_0943284 3300048917 Bacteria 745
317 Ga0496115_0000507 3300048918 Bacteria 30530
318 Ga0496115_0021209 3300048918 Bacteria 5016
319 Ga0496115_0031769 3300048918 Bacteria 4162
320 Ga0496115_0477767 3300048918 Bacteria 1004
321 Ga0496115_0890056 3300048918 Bacteria 687
322 Ga0501032_0976207 3300049569 Bacteria 532
323 Ga0501033_0944769 3300049570 Bacteria 578
324 Ga0501036_0234866 3300049572 Bacteria 1538
325 Ga0501036_0876256 3300049572 Bacteria 737
326 Ga0501037_0068237 3300049573 Bacteria 2589
327 Ga0501037_0173333 3300049573 Bacteria 1533
328 Ga0501038_0012423 3300049574 Bacteria 7785
329 Ga0501038_0272407 3300049574 Bacteria 1334
330 Ga0501038_0348746 3300049574 Bacteria 1153
331 Ga0501040_0088595 3300049576 Bacteria 2149
332 Ga0501040_0169423 3300049576 Bacteria 1546
333 Ga0501040_0243349 3300049576 Bacteria 1283
334 Ga0501040_0276276 3300049576 Bacteria 1200
335 Ga0501040_0759815 3300049576 Bacteria 701
336 Ga0501041_0045642 3300049577 Bacteria 2664
337 Ga0501041_0052355 3300049577 Bacteria 2489
338 Ga0501042_0506759 3300049578 Bacteria 876
339 Ga0501046_0159243 3300049580 Bacteria 1699
340 Ga0501048_0244403 3300049582 Bacteria 1273
341 Ga0501048_0765572 3300049582 Bacteria 693
342 Ga0501067_0000010 3300049583 Bacteria 123277
343 Ga0501067_0006021 3300049583 Bacteria 6722
344 Ga0501068_0000003 3300049584 Bacteria 94842
345 Ga0501069_0000123 3300049585 Bacteria 34189
346 Ga0501069_0486882 3300049585 Bacteria 735
347 Ga0501069_0777834 3300049585 Bacteria 579
348 Ga0501070_0111423 3300049586 Bacteria 2262
349 Ga0501071_0030878 3300049587 Bacteria 3792
350 Ga0501071_0080994 3300049587 Bacteria 2375
351 Ga0501071_0138876 3300049587 Bacteria 1809
352 Ga0501072_0003405 3300049588 Bacteria 11975
353 Ga0501072_0422530 3300049588 Bacteria 1056
354 Ga0501074_0236021 3300049590 Bacteria 1301
355 Ga0501075_0197673 3300049591 Bacteria 1533
356 Ga0501075_0291755 3300049591 Bacteria 1243
357 Ga0501075_0478201 3300049591 Bacteria 950
358 Ga0501076_0004911 3300049592 Bacteria 9569
359 Ga0501076_0040933 3300049592 Bacteria 3643
360 Ga0501076_0100467 3300049592 Bacteria 2331
361 Ga0501077_0039687 3300049593 Bacteria 2999
362 Ga0501077_0574778 3300049593 Bacteria 723
363 Ga0501079_0231157 3300049741 Bacteria 1444
364 Ga0501079_0271837 3300049741 Bacteria 1325
365 Ga0501079_0565056 3300049741 Bacteria 895
366 Ga0501080_0366596 3300049742 Bacteria 1299
367 Ga0501081_0102258 3300049743 Bacteria 2027
368 Ga0501081_0358155 3300049743 Bacteria 1076
369 Ga0501081_0371271 3300049743 Bacteria 1056
370 Ga0501081_0428450 3300049743 Bacteria 981
371 Ga0501044_0360613 3300049823 Bacteria 1372
372 Ga0501045_0043638 3300049824 Bacteria 3266
373 Ga0501045_0307069 3300049824 Bacteria 1181
374 nmdc:mga08y16_331812_c1 3300050511 Bacteria 1564
375 nmdc:mga0n895_1373877_c1 3300050512 Bacteria 675
376 nmdc:mga0n895_509555_c1 3300050512 Bacteria 1212
377 nmdc:mga0n895_86622_c1 3300050512 Bacteria 3129
378 nmdc:mga0rr50_39128_c1 3300050513 Bacteria 3438
379 nmdc:mga0rr50_414067_c1 3300050513 Bacteria 1140
380 nmdc:mga08x19_34593_c1 3300050514 Bacteria 3195
381 nmdc:mga08x19_63202_c1 3300050514 Bacteria 2402
382 nmdc:mga0a205_295383_c1 3300050515 Bacteria 1494
383 nmdc:mga0a205_862808_c1 3300050515 Bacteria 752
384 nmdc:mga0a205_88869_c1 3300050515 Bacteria 2987
385 Ga0495601_0069876 3300053077 Bacteria 2240
386 Ga0495601_0263999 3300053077 Bacteria 1124
387 Ga0495612_0056955 3300053078 Unclassified 1614
388 Ga0495619_0160931 3300053085 Bacteria 1550
389 Ga0501084_0096359 3300054114 Bacteria 2485
390 Ga0501084_0128769 3300054114 Bacteria 2131
391 Ga0501084_0299842 3300054114 Bacteria 1357
392 Ga0501084_0315679 3300054114 Bacteria 1320
393 Ga0501082_0225326 3300060353 Bacteria 1631
394 Ga0501082_0657364 3300060353 Bacteria 917
395 Ga0466962_0048429 3300061719 Bacteria 2031
396 Ga0466962_0049728 3300061719 Bacteria 2004
397 Ga0530510_0008944 3300061734 Bacteria 7015
398 Ga0530510_0665953 3300061734 Bacteria 793
399 Ga0530510_0706176 3300061734 Bacteria 768
400 Ga0495582_0491931
401 Ga0070658_10125932
402 Ga0070683_100013281
403 Ga0070683_100107422
404 Ga0070680_100004550
405 Ga0070682_100099441
406 Ga0070660_100001247
407 Ga0070687_100598872
408 Ga0070661_100852901
409 Ga0070668_100340968
410 Ga0070673_100264738
411 Ga0070703_10092587
412 Ga0070714_100183009
413 Ga0070714_100441191
414 Ga0070713_100081284
415 Ga0070713_100114203
416 Ga0070710_10122680
417 Ga0070710_10130981
418 Ga0070710_10704647
419 Ga0070705_100030600
420 Ga0070700_100230503
421 Ga0070663_100772129
422 Ga0070678_100214467
423 Ga0070681_10201704
424 Ga0070681_10714002
425 Ga0070685_10026307
426 Ga0070679_100051799
427 Ga0070679_100158161
428 Ga0070679_100203955
429 Ga0070679_100544333
430 Ga0070684_100000317
431 Ga0070684_100001562
432 Ga0070684_100019782
433 Ga0070684_100213878
434 Ga0070697_100327781
435 Ga0068853_100978770
436 Ga0070672_100376817
437 Ga0070672_100451501
438 Ga0070686_100039159
439 Ga0070695_100012517
440 Ga0070695_100120857
441 Ga0070696_100204211
442 Ga0070693_100027128
443 Ga0070693_100080310
444 Ga0070693_100917063
445 Ga0070704_100006852
446 Ga0068855_100543237
447 Ga0068855_100555407
448 Ga0070664_100022828
449 Ga0070664_100146847
450 Ga0068857_100000561
451 Ga0068857_100069652
452 Ga0068857_100073950
453 Ga0068854_100073921
454 Ga0068856_100100706
455 Ga0068856_100394898
456 Ga0068852_100311434
457 Ga0068851_10468869
458 Ga0068863_101131217
459 Ga0081455_10040073
460 Ga0081455_10322146
461 Ga0081455_10603441
462 Ga0081538_10012008
463 Ga0081538_10030550
464 Ga0081538_10069274
465 Ga0070717_10355613
466 Ga0075365_10154682
467 Ga0070715_10005066
468 Ga0070716_100206527
469 Ga0070716_100361119
470 Ga0070712_100078499
471 Ga0070712_100382489
472 Ga0075433_10000289
473 Ga0075433_10138838
474 Ga0075433_10816382
475 Ga0075434_100000777
476 Ga0075434_100010740
477 Ga0075436_100043903
478 Ga0075436_100076274
479 Ga0075435_100380793
480 Ga0105240_10035806
481 Ga0105240_10392255
482 Ga0105245_10035790
483 Ga0105245_10368395
484 Ga0105245_10485322
485 Ga0105245_10604049
486 Ga0105245_11048536
487 Ga0114129_10275165
488 Ga0105243_10144025
489 Ga0105243_10192611
490 Ga0105243_10353671
491 Ga0105243_11371145
492 Ga0105243_11933693
493 Ga0105241_10177000
494 Ga0105242_10539253
495 Ga0105238_10106797
496 Ga0105238_10315347
497 Ga0105238_12244192
498 Ga0105249_10463778
499 Ga0105239_10402367
500 Ga0105246_10137104
501 Ga0105246_10685049
502 Ga0157370_10005142
503 Ga0157369_10002414
504 Ga0157369_10148690
505 Ga0157369_10687040
506 Ga0157374_10076029
507 Ga0157374_11149245
508 Ga0157378_10060591
509 Ga0157378_10488903
510 Ga0163162_10706316
511 Ga0157372_10054414
512 Ga0157372_10299158
513 Ga0157372_12288531
514 Ga0163163_10642867
515 Ga0157379_11887790
516 Ga0157376_10614606
517 Ga0157376_11187158
518 Ga0206354_11523398
519 Ga0206353_10092031
520 Ga0206353_11440038
521 Ga0224712_10027095
522 Ga0207656_10402128
523 Ga0207685_10286974
524 Ga0207705_10107068
525 Ga0207707_10096145
526 Ga0207707_10175192
527 Ga0207695_10211221
528 Ga0207695_10356769
529 Ga0207671_10679921
530 Ga0207693_10173480
531 Ga0207693_10194308
532 Ga0207663_10703735
533 Ga0207660_10113726
534 Ga0207660_10115991
535 Ga0207657_10007251
536 Ga0207652_10180821
537 Ga0207652_10217256
538 Ga0207652_10605193
539 Ga0207694_10075873
540 Ga0207687_10014632
541 Ga0207687_10286608
542 Ga0207687_10392107
543 Ga0207687_10895674
544 Ga0207700_10192186
545 Ga0207686_10179498
546 Ga0207686_11211311
547 Ga0207709_10049040
548 Ga0207709_10196834
549 Ga0207665_10018758
550 Ga0207691_10877695
551 Ga0207711_11410390
552 Ga0207679_10024200
553 Ga0207667_10326721
554 Ga0207667_10407248
555 Ga0207667_10473164
556 Ga0207640_10292716
557 Ga0207678_10807008
558 Ga0207708_10423311
559 Ga0207648_10326890
560 Ga0207674_10002357
561 Ga0207674_10113020
562 Ga0207674_10227389
563 Ga0207683_10073787
564 Ga0207683_10309210
565 Ga0265338_10006521
566 Ga0265338_10325936
567 Ga0373930_0007911
568 Ga0373950_0003166
569 Ga0373958_0008734
570 Ga0373959_0004420
571 Ga0373928_0009091
572 Ga0373929_0031502
573 Ga0373940_0043589
574 Ga0373949_0004584
575 Ga0373932_0003076
576 Ga0373939_0037471
577 Ga0373960_0015385
578 Ga0373942_0013738
579 Ga0373961_0055081
580 Ga0373962_0010403
581 Ga0373924_0565189
582 Ga0373931_0019400
583 Ga0373937_0046387
584 Ga0395899_0061888
585 Ga0395899_0104768
586 Ga0395899_0192858
587 Ga0395899_0238079
588 Ga0395899_0678952
589 Ga0395900_0007576
590 Ga0395900_0028444
591 Ga0395900_0039392
592 Ga0395900_0284418
593 Ga0395900_0305212
594 Ga0395900_1904608
595 Ga0395898_0008666
596 Ga0395898_0382068
597 Ga0395898_0666380
598 Ga0395898_0746541
599 Ga0395905_0243750
600 Ga0395905_0507418
601 Ga0395905_0749466
602 Ga0395905_0827279
603 Ga0395905_0973622
604 Ga0395901_0006587
605 Ga0395901_0018541
606 Ga0395901_0044593
607 Ga0395901_0060579
608 Ga0395901_0123185
609 Ga0395901_0371881
610 Ga0395901_0764964
611 Ga0395901_0843199
612 Ga0395901_1899532
613 Ga0451855_0783939
614 Ga0451853_3664646
615 Ga0439448_0117391
616 Ga0439440_0112697
617 Ga0466965_0535293
618 Ga0466961_0519990
619 Ga0466963_0002377
620 Ga0466963_0002609
621 Ga0466963_0024654
622 Ga0466963_0439861
623 Ga0466963_0645005
624 Ga0466963_0808033
625 Ga0466964_0096065
626 Ga0466971_0077105
627 Ga0466971_0158028
628 Ga0466957_0026811
629 Ga0466957_0071668
630 Ga0466957_0091752
631 Ga0466960_0001316
632 Ga0466958_0026979
633 Ga0466958_0029896
634 Ga0466958_0773330
635 Ga0466967_0000214
636 Ga0466967_0005114
637 Ga0466967_0011845
638 Ga0466967_0016022
639 Ga0466967_0194652
640 Ga0466967_0274349
641 Ga0466967_0278176
642 Ga0466967_0525614
643 Ga0495629_0684869
644 Ga0495653_0399665
645 Ga0495608_0554537
646 Ga0495652_0195463
647 Ga0495652_0859608
648 Ga0495645_0488012
649 Ga0495667_0047455
650 Ga0495659_0094276
651 Ga0495599_0072573
652 Ga0495623_0443534
653 Ga0495658_0358789
654 Ga0495613_0478199
655 Ga0495581_0543687
656 Ga0495604_0055732
657 Ga0495674_0204648
658 Ga0495602_0186749
659 Ga0496100_0044024
660 Ga0496100_0082522
661 Ga0496100_0091691
662 Ga0496100_1220433
663 Ga0496101_0031252
664 Ga0496101_0032145
665 Ga0496101_0037003
666 Ga0496101_0133994
667 Ga0496101_0187271
668 Ga0496101_1332876
669 Ga0496102_0258239
670 Ga0496102_0542579
671 Ga0496102_0687555
672 Ga0496102_0710867
673 Ga0496103_0051314
674 Ga0496103_0520521
675 Ga0496104_0140707
676 Ga0496104_0184544
677 Ga0496104_0262161
678 Ga0496104_0413376
679 Ga0496104_1377211
680 Ga0496105_0053097
681 Ga0496105_0179794
682 Ga0496105_0598100
683 Ga0496106_0026206
684 Ga0496106_0076370
685 Ga0496107_0075588
686 Ga0496107_0096802
687 Ga0496107_0170758
688 Ga0496107_0215469
689 Ga0496107_0533696
690 Ga0496107_0655191
691 Ga0496108_0015539
692 Ga0496108_0481197
693 Ga0496108_0836012
694 Ga0496109_0005540
695 Ga0496109_0018755
696 Ga0496109_0030546
697 Ga0496109_0386877
698 Ga0496110_0028003
699 Ga0496110_0251267
700 Ga0496110_0721806
701 Ga0496111_0042849
702 Ga0496111_0102569
703 Ga0496112_0046370
704 Ga0496112_0274617
705 Ga0496112_0288522
706 Ga0496112_1184935
707 Ga0496113_0029572
708 Ga0496113_0053845
709 Ga0496113_0650576
710 Ga0496114_0021921
711 Ga0496114_0058980
712 Ga0496114_0070395
713 Ga0496114_0323905
714 Ga0496114_0597878
715 Ga0496114_0943284
716 Ga0496115_0000507
717 Ga0496115_0021209
718 Ga0496115_0031769
719 Ga0496115_0477767
720 Ga0496115_0890056
721 Ga0501032_0976207
722 Ga0501033_0944769
723 Ga0501036_0234866
724 Ga0501036_0876256
725 Ga0501037_0068237
726 Ga0501037_0173333
727 Ga0501038_0012423
728 Ga0501038_0272407
729 Ga0501038_0348746
730 Ga0501040_0088595
731 Ga0501040_0169423
732 Ga0501040_0243349
733 Ga0501040_0276276
734 Ga0501040_0759815
735 Ga0501041_0045642
736 Ga0501041_0052355
737 Ga0501042_0506759
738 Ga0501046_0159243
739 Ga0501048_0244403
740 Ga0501048_0765572
741 Ga0501067_0000010
742 Ga0501067_0006021
743 Ga0501068_0000003
744 Ga0501069_0000123
745 Ga0501069_0486882
746 Ga0501069_0777834
747 Ga0501070_0111423
748 Ga0501071_0030878
749 Ga0501071_0080994
750 Ga0501071_0138876
751 Ga0501072_0003405
752 Ga0501072_0422530
753 Ga0501074_0236021
754 Ga0501075_0197673
755 Ga0501075_0291755
756 Ga0501075_0478201
757 Ga0501076_0004911
758 Ga0501076_0040933
759 Ga0501076_0100467
760 Ga0501077_0039687
761 Ga0501077_0574778
762 Ga0501079_0231157
763 Ga0501079_0271837
764 Ga0501079_0565056
765 Ga0501080_0366596
766 Ga0501081_0102258
767 Ga0501081_0358155
768 Ga0501081_0371271
769 Ga0501081_0428450
770 Ga0501044_0360613
771 Ga0501045_0043638
772 Ga0501045_0307069
773 nmdc:mga08y16_331812_c1
774 nmdc:mga0n895_1373877_c1
775 nmdc:mga0n895_509555_c1
776 nmdc:mga0n895_86622_c1
777 nmdc:mga0rr50_39128_c1
778 nmdc:mga0rr50_414067_c1
779 nmdc:mga08x19_34593_c1
780 nmdc:mga08x19_63202_c1
781 nmdc:mga0a205_295383_c1
782 nmdc:mga0a205_862808_c1
783 nmdc:mga0a205_88869_c1
784 Ga0495601_0069876
785 Ga0495601_0263999
786 Ga0495612_0056955
787 Ga0495619_0160931
788 Ga0501084_0096359
789 Ga0501084_0128769
790 Ga0501084_0299842
791 Ga0501084_0315679
792 Ga0501082_0225326
793 Ga0501082_0657364
794 Ga0466962_0048429
795 Ga0466962_0049728
796 Ga0530510_0008944
797 Ga0530510_0665953
798 Ga0530510_0706176

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04237

YjbR

YjbR

15

119

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cd7-assembly1.cif.gz_A crystal structure of the ntd l199m of drosophila oskar protein 0.8603 7 31
2n4t-assembly1.cif.gz_A nmr structure of fbp28 ww domain l453w mutant 0.7592 13 32
5cd7-assembly3.cif.gz_E crystal structure of the ntd l199m of drosophila oskar protein 0.7466 1 31
7xfp-assembly4.cif.gz_D crystal structure of helicobacter pylori icea2 0.744 15 35
5cd7-assembly2.cif.gz_D crystal structure of the ntd l199m of drosophila oskar protein 0.7081 1 31
ID Description Score Start End Superfamily
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8278 5 125 3.30.70.1230
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8089 5 125 3.30.70.1230
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7168 5 126 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7145 2 126 3.90.1150.30
af_C4J9H4_8_107_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.7142 96 129 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A538G618-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.973 4 131
AF-A0A7Y5WXI2-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9661 14 131
AF-A0A538G618-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9656 4 131
AF-A0A538IJE1-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9595 35 131
AF-A0A2U3C7E8-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9564 14 131

Map