F434339

General Info

Members Datasets Scaffolds Average Seq Length
399 200 390 224

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0391210|Ga0395905_0391210_50_793
Length 247
Sequence LFAQYFNFSQILRRLNFAAMQEVTCDLASCFLCSNCVPEWKEIIAVKKQTVQVNKGRDIFREGEQVKGIYFINTGAVKVYKQWGDQKQLIIRFAKTGDILGHRGLGGSEVYPVTATALEESKVCFITNEFLATTLATNHFFTNKLMHFYAAELQKAEKRMRDLAHMEVKGRIADAVLELARVFGMDQNKTIAASITRQDIASYAGTTYETVFKFFTELTQAKIISTSGKSIKINKPDRLKQFTINQA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
4 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
5 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
6 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
7 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
8 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
9 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
154 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
155 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
174 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
175 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
176 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
177 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
185 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
186 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
187 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
188 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
189 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
190 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
191 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
192 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
197 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.24
Metatranscriptomes 0.5
Isolates 2.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.27
Nodule 0
Rhizoplane 1
Rhizosphere 89.47
Stem 0
Stem Tuber 0
Unclassified 3.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2319196 2162886007 Bacteria 1834
2 SwRhRL2b_contig_636887 2162886007 Bacteria 15689
3 rootH1_10112344 3300003316 Bacteria 3547
4 rootH2_10079641 3300003320 Bacteria 2723
5 rootH2_10198423 3300003320 Bacteria 1408
6 rootL2_10058193 3300003322 Bacteria 6627
7 rootL2_10122755 3300003322 Bacteria 1688
8 rootH1_10129438 3300003323 Bacteria 2096
9 JGI25160J50197_1003683 3300003354 Bacteria 6773
10 Ga0055535_1004248 3300003761 Bacteria 3576
11 Ga0055542_1002812 3300003762 Bacteria 5219
12 Ga0055536_1000009 3300003781 Bacteria 311572
13 Ga0065714_10003304 3300005288 Bacteria 10635
14 Ga0065704_10078469 3300005289 Bacteria 4419
15 Ga0070658_10001278 3300005327 Bacteria 21502
16 Ga0070658_10085432 3300005327 Unclassified 2595
17 Ga0070658_10158672 3300005327 Bacteria 1897
18 Ga0070676_10000011 3300005328 Bacteria 58868
19 Ga0070676_10002626 3300005328 Bacteria 9243
20 Ga0070676_10008344 3300005328 Bacteria 5582
21 Ga0070676_10213610 3300005328 Bacteria 1271
22 Ga0070683_100042604 3300005329 Bacteria 4180
23 Ga0070670_100140605 3300005331 Bacteria 2087
24 Ga0068869_100004084 3300005334 Bacteria 9039
25 Ga0068869_100008785 3300005334 Bacteria 6533
26 Ga0068869_100278055 3300005334 Bacteria 1345
27 Ga0068869_100449485 3300005334 Unclassified 1068
28 Ga0070666_10000065 3300005335 Bacteria 79454
29 Ga0070666_10000107 3300005335 Bacteria 57059
30 Ga0070666_10003664 3300005335 Bacteria 9307
31 Ga0070666_10014851 3300005335 Bacteria 4962
32 Ga0070666_10082779 3300005335 Bacteria 2195
33 Ga0070680_100007329 3300005336 Bacteria 8412
34 Ga0068868_100000401 3300005338 Bacteria 29470
35 Ga0068868_100024535 3300005338 Bacteria 4577
36 Ga0068868_100074305 3300005338 Bacteria 2715
37 Ga0068868_100154762 3300005338 Bacteria 1890
38 Ga0070691_10024816 3300005341 Bacteria 2788
39 Ga0070691_10101868 3300005341 Bacteria 1427
40 Ga0070668_100000017 3300005347 Bacteria 100828
41 Ga0070668_100010527 3300005347 Bacteria 6876
42 Ga0070668_100035547 3300005347 Bacteria 3799
43 Ga0070669_100100815 3300005353 Bacteria 2178
44 Ga0070669_100272757 3300005353 Bacteria 1353
45 Ga0070675_100020404 3300005354 Bacteria 5289
46 Ga0070671_100833578 3300005355 Bacteria 804
47 Ga0070674_100008290 3300005356 Bacteria 6182
48 Ga0070673_100001453 3300005364 Bacteria 13877
49 Ga0070673_100066256 3300005364 Bacteria 2884
50 Ga0070673_100435291 3300005364 Bacteria 1178
51 Ga0070667_100000376 3300005367 Bacteria 48890
52 Ga0070667_100019335 3300005367 Bacteria 5650
53 Ga0070667_100042770 3300005367 Bacteria 3801
54 Ga0070667_100070473 3300005367 Bacteria 2976
55 Ga0070678_100005156 3300005456 Bacteria 7508
56 Ga0070678_100497598 3300005456 Bacteria 1075
57 Ga0070662_100021882 3300005457 Bacteria 4370
58 Ga0070662_100357894 3300005457 Unclassified 1197
59 Ga0070681_10023149 3300005458 Bacteria 6248
60 Ga0068867_100002017 3300005459 Bacteria 14189
61 Ga0068867_100049656 3300005459 Bacteria 3089
62 Ga0068867_100554739 3300005459 Bacteria 996
63 Ga0070684_100009335 3300005535 Bacteria 7721
64 Ga0068853_100006075 3300005539 Bacteria 9560
65 Ga0068853_100024307 3300005539 Bacteria 5078
66 Ga0068853_100275836 3300005539 Unclassified 1549
67 Ga0070672_100000053 3300005543 Bacteria 51215
68 Ga0070672_100036501 3300005543 Bacteria 3744
69 Ga0070672_100087065 3300005543 Bacteria 2513
70 Ga0070693_100004416 3300005547 Bacteria 6648
71 Ga0070665_100000001 3300005548 Bacteria 1083363
72 Ga0070665_100002783 3300005548 Bacteria 18963
73 Ga0070665_100036604 3300005548 Bacteria 4936
74 Ga0070665_100164267 3300005548 Bacteria 2223
75 Ga0068855_100006586 3300005563 Bacteria 14122
76 Ga0068855_100020344 3300005563 Bacteria 7961
77 Ga0068855_100029785 3300005563 Bacteria 6527
78 Ga0068855_100073188 3300005563 Bacteria 3982
79 Ga0068857_100016383 3300005577 Bacteria 6495
80 Ga0068857_100099629 3300005577 Bacteria 2607
81 Ga0068857_100741881 3300005577 Bacteria 935
82 Ga0068854_100013378 3300005578 Bacteria 5384
83 Ga0068854_100098789 3300005578 Bacteria 2185
84 Ga0068856_100040515 3300005614 Bacteria 4576
85 Ga0068856_100293450 3300005614 Unclassified 1643
86 Ga0068852_100001189 3300005616 Bacteria 17258
87 Ga0068852_100028419 3300005616 Unclassified 4577
88 Ga0068859_100000006 3300005617 Bacteria 421509
89 Ga0068859_100047589 3300005617 Bacteria 4309
90 Ga0068864_100001989 3300005618 Bacteria 16826
91 Ga0068861_100017358 3300005719 Bacteria 5108
92 Ga0068851_10000292 3300005834 Bacteria 22862
93 Ga0068863_100002366 3300005841 Bacteria 18768
94 Ga0068863_100165587 3300005841 Bacteria 2120
95 Ga0068858_100000305 3300005842 Bacteria 52454
96 Ga0068858_100023966 3300005842 Bacteria 5685
97 Ga0068860_100000137 3300005843 Bacteria 119626
98 Ga0068860_100006219 3300005843 Bacteria 12008
99 Ga0068860_100024910 3300005843 Bacteria 5776
100 Ga0068860_100033978 3300005843 Bacteria 4892
101 Ga0068860_100061086 3300005843 Bacteria 3580
102 Ga0068860_100231272 3300005843 Bacteria 1796
103 Ga0097621_100002582 3300006237 Bacteria 12408
104 Ga0097621_100007912 3300006237 Bacteria 7625
105 Ga0097621_100008974 3300006237 Bacteria 7232
106 Ga0097621_100218853 3300006237 Bacteria 1659
107 Ga0097621_100452251 3300006237 Bacteria 1157
108 Ga0068871_100037153 3300006358 Bacteria 3883
109 Ga0068865_100006144 3300006881 Bacteria 7321
110 Ga0068865_100516400 3300006881 Bacteria 998
111 Ga0097620_100000006 3300006931 Bacteria 421509
112 Ga0097620_100047587 3300006931 Bacteria 4309
113 Ga0105240_10000205 3300009093 Bacteria 120767
114 Ga0105240_10005272 3300009093 Bacteria 19301
115 Ga0105240_10013917 3300009093 Bacteria 11012
116 Ga0105240_10033871 3300009093 Bacteria 6595
117 Ga0105240_10068559 3300009093 Bacteria 4393
118 Ga0105240_10096764 3300009093 Bacteria 3597
119 Ga0105245_10230146 3300009098 Bacteria 1792
120 Ga0105245_10326787 3300009098 Bacteria 1512
121 Ga0105247_10002655 3300009101 Bacteria 12044
122 Ga0105247_10170197 3300009101 Bacteria 1448
123 Ga0105243_10369921 3300009148 Bacteria 1322
124 Ga0105241_10001145 3300009174 Bacteria 20200
125 Ga0105241_10001417 3300009174 Bacteria 18366
126 Ga0105241_10003081 3300009174 Bacteria 12428
127 Ga0105241_10169739 3300009174 Bacteria 1801
128 Ga0105242_10027499 3300009176 Bacteria 4517
129 Ga0105242_10389411 3300009176 Bacteria 1298
130 Ga0105248_10107590 3300009177 Bacteria 3144
131 Ga0105248_10223319 3300009177 Bacteria 2121
132 Ga0105237_10002580 3300009545 Bacteria 22343
133 Ga0105237_10002662 3300009545 Bacteria 21955
134 Ga0105237_10008014 3300009545 Bacteria 11497
135 Ga0105237_10050962 3300009545 Bacteria 4160
136 Ga0105237_10066240 3300009545 Bacteria 3607
137 Ga0105237_10109502 3300009545 Bacteria 2754
138 Ga0105238_10017705 3300009551 Bacteria 7244
139 Ga0105238_10752405 3300009551 Bacteria 988
140 Ga0105249_10286816 3300009553 Bacteria 1646
141 Ga0105249_10330297 3300009553 Bacteria 1538
142 Ga0105239_10000089 3300010375 Bacteria 129415
143 Ga0105239_10003881 3300010375 Bacteria 18138
144 Ga0105239_10016769 3300010375 Bacteria 8096
145 Ga0105239_10019482 3300010375 Bacteria 7490
146 Ga0105239_10052022 3300010375 Bacteria 4490
147 Ga0105246_10003336 3300011119 Bacteria 9711
148 Ga0105246_10007944 3300011119 Bacteria 6512
149 Ga0105246_10028043 3300011119 Bacteria 3696
150 Ga0157371_10001942 3300013102 Bacteria 20568
151 Ga0157371_10023992 3300013102 Bacteria 4456
152 Ga0157370_10000479 3300013104 Bacteria 49878
153 Ga0157370_10050808 3300013104 Bacteria 3962
154 Ga0157370_10053627 3300013104 Bacteria 3844
155 Ga0157370_10056409 3300013104 Bacteria 3739
156 Ga0157370_10482340 3300013104 Bacteria 1139
157 Ga0157369_10072589 3300013105 Bacteria 3694
158 Ga0157369_10110612 3300013105 Bacteria 2921
159 Ga0157369_10227644 3300013105 Unclassified 1950
160 Ga0157369_10306710 3300013105 Bacteria 1651
161 Ga0157374_10000356 3300013296 Bacteria 42356
162 Ga0157374_10120364 3300013296 Bacteria 2533
163 Ga0157378_10062230 3300013297 Bacteria 3332
164 Ga0157378_10074689 3300013297 Bacteria 3051
165 Ga0163162_10000417 3300013306 Bacteria 39158
166 Ga0163162_10001437 3300013306 Bacteria 22194
167 Ga0163162_10014053 3300013306 Bacteria 7825
168 Ga0163162_10053181 3300013306 Bacteria 4070
169 Ga0163162_10384929 3300013306 Bacteria 1536
170 Ga0157372_10003732 3300013307 Bacteria 16358
171 Ga0157372_10005033 3300013307 Bacteria 14039
172 Ga0157372_10029807 3300013307 Bacteria 5963
173 Ga0157372_10084897 3300013307 Bacteria 3590
174 Ga0157372_10149395 3300013307 Bacteria 2696
175 Ga0157372_10982706 3300013307 Bacteria 978
176 Ga0157375_10000248 3300013308 Bacteria 49146
177 Ga0157375_10039207 3300013308 Bacteria 4558
178 Ga0157375_11081340 3300013308 Bacteria 938
179 Ga0163163_10000496 3300014325 Bacteria 35448
180 Ga0163163_10029416 3300014325 Bacteria 5284
181 Ga0163163_10033853 3300014325 Bacteria 4945
182 Ga0163163_10225249 3300014325 Bacteria 1924
183 Ga0157379_10000096 3300014968 Bacteria 59172
184 Ga0157379_10053576 3300014968 Bacteria 3604
185 Ga0157379_10274906 3300014968 Unclassified 1532
186 Ga0157376_10000196 3300014969 Bacteria 42092
187 Ga0157376_10006350 3300014969 Bacteria 8349
188 Ga0157376_10048715 3300014969 Bacteria 3506
189 Ga0157376_10195732 3300014969 Bacteria 1857
190 Ga0163161_10023441 3300017792 Bacteria 4354
191 Ga0163161_10117103 3300017792 Bacteria 1998
192 Ga0197907_11228300 3300020069 Bacteria 816
193 Ga0206352_10716443 3300020078 Unclassified 2928
194 Ga0213872_10137375 3300021361 Bacteria 1074
195 Ga0209258_100336 3300025242 Bacteria 70306
196 Ga0209148_1000157 3300025254 Bacteria 142367
197 Ga0207426_1000002 3300025302 Bacteria 1249660
198 Ga0207656_10001444 3300025321 Bacteria 7878
199 Ga0207656_10014600 3300025321 Bacteria 3030
200 Ga0207710_10088196 3300025900 Bacteria 1448
201 Ga0207710_10160323 3300025900 Bacteria 1095
202 Ga0207680_10000111 3300025903 Bacteria 37377
203 Ga0207680_10000571 3300025903 Bacteria 17448
204 Ga0207680_10008773 3300025903 Bacteria 4981
205 Ga0207680_10114079 3300025903 Bacteria 1758
206 Ga0207647_10018159 3300025904 Bacteria 4765
207 Ga0207647_10088060 3300025904 Bacteria 1854
208 Ga0207645_10000231 3300025907 Bacteria 46287
209 Ga0207645_10002867 3300025907 Bacteria 13357
210 Ga0207645_10037794 3300025907 Bacteria 3098
211 Ga0207705_10007225 3300025909 Bacteria 8177
212 Ga0207705_10071155 3300025909 Unclassified 2521
213 Ga0207705_10296350 3300025909 Bacteria 1240
214 Ga0207654_10000735 3300025911 Bacteria 18221
215 Ga0207707_10000721 3300025912 Bacteria 32676
216 Ga0207695_10000073 3300025913 Bacteria 312565
217 Ga0207695_10001624 3300025913 Bacteria 36440
218 Ga0207695_10017176 3300025913 Bacteria 8433
219 Ga0207695_10032561 3300025913 Bacteria 5703
220 Ga0207695_10032956 3300025913 Bacteria 5660
221 Ga0207695_10053893 3300025913 Bacteria 4204
222 Ga0207695_10154156 3300025913 Bacteria 2233
223 Ga0207695_10174156 3300025913 Bacteria 2075
224 Ga0207671_10004164 3300025914 Bacteria 13977
225 Ga0207671_10014057 3300025914 Bacteria 6345
226 Ga0207671_10015914 3300025914 Bacteria 5866
227 Ga0207671_10026541 3300025914 Bacteria 4338
228 Ga0207671_10077968 3300025914 Bacteria 2481
229 Ga0207671_10323720 3300025914 Bacteria 1220
230 Ga0207660_10024613 3300025917 Unclassified 4077
231 Ga0207657_10447871 3300025919 Bacteria 1013
232 Ga0207652_10016887 3300025921 Bacteria 5968
233 Ga0207681_10066464 3300025923 Bacteria 2496
234 Ga0207681_10253764 3300025923 Bacteria 1374
235 Ga0207694_10022649 3300025924 Bacteria 4766
236 Ga0207694_10106697 3300025924 Bacteria 2225
237 Ga0207694_10144160 3300025924 Unclassified 1916
238 Ga0207694_10264856 3300025924 Bacteria 1409
239 Ga0207650_10452435 3300025925 Bacteria 1069
240 Ga0207659_10123964 3300025926 Bacteria 1984
241 Ga0207706_10008470 3300025933 Bacteria 9485
242 Ga0207706_10217186 3300025933 Unclassified 1675
243 Ga0207709_10233198 3300025935 Bacteria 1334
244 Ga0207669_10056901 3300025937 Bacteria 2377
245 Ga0207704_10002221 3300025938 Bacteria 8705
246 Ga0207704_10040542 3300025938 Bacteria 2723
247 Ga0207704_10084035 3300025938 Bacteria 2068
248 Ga0207704_10312456 3300025938 Bacteria 1209
249 Ga0207691_10000185 3300025940 Bacteria 59033
250 Ga0207691_10006452 3300025940 Bacteria 11331
251 Ga0207691_10040874 3300025940 Bacteria 4284
252 Ga0207691_10449103 3300025940 Bacteria 1097
253 Ga0207711_10147727 3300025941 Bacteria 2119
254 Ga0207689_10002664 3300025942 Bacteria 16512
255 Ga0207689_10023589 3300025942 Bacteria 5160
256 Ga0207661_10032224 3300025944 Bacteria 4058
257 Ga0207667_10000449 3300025949 Bacteria 55183
258 Ga0207667_10013110 3300025949 Bacteria 9513
259 Ga0207667_10073097 3300025949 Bacteria 3563
260 Ga0207667_10083059 3300025949 Bacteria 3317
261 Ga0207651_10001155 3300025960 Bacteria 11797
262 Ga0207651_10052976 3300025960 Bacteria 2770
263 Ga0207651_10308210 3300025960 Bacteria 1319
264 Ga0207712_10035873 3300025961 Bacteria 3373
265 Ga0207712_10241708 3300025961 Bacteria 1454
266 Ga0207668_10001345 3300025972 Bacteria 14564
267 Ga0207668_10048205 3300025972 Bacteria 2922
268 Ga0207668_10074902 3300025972 Bacteria 2432
269 Ga0207668_10546720 3300025972 Bacteria 1002
270 Ga0207640_10068078 3300025981 Bacteria 2385
271 Ga0207640_10339902 3300025981 Bacteria 1202
272 Ga0207658_10000883 3300025986 Bacteria 24963
273 Ga0207658_10055725 3300025986 Bacteria 2931
274 Ga0207658_10394437 3300025986 Bacteria 1215
275 Ga0207677_10008995 3300026023 Bacteria 5603
276 Ga0207677_10068965 3300026023 Bacteria 2485
277 Ga0207677_10310582 3300026023 Bacteria 1306
278 Ga0207703_10002120 3300026035 Bacteria 17465
279 Ga0207703_10357095 3300026035 Bacteria 1347
280 Ga0207639_10005712 3300026041 Bacteria 8422
281 Ga0207639_10101936 3300026041 Bacteria 2322
282 Ga0207639_10165080 3300026041 Bacteria 1870
283 Ga0207702_10094713 3300026078 Unclassified 2622
284 Ga0207641_10000280 3300026088 Bacteria 64281
285 Ga0207641_10041508 3300026088 Bacteria 3855
286 Ga0207641_10218476 3300026088 Bacteria 1766
287 Ga0207641_10513198 3300026088 Bacteria 1165
288 Ga0207648_10000649 3300026089 Bacteria 39082
289 Ga0207648_10003092 3300026089 Bacteria 17582
290 Ga0207648_10052723 3300026089 Bacteria 3557
291 Ga0207676_10001327 3300026095 Bacteria 18391
292 Ga0207676_10012020 3300026095 Bacteria 6195
293 Ga0207676_10101230 3300026095 Bacteria 2389
294 Ga0207674_10012179 3300026116 Bacteria 9626
295 Ga0207674_10759956 3300026116 Bacteria 936
296 Ga0207675_100069659 3300026118 Bacteria 3288
297 Ga0207675_100112071 3300026118 Bacteria 2574
298 Ga0207675_100152135 3300026118 Bacteria 2203
299 Ga0207683_10000439 3300026121 Bacteria 38420
300 Ga0207683_10585237 3300026121 Bacteria 1033
301 Ga0207698_10029620 3300026142 Bacteria 3924
302 Ga0207698_10042130 3300026142 Bacteria 3408
303 Ga0207698_10398018 3300026142 Bacteria 1315
304 Ga0268266_10000102 3300028379 Bacteria 179754
305 Ga0268266_10005320 3300028379 Bacteria 12063
306 Ga0268266_10022842 3300028379 Bacteria 5324
307 Ga0268266_10632328 3300028379 Unclassified 1029
308 Ga0268264_10000189 3300028381 Bacteria 128203
309 Ga0268264_10008634 3300028381 Bacteria 8464
310 Ga0268264_10009952 3300028381 Bacteria 7873
311 Ga0268264_10017439 3300028381 Bacteria 5879
312 Ga0268264_10052967 3300028381 Bacteria 3385
313 Ga0268264_10089667 3300028381 Bacteria 2648
314 Ga0307517_10003166 3300028786 Bacteria 25861
315 Ga0307516_10001530 3300031730 Bacteria 31809
316 Ga0307407_10000020 3300031903 Bacteria 126218
317 Ga0307416_100000042 3300032002 Bacteria 130512
318 Ga0307414_10004051 3300032004 Bacteria 7901
319 Ga0307411_10097708 3300032005 Bacteria 2068
320 Ga0307510_10000119 3300033180 Bacteria 62835
321 Ga0373937_0118412 3300036401 Bacteria 2467
322 Ga0373937_1268347 3300036401 Bacteria 685
323 Ga0395900_0073317 3300037418 Unclassified 3520
324 Ga0395905_0011240 3300037471 Bacteria 8654
325 Ga0395905_0391210 3300037471 Unclassified 1285
326 Ga0436361_0261288 3300039447 Bacteria 1282
327 Ga0439431_0000422 3300041997 Bacteria 8974
328 Ga0466972_0000180 3300044658 Bacteria 48646
329 Ga0466972_0005204 3300044658 Bacteria 6513
330 Ga0466972_0170734 3300044658 Bacteria 1021
331 Ga0453683_0047923 3300044673 Unclassified 2680
332 Ga0466964_0016830 3300044706 Bacteria 2795
333 Ga0453684_0034766 3300044712 Bacteria 6984
334 Ga0495638_0020886 3300046460 Unclassified 4323
335 Ga0495606_0011188 3300046507 Bacteria 7346
336 Ga0495632_0204017 3300046519 Bacteria 899
337 Ga0495648_0001645 3300046524 Bacteria 21701
338 Ga0495611_0000144 3300046648 Bacteria 50318
339 Ga0495661_0009474 3300046665 Bacteria 6683
340 Ga0495687_000001 3300047443 Bacteria 1215582
341 Ga0495686_0000058 3300047472 Bacteria 240089
342 Ga0496105_0745662 3300048908 Unclassified 748
343 Ga0496106_0291721 3300048909 Bacteria 1308
344 Ga0496108_0201976 3300048911 Bacteria 1725
345 Ga0496114_0012392 3300048917 Bacteria 6825
346 Ga0501292_040163 3300049515 Unclassified 807
347 Ga0501032_0043018 3300049569 Bacteria 3062
348 Ga0501034_0024878 3300049571 Bacteria 6092
349 Ga0501034_0041018 3300049571 Bacteria 4683
350 Ga0501034_0180202 3300049571 Bacteria 2077
351 Ga0501036_0031715 3300049572 Bacteria 4465
352 Ga0501037_0101111 3300049573 Bacteria 2081
353 Ga0501038_0007351 3300049574 Bacteria 10162
354 Ga0501043_0002851 3300049579 Bacteria 14440
355 Ga0501047_0209533 3300049581 Unclassified 1808
356 Ga0501067_0008045 3300049583 Bacteria 5859
357 Ga0501070_0002264 3300049586 Bacteria 16921
358 Ga0501202_010436 3300049652 Bacteria 1724
359 Ga0501207_038819 3300049654 Bacteria 823
360 Ga0501235_026944 3300049669 Bacteria 1289
361 Ga0501259_001962 3300049688 Bacteria 3402
362 Ga0501225_0117614 3300049705 Unclassified 788
363 Ga0501079_0128986 3300049741 Bacteria 1968
364 Ga0501080_0393147 3300049742 Bacteria 1248
365 Ga0501083_0029072 3300049744 Bacteria 3805
366 Ga0501241_000318 3300049758 Bacteria 10546
367 Ga0501241_013579 3300049758 Bacteria 1480
368 Ga0501035_0501107 3300049822 Bacteria 999
369 Ga0501044_0056866 3300049823 Bacteria 4016
370 Ga0501044_0098483 3300049823 Bacteria 2944
371 Ga0500644_0000021 3300053088 Bacteria 100777
372 Ga0500581_098337 3300053089 Unclassified 1442
373 Ga0500646_0008360 3300053090 Bacteria 2647
374 Ga0500646_0019343 3300053090 Bacteria 1802
375 Ga0500583_0000767 3300053092 Bacteria 9333
376 Ga0500583_0035665 3300053092 Bacteria 2221
377 Ga0500651_0000887 3300053093 Bacteria 14677
378 Ga0500562_000003 3300053108 Bacteria 293779
379 Ga0500569_000813 3300053109 Bacteria 5504
380 Ga0500607_165079 3300053121 Unclassified 1006
381 Ga0500658_0033427 3300053134 Bacteria 2022
382 Ga0500568_0050789 3300053139 Bacteria 1633
383 Ga0500577_0189632 3300053142 Bacteria 884
384 Ga0500616_0005630 3300053153 Bacteria 8454
385 Ga0500622_0001190 3300053156 Bacteria 21483
386 Ga0500633_0000273 3300053160 Bacteria 7528
387 Ga0500633_0087222 3300053160 Bacteria 1136
388 Ga0501084_0119914 3300054114 Bacteria 2211
389 Ga0500661_027499 3300055283 Unclassified 1005
390 Ga0501082_0008197 3300060353 Bacteria 9016

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10982706 Ga0157372_109827061 182
2 3300005577 Ga0068857_100016383 Ga0068857_1000163833 191
3 3300026078 Ga0207702_10094713 Ga0207702_100947131 191
4 3300044706 Ga0466964_0016830 Ga0466964_0016830_1249_1917 191
5 3300046507 Ga0495606_0011188 Ga0495606_0011188_2995_3591 192
6 3300025907 Ga0207645_10037794 Ga0207645_100377943 193
7 3300021361 Ga0213872_10137375 Ga0213872_101373752 196
8 3300025938 Ga0207704_10312456 Ga0207704_103124562 196
9 3300025960 Ga0207651_10052976 Ga0207651_100529762 196
10 3300025981 Ga0207640_10339902 Ga0207640_103399021 196
11 3300025986 Ga0207658_10394437 Ga0207658_103944372 196
12 3300039447 Ga0436361_0261288 Ga0436361_0261288_479_1087 196
13 3300049758 Ga0501241_013579 Ga0501241_013579_604_1218 197
14 3300003320 rootH2_10198423 rootH2_101984231 198
15 3300005548 Ga0070665_100000001 Ga0070665_100000001349 198
16 3300013306 Ga0163162_10014053 Ga0163162_100140532 198
17 3300028379 Ga0268266_10000102 Ga0268266_1000010217 198
18 3300044658 Ga0466972_0000180 Ga0466972_0000180_27243_27935 198
19 3300046460 Ga0495638_0020886 Ga0495638_0020886_1471_2073 198
20 3300046524 Ga0495648_0001645 Ga0495648_0001645_6720_7322 198
21 3300047443 Ga0495687_000001 Ga0495687_000001_805071_805673 198
22 3300053090 Ga0500646_0019343 Ga0500646_0019343_481_1083 198
23 3300053092 Ga0500583_0000767 Ga0500583_0000767_6478_7080 198
24 3300053139 Ga0500568_0050789 Ga0500568_0050789_630_1232 198
25 3300053156 Ga0500622_0001190 Ga0500622_0001190_8097_8699 198
26 3300003316 rootH1_10112344 rootH1_101123442 199
27 3300003322 rootL2_10058193 rootL2_100581937 199
28 3300005335 Ga0070666_10014851 Ga0070666_100148514 199
29 3300005539 Ga0068853_100275836 Ga0068853_1002758362 199
30 3300005614 Ga0068856_100293450 Ga0068856_1002934502 199
31 3300009093 Ga0105240_10000205 Ga0105240_1000020559 199
32 3300009174 Ga0105241_10001145 Ga0105241_100011452 199
33 3300009545 Ga0105237_10050962 Ga0105237_100509622 199
34 3300009551 Ga0105238_10017705 Ga0105238_100177052 199
35 3300010375 Ga0105239_10016769 Ga0105239_100167696 199
36 3300013307 Ga0157372_10029807 Ga0157372_100298072 199
37 3300025914 Ga0207671_10014057 Ga0207671_100140572 199
38 3300044658 Ga0466972_0005204 Ga0466972_0005204_3033_3668 199
39 3300044673 Ga0453683_0047923 Ga0453683_0047923_437_1123 201
40 3300044712 Ga0453684_0034766 Ga0453684_0034766_2075_2761 201
41 3300005535 Ga0070684_100009335 Ga0070684_1000093354 203
42 3300009093 Ga0105240_10005272 Ga0105240_1000527216 203
43 3300009093 Ga0105240_10096764 Ga0105240_100967643 203
44 3300009545 Ga0105237_10066240 Ga0105237_100662402 203
45 3300010375 Ga0105239_10000089 Ga0105239_100000893 203
46 3300010375 Ga0105239_10052022 Ga0105239_100520222 203
47 3300013104 Ga0157370_10056409 Ga0157370_100564092 203
48 3300013105 Ga0157369_10072589 Ga0157369_100725895 203
49 3300025949 Ga0207667_10013110 Ga0207667_100131108 203
50 3300036401 Ga0373937_0118412 Ga0373937_0118412_88_735 203
51 2162886007 SwRhRL2b_contig_636887 SwRhRL2b_0954.00006470 204
52 3300006237 Ga0097621_100002582 Ga0097621_10000258213 204
53 3300006358 Ga0068871_100037153 Ga0068871_1000371533 204
54 3300006881 Ga0068865_100516400 Ga0068865_1005164001 204
55 3300013104 Ga0157370_10482340 Ga0157370_104823402 204
56 3300013306 Ga0163162_10053181 Ga0163162_100531812 204
57 3300014969 Ga0157376_10006350 Ga0157376_100063507 204
58 3300014969 Ga0157376_10048715 Ga0157376_100487153 204
59 3300025938 Ga0207704_10084035 Ga0207704_100840352 204
60 3300036401 Ga0373937_1268347 Ga0373937_1268347_22_654 204
61 3300053093 Ga0500651_0000887 Ga0500651_0000887_3294_3929 204
62 3300055283 Ga0500661_027499 Ga0500661_027499_313_951 204
63 3300046648 Ga0495611_0000144 Ga0495611_0000144_5618_6295 206
64 3300005563 Ga0068855_100073188 Ga0068855_1000731884 209
65 3300006237 Ga0097621_100452251 Ga0097621_1004522512 209
66 3300013307 Ga0157372_10003732 Ga0157372_1000373212 209
67 3300013308 Ga0157375_10039207 Ga0157375_100392074 209
68 3300014325 Ga0163163_10225249 Ga0163163_102252492 209
69 3300014968 Ga0157379_10053576 Ga0157379_100535763 209
70 3300025904 Ga0207647_10088060 Ga0207647_100880602 209
71 3300025913 Ga0207695_10174156 Ga0207695_101741562 209
72 3300025914 Ga0207671_10323720 Ga0207671_103237202 209
73 3300048908 Ga0496105_0745662 Ga0496105_0745662_25_693 209
74 3300049758 Ga0501241_000318 Ga0501241_000318_5666_6319 209
75 3300005843 Ga0068860_100000137 Ga0068860_10000013724 210
76 3300028381 Ga0268264_10000189 Ga0268264_1000018964 210
77 3300005563 Ga0068855_100020344 Ga0068855_1000203442 211
78 3300005577 Ga0068857_100099629 Ga0068857_1000996292 211
79 3300005578 Ga0068854_100013378 Ga0068854_1000133784 211
80 3300005614 Ga0068856_100040515 Ga0068856_1000405152 211
81 3300005616 Ga0068852_100001189 Ga0068852_10000118912 211
82 3300005843 Ga0068860_100006219 Ga0068860_1000062199 211
83 3300009093 Ga0105240_10068559 Ga0105240_100685592 211
84 3300009545 Ga0105237_10002662 Ga0105237_100026627 211
85 3300009545 Ga0105237_10008014 Ga0105237_100080143 211
86 3300009551 Ga0105238_10752405 Ga0105238_107524051 211
87 3300010375 Ga0105239_10019482 Ga0105239_100194823 211
88 3300013306 Ga0163162_10384929 Ga0163162_103849292 211
89 3300025903 Ga0207680_10008773 Ga0207680_100087732 211
90 3300025904 Ga0207647_10018159 Ga0207647_100181592 211
91 3300025913 Ga0207695_10001624 Ga0207695_1000162425 211
92 3300025913 Ga0207695_10032561 Ga0207695_100325612 211
93 3300025913 Ga0207695_10032956 Ga0207695_100329562 211
94 3300025913 Ga0207695_10154156 Ga0207695_101541562 211
95 3300025914 Ga0207671_10004164 Ga0207671_1000416411 211
96 3300025914 Ga0207671_10026541 Ga0207671_100265411 211
97 3300025924 Ga0207694_10022649 Ga0207694_100226495 211
98 3300025924 Ga0207694_10106697 Ga0207694_101066972 211
99 3300025924 Ga0207694_10144160 Ga0207694_101441602 211
100 3300025949 Ga0207667_10000449 Ga0207667_1000044938 211
101 3300025981 Ga0207640_10068078 Ga0207640_100680782 211
102 3300026041 Ga0207639_10165080 Ga0207639_101650802 211
103 3300026095 Ga0207676_10101230 Ga0207676_101012302 211
104 3300026116 Ga0207674_10012179 Ga0207674_100121792 211
105 3300026142 Ga0207698_10042130 Ga0207698_100421302 211
106 3300028381 Ga0268264_10052967 Ga0268264_100529671 211
107 3300005327 Ga0070658_10158672 Ga0070658_101586722 213
108 3300005328 Ga0070676_10213610 Ga0070676_102136101 213
109 3300005334 Ga0068869_100449485 Ga0068869_1004494852 213
110 3300005335 Ga0070666_10082779 Ga0070666_100827793 213
111 3300005338 Ga0068868_100074305 Ga0068868_1000743053 213
112 3300005347 Ga0070668_100035547 Ga0070668_1000355472 213
113 3300005364 Ga0070673_100435291 Ga0070673_1004352912 213
114 3300005367 Ga0070667_100042770 Ga0070667_1000427702 213
115 3300005456 Ga0070678_100497598 Ga0070678_1004975981 213
116 3300005457 Ga0070662_100357894 Ga0070662_1003578942 213
117 3300005459 Ga0068867_100554739 Ga0068867_1005547391 213
118 3300005543 Ga0070672_100036501 Ga0070672_1000365012 213
119 3300005548 Ga0070665_100164267 Ga0070665_1001642672 213
120 3300005841 Ga0068863_100165587 Ga0068863_1001655872 213
121 3300005843 Ga0068860_100231272 Ga0068860_1002312721 213
122 3300006237 Ga0097621_100218853 Ga0097621_1002188532 213
123 3300009098 Ga0105245_10230146 Ga0105245_102301462 213
124 3300009177 Ga0105248_10223319 Ga0105248_102233191 213
125 3300014325 Ga0163163_10029416 Ga0163163_100294163 213
126 3300014968 Ga0157379_10274906 Ga0157379_102749062 213
127 3300017792 Ga0163161_10117103 Ga0163161_101171033 213
128 3300025321 Ga0207656_10014600 Ga0207656_100146001 213
129 3300025903 Ga0207680_10114079 Ga0207680_101140792 213
130 3300025909 Ga0207705_10071155 Ga0207705_100711552 213
131 3300025933 Ga0207706_10217186 Ga0207706_102171862 213
132 3300025938 Ga0207704_10040542 Ga0207704_100405423 213
133 3300025940 Ga0207691_10006452 Ga0207691_100064523 213
134 3300025960 Ga0207651_10308210 Ga0207651_103082101 213
135 3300025972 Ga0207668_10546720 Ga0207668_105467201 213
136 3300026023 Ga0207677_10068965 Ga0207677_100689652 213
137 3300026035 Ga0207703_10357095 Ga0207703_103570952 213
138 3300026088 Ga0207641_10218476 Ga0207641_102184762 213
139 3300026089 Ga0207648_10052723 Ga0207648_100527232 213
140 3300026118 Ga0207675_100069659 Ga0207675_1000696593 213
141 3300026121 Ga0207683_10585237 Ga0207683_105852372 213
142 3300028379 Ga0268266_10632328 Ga0268266_106323282 213
143 3300028381 Ga0268264_10089667 Ga0268264_100896672 213
144 3300048917 Ga0496114_0012392 Ga0496114_0012392_88_762 213
145 iso_pu_bacteria 2896085136 2896089688 213
146 iso_pu_bacteria 2896109856 2896110972 213
147 3300025913 Ga0207695_10053893 Ga0207695_100538932 214
148 3300025924 Ga0207694_10264856 Ga0207694_102648561 214
149 3300026041 Ga0207639_10101936 Ga0207639_101019362 214
150 3300041997 Ga0439431_0000422 Ga0439431_0000422_8243_8911 214
151 iso_pu_bacteria 2929239360 2929244803 214
152 3300003320 rootH2_10079641 rootH2_100796412 215
153 3300003322 rootL2_10122755 rootL2_101227552 215
154 3300003323 rootH1_10129438 rootH1_101294382 215
155 3300003354 JGI25160J50197_1003683 JGI25160J50197_10036836 215
156 3300003761 Ga0055535_1004248 Ga0055535_10042482 215
157 3300003762 Ga0055542_1002812 Ga0055542_10028123 215
158 3300005327 Ga0070658_10085432 Ga0070658_100854322 215
159 3300005328 Ga0070676_10008344 Ga0070676_100083447 215
160 3300005329 Ga0070683_100042604 Ga0070683_1000426044 215
161 3300005334 Ga0068869_100004084 Ga0068869_1000040845 215
162 3300005335 Ga0070666_10003664 Ga0070666_100036645 215
163 3300005338 Ga0068868_100024535 Ga0068868_1000245355 215
164 3300005341 Ga0070691_10101868 Ga0070691_101018682 215
165 3300005347 Ga0070668_100010527 Ga0070668_1000105275 215
166 3300005353 Ga0070669_100100815 Ga0070669_1001008152 215
167 3300005353 Ga0070669_100272757 Ga0070669_1002727572 215
168 3300005354 Ga0070675_100020404 Ga0070675_1000204047 215
169 3300005356 Ga0070674_100008290 Ga0070674_1000082905 215
170 3300005364 Ga0070673_100066256 Ga0070673_1000662562 215
171 3300005367 Ga0070667_100070473 Ga0070667_1000704733 215
172 3300005456 Ga0070678_100005156 Ga0070678_1000051567 215
173 3300005459 Ga0068867_100049656 Ga0068867_1000496562 215
174 3300005543 Ga0070672_100087065 Ga0070672_1000870652 215
175 3300005548 Ga0070665_100036604 Ga0070665_1000366042 215
176 3300005563 Ga0068855_100006586 Ga0068855_1000065865 215
177 3300005578 Ga0068854_100098789 Ga0068854_1000987891 215
178 3300005617 Ga0068859_100047589 Ga0068859_1000475892 215
179 3300005843 Ga0068860_100024910 Ga0068860_1000249103 215
180 3300006881 Ga0068865_100006144 Ga0068865_10000614410 215
181 3300006931 Ga0097620_100047587 Ga0097620_1000475874 215
182 3300009176 Ga0105242_10027499 Ga0105242_100274992 215
183 3300009545 Ga0105237_10109502 Ga0105237_101095021 215
184 3300010375 Ga0105239_10003881 Ga0105239_100038818 215
185 3300011119 Ga0105246_10028043 Ga0105246_100280432 215
186 3300013297 Ga0157378_10074689 Ga0157378_100746893 215
187 3300020069 Ga0197907_11228300 Ga0197907_112283001 215
188 3300020078 Ga0206352_10716443 Ga0206352_107164433 215
189 3300025242 Ga0209258_100336 Ga0209258_10033619 215
190 3300025254 Ga0209148_1000157 Ga0209148_100015788 215
191 3300025302 Ga0207426_1000002 Ga0207426_100000295 215
192 3300025907 Ga0207645_10002867 Ga0207645_100028676 215
193 3300025909 Ga0207705_10296350 Ga0207705_102963502 215
194 3300025913 Ga0207695_10000073 Ga0207695_1000007324 215
195 3300025914 Ga0207671_10077968 Ga0207671_100779682 215
196 3300025923 Ga0207681_10066464 Ga0207681_100664642 215
197 3300025923 Ga0207681_10253764 Ga0207681_102537641 215
198 3300025926 Ga0207659_10123964 Ga0207659_101239642 215
199 3300025937 Ga0207669_10056901 Ga0207669_100569012 215
200 3300025940 Ga0207691_10040874 Ga0207691_100408742 215
201 3300025942 Ga0207689_10002664 Ga0207689_100026645 215
202 3300025944 Ga0207661_10032224 Ga0207661_100322242 215
203 3300025972 Ga0207668_10048205 Ga0207668_100482052 215
204 3300026023 Ga0207677_10310582 Ga0207677_103105822 215
205 3300026089 Ga0207648_10000649 Ga0207648_1000064916 215
206 3300026118 Ga0207675_100152135 Ga0207675_1001521352 215
207 3300026121 Ga0207683_10000439 Ga0207683_1000043916 215
208 3300026142 Ga0207698_10398018 Ga0207698_103980182 215
209 3300028379 Ga0268266_10022842 Ga0268266_100228422 215
210 3300028381 Ga0268264_10017439 Ga0268264_100174397 215
211 3300037418 Ga0395900_0073317 Ga0395900_0073317_2007_2711 215
212 3300037471 Ga0395905_0011240 Ga0395905_0011240_3596_4300 215
213 3300046519 Ga0495632_0204017 Ga0495632_0204017_18_692 215
214 3300049515 Ga0501292_040163 Ga0501292_040163_116_796 215
215 3300049571 Ga0501034_0041018 Ga0501034_0041018_1531_2205 215
216 3300049705 Ga0501225_0117614 Ga0501225_0117614_10_690 215
217 3300053088 Ga0500644_0000021 Ga0500644_0000021_56878_57552 215
218 3300053089 Ga0500581_098337 Ga0500581_098337_497_1180 215
219 3300053090 Ga0500646_0008360 Ga0500646_0008360_41_715 215
220 3300053092 Ga0500583_0035665 Ga0500583_0035665_1260_1934 215
221 3300053109 Ga0500569_000813 Ga0500569_000813_313_987 215
222 3300053121 Ga0500607_165079 Ga0500607_165079_241_915 215
223 3300053134 Ga0500658_0033427 Ga0500658_0033427_308_982 215
224 3300053142 Ga0500577_0189632 Ga0500577_0189632_37_711 215
225 3300053153 Ga0500616_0005630 Ga0500616_0005630_3967_4641 215
226 3300053160 Ga0500633_0000273 Ga0500633_0000273_4650_5324 215
227 3300053160 Ga0500633_0087222 Ga0500633_0087222_422_1096 215
228 3300005327 Ga0070658_10001278 Ga0070658_100012789 216
229 3300005328 Ga0070676_10000011 Ga0070676_100000112 216
230 3300005331 Ga0070670_100140605 Ga0070670_1001406053 216
231 3300005334 Ga0068869_100008785 Ga0068869_1000087856 216
232 3300005334 Ga0068869_100278055 Ga0068869_1002780551 216
233 3300005335 Ga0070666_10000065 Ga0070666_1000006568 216
234 3300005335 Ga0070666_10000107 Ga0070666_1000010720 216
235 3300005338 Ga0068868_100000401 Ga0068868_1000004015 216
236 3300005338 Ga0068868_100154762 Ga0068868_1001547623 216
237 3300005347 Ga0070668_100000017 Ga0070668_10000001773 216
238 3300005355 Ga0070671_100833578 Ga0070671_1008335781 216
239 3300005364 Ga0070673_100001453 Ga0070673_1000014537 216
240 3300005367 Ga0070667_100000376 Ga0070667_10000037616 216
241 3300005367 Ga0070667_100019335 Ga0070667_1000193351 216
242 3300005457 Ga0070662_100021882 Ga0070662_1000218822 216
243 3300005459 Ga0068867_100002017 Ga0068867_10000201716 216
244 3300005539 Ga0068853_100006075 Ga0068853_1000060754 216
245 3300005543 Ga0070672_100000053 Ga0070672_10000005340 216
246 3300005548 Ga0070665_100002783 Ga0070665_10000278317 216
247 3300005563 Ga0068855_100029785 Ga0068855_1000297858 216
248 3300005616 Ga0068852_100028419 Ga0068852_1000284194 216
249 3300005617 Ga0068859_100000006 Ga0068859_100000006252 216
250 3300005618 Ga0068864_100001989 Ga0068864_1000019899 216
251 3300005719 Ga0068861_100017358 Ga0068861_1000173582 216
252 3300005834 Ga0068851_10000292 Ga0068851_100002925 216
253 3300005841 Ga0068863_100002366 Ga0068863_10000236622 216
254 3300005842 Ga0068858_100000305 Ga0068858_10000030524 216
255 3300005842 Ga0068858_100023966 Ga0068858_1000239664 216
256 3300005843 Ga0068860_100033978 Ga0068860_1000339783 216
257 3300005843 Ga0068860_100061086 Ga0068860_1000610862 216
258 3300006237 Ga0097621_100007912 Ga0097621_1000079125 216
259 3300006237 Ga0097621_100008974 Ga0097621_1000089746 216
260 3300006931 Ga0097620_100000006 Ga0097620_100000006252 216
261 3300009093 Ga0105240_10013917 Ga0105240_100139177 216
262 3300009098 Ga0105245_10326787 Ga0105245_103267871 216
263 3300009101 Ga0105247_10002655 Ga0105247_100026558 216
264 3300009101 Ga0105247_10170197 Ga0105247_101701972 216
265 3300009148 Ga0105243_10369921 Ga0105243_103699212 216
266 3300009174 Ga0105241_10001417 Ga0105241_100014173 216
267 3300009174 Ga0105241_10169739 Ga0105241_101697392 216
268 3300009176 Ga0105242_10389411 Ga0105242_103894112 216
269 3300009177 Ga0105248_10107590 Ga0105248_101075902 216
270 3300009545 Ga0105237_10002580 Ga0105237_1000258019 216
271 3300009553 Ga0105249_10286816 Ga0105249_102868162 216
272 3300009553 Ga0105249_10330297 Ga0105249_103302972 216
273 3300011119 Ga0105246_10003336 Ga0105246_100033365 216
274 3300011119 Ga0105246_10007944 Ga0105246_100079444 216
275 3300013102 Ga0157371_10023992 Ga0157371_100239922 216
276 3300013105 Ga0157369_10110612 Ga0157369_101106123 216
277 3300013105 Ga0157369_10306710 Ga0157369_103067102 216
278 3300013296 Ga0157374_10000356 Ga0157374_1000035624 216
279 3300013296 Ga0157374_10120364 Ga0157374_101203642 216
280 3300013297 Ga0157378_10062230 Ga0157378_100622302 216
281 3300013306 Ga0163162_10000417 Ga0163162_1000041724 216
282 3300013306 Ga0163162_10001437 Ga0163162_100014373 216
283 3300013307 Ga0157372_10005033 Ga0157372_1000503312 216
284 3300013308 Ga0157375_10000248 Ga0157375_1000024822 216
285 3300013308 Ga0157375_11081340 Ga0157375_110813401 216
286 3300014325 Ga0163163_10000496 Ga0163163_1000049624 216
287 3300014325 Ga0163163_10033853 Ga0163163_100338532 216
288 3300014968 Ga0157379_10000096 Ga0157379_1000009633 216
289 3300014969 Ga0157376_10000196 Ga0157376_1000019624 216
290 3300014969 Ga0157376_10195732 Ga0157376_101957322 216
291 3300017792 Ga0163161_10023441 Ga0163161_100234416 216
292 3300025321 Ga0207656_10001444 Ga0207656_100014445 216
293 3300025900 Ga0207710_10088196 Ga0207710_100881962 216
294 3300025900 Ga0207710_10160323 Ga0207710_101603232 216
295 3300025903 Ga0207680_10000111 Ga0207680_1000011137 216
296 3300025903 Ga0207680_10000571 Ga0207680_100005719 216
297 3300025907 Ga0207645_10000231 Ga0207645_1000023138 216
298 3300025909 Ga0207705_10007225 Ga0207705_100072252 216
299 3300025911 Ga0207654_10000735 Ga0207654_100007353 216
300 3300025914 Ga0207671_10015914 Ga0207671_100159143 216
301 3300025925 Ga0207650_10452435 Ga0207650_104524352 216
302 3300025933 Ga0207706_10008470 Ga0207706_100084702 216
303 3300025935 Ga0207709_10233198 Ga0207709_102331982 216
304 3300025938 Ga0207704_10002221 Ga0207704_100022214 216
305 3300025940 Ga0207691_10000185 Ga0207691_1000018524 216
306 3300025940 Ga0207691_10449103 Ga0207691_104491032 216
307 3300025941 Ga0207711_10147727 Ga0207711_101477273 216
308 3300025942 Ga0207689_10023589 Ga0207689_100235893 216
309 3300025949 Ga0207667_10073097 Ga0207667_100730972 216
310 3300025960 Ga0207651_10001155 Ga0207651_100011556 216
311 3300025961 Ga0207712_10035873 Ga0207712_100358733 216
312 3300025961 Ga0207712_10241708 Ga0207712_102417081 216
313 3300025972 Ga0207668_10001345 Ga0207668_1000134515 216
314 3300025972 Ga0207668_10074902 Ga0207668_100749023 216
315 3300025986 Ga0207658_10000883 Ga0207658_100008839 216
316 3300025986 Ga0207658_10055725 Ga0207658_100557252 216
317 3300026023 Ga0207677_10008995 Ga0207677_100089955 216
318 3300026035 Ga0207703_10002120 Ga0207703_1000212016 216
319 3300026041 Ga0207639_10005712 Ga0207639_100057123 216
320 3300026088 Ga0207641_10000280 Ga0207641_1000028019 216
321 3300026088 Ga0207641_10041508 Ga0207641_100415085 216
322 3300026088 Ga0207641_10513198 Ga0207641_105131981 216
323 3300026089 Ga0207648_10003092 Ga0207648_1000309217 216
324 3300026095 Ga0207676_10001327 Ga0207676_1000132716 216
325 3300026095 Ga0207676_10012020 Ga0207676_100120203 216
326 3300026118 Ga0207675_100112071 Ga0207675_1001120712 216
327 3300026142 Ga0207698_10029620 Ga0207698_100296201 216
328 3300028379 Ga0268266_10005320 Ga0268266_100053204 216
329 3300028381 Ga0268264_10008634 Ga0268264_100086345 216
330 3300028381 Ga0268264_10009952 Ga0268264_100099522 216
331 3300028786 Ga0307517_10003166 Ga0307517_1000316612 216
332 3300031730 Ga0307516_10001530 Ga0307516_1000153018 216
333 3300033180 Ga0307510_10000119 Ga0307510_100001197 216
334 3300037471 Ga0395905_0391210 Ga0395905_0391210_50_793 216
335 3300047472 Ga0495686_0000058 Ga0495686_0000058_99152_99871 216
336 3300048909 Ga0496106_0291721 Ga0496106_0291721_589_1272 216
337 3300048911 Ga0496108_0201976 Ga0496108_0201976_450_1133 216
338 3300049569 Ga0501032_0043018 Ga0501032_0043018_1958_2644 216
339 3300049571 Ga0501034_0180202 Ga0501034_0180202_669_1355 216
340 3300049572 Ga0501036_0031715 Ga0501036_0031715_445_1131 216
341 3300049573 Ga0501037_0101111 Ga0501037_0101111_61_747 216
342 3300049574 Ga0501038_0007351 Ga0501038_0007351_575_1261 216
343 3300049579 Ga0501043_0002851 Ga0501043_0002851_3648_4334 216
344 3300049581 Ga0501047_0209533 Ga0501047_0209533_75_761 216
345 3300049652 Ga0501202_010436 Ga0501202_010436_948_1634 216
346 3300049654 Ga0501207_038819 Ga0501207_038819_47_733 216
347 3300049669 Ga0501235_026944 Ga0501235_026944_262_948 216
348 3300049688 Ga0501259_001962 Ga0501259_001962_704_1390 216
349 3300049822 Ga0501035_0501107 Ga0501035_0501107_186_872 216
350 3300049823 Ga0501044_0098483 Ga0501044_0098483_1546_2232 216
351 iso_pu_bacteria 2883068021 2883071581 216
352 2162886007 SwRhRL2b_contig_2319196 SwRhRL2b_0403.00003710 217
353 3300003781 Ga0055536_1000009 Ga0055536_1000009157 217
354 3300005288 Ga0065714_10003304 Ga0065714_100033043 217
355 3300005289 Ga0065704_10078469 Ga0065704_100784693 217
356 3300005328 Ga0070676_10002626 Ga0070676_100026263 217
357 3300005336 Ga0070680_100007329 Ga0070680_1000073294 217
358 3300005341 Ga0070691_10024816 Ga0070691_100248162 217
359 3300005458 Ga0070681_10023149 Ga0070681_100231493 217
360 3300005539 Ga0068853_100024307 Ga0068853_1000243072 217
361 3300005547 Ga0070693_100004416 Ga0070693_1000044163 217
362 3300005577 Ga0068857_100741881 Ga0068857_1007418812 217
363 3300009093 Ga0105240_10033871 Ga0105240_100338717 217
364 3300009174 Ga0105241_10003081 Ga0105241_1000308110 217
365 3300013102 Ga0157371_10001942 Ga0157371_100019427 217
366 3300013104 Ga0157370_10000479 Ga0157370_1000047913 217
367 3300013104 Ga0157370_10050808 Ga0157370_100508082 217
368 3300013104 Ga0157370_10053627 Ga0157370_100536272 217
369 3300013105 Ga0157369_10227644 Ga0157369_102276443 217
370 3300013307 Ga0157372_10084897 Ga0157372_100848973 217
371 3300013307 Ga0157372_10149395 Ga0157372_101493952 217
372 3300025912 Ga0207707_10000721 Ga0207707_1000072123 217
373 3300025913 Ga0207695_10017176 Ga0207695_100171762 217
374 3300025917 Ga0207660_10024613 Ga0207660_100246131 217
375 3300025919 Ga0207657_10447871 Ga0207657_104478711 217
376 3300025921 Ga0207652_10016887 Ga0207652_100168872 217
377 3300025949 Ga0207667_10083059 Ga0207667_100830592 217
378 3300026116 Ga0207674_10759956 Ga0207674_107599562 217
379 3300031903 Ga0307407_10000020 Ga0307407_10000020135 217
380 3300032002 Ga0307416_100000042 Ga0307416_100000042131 217
381 3300032004 Ga0307414_10004051 Ga0307414_100040518 217
382 3300032005 Ga0307411_10097708 Ga0307411_100977082 217
383 3300044658 Ga0466972_0170734 Ga0466972_0170734_291_980 217
384 3300046665 Ga0495661_0009474 Ga0495661_0009474_217_915 217
385 3300049571 Ga0501034_0024878 Ga0501034_0024878_3151_3873 217
386 3300049583 Ga0501067_0008045 Ga0501067_0008045_1119_1841 217
387 3300049586 Ga0501070_0002264 Ga0501070_0002264_7353_8075 217
388 3300049741 Ga0501079_0128986 Ga0501079_0128986_500_1222 217
389 3300049742 Ga0501080_0393147 Ga0501080_0393147_475_1164 217
390 3300049744 Ga0501083_0029072 Ga0501083_0029072_2207_2929 217
391 3300049823 Ga0501044_0056866 Ga0501044_0056866_2205_2927 217
392 3300053108 Ga0500562_000003 Ga0500562_000003_239059_239751 217
393 3300054114 Ga0501084_0119914 Ga0501084_0119914_66_788 217
394 3300060353 Ga0501082_0008197 Ga0501082_0008197_4875_5597 217
395 iso_pu_bacteria 2585427687 2586209098 217
396 iso_pu_bacteria 2896085136 2896087975 217
397 iso_pu_bacteria 2929154850 2929156713 217
398 iso_pu_bacteria 2945997725 2946001071 217
399 iso_pu_bacteria 2954016120 2954019243 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

50

138

0.95

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

170

242

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gau-assembly1.cif.gz_A-2 crystal structure of transcriptional regulator, crp/fnr family from porphyromonas gingivalis (apc80792), structural genomics, mcsg 0.9312 9 214
7ff9-assembly3.cif.gz_E pseudomonas aeruginosa virulence factor regulator with camp ligand and cl(triethylphosphine)gold(i) 0.929 26 205
2oz6-assembly1.cif.gz_A-2 crystal structure of virulence factor regulator from pseudomonas aeruginosa in complex with camp 0.919 14 204
3i54-assembly2.cif.gz_C crystal structure of mtbcrp in complex with camp 0.9169 18 213
3i59-assembly1.cif.gz_A crystal structure of mtbcrp in complex with n6-camp 0.9104 26 213
ID Description Score Start End Superfamily
3i54C01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9516 18 141 2.60.120.10
2gauA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9429 144 214 1.10.10.10
2gauA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.932 9 141 2.60.120.10
4byyB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9236 144 205 1.10.10.10
2xkpF01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9233 25 123 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1I1P4J5-F1-model_v4 Transcriptional regulator /transcriptional regulator, Crp/Fnr family 0.9707 1 217 GO:0003677
GO:0003700
GO:0005829
AF-A0A5B8V578-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9685 3 217 GO:0003677
GO:0003700
GO:0005829
AF-A0A1I1P4J5-F1-model_v4 Transcriptional regulator /transcriptional regulator, Crp/Fnr family 0.9663 1 217 GO:0003677
GO:0003700
GO:0005829
AF-A0A4Q3SXD4-F1-model_v4 deleted 0.9643 14 214
AF-A0A5K7S9I9-F1-model_v4 Transcriptional regulator, Crp/Fnr family 0.9592 11 214 GO:0003677
GO:0003700
GO:0005829

Feature Viewer

pLDDT pTM Quality
92.35 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map