F434309

General Info

Members Datasets Scaffolds Average Seq Length
399 166 798 242

Family's Representative Sequence

Representative Sequence 3300025938|Ga0207704_10381538|Ga0207704_103815382
Length 295
Sequence LKNFYEMLSLPSDAPSDESGRRNGSGAPDLARAAAADSPQYTPSTPPGSSASLGAGLDFDHVSVDDVSRHFGRRRAVARVSFVAARGNIIGLLGPNGAGKSTLLAMLATLLRPSAGSIRYGAMQADDAPPALRGRIGVLGHDLFLYPELTARENLAFFAGLYGHRDADGAARAALTRAGLADRGDDLVAGFSRGMRQRVALERALIHDPRLVLLDEPFTGLDDASASALVARLRELRQGGAILVVATHDLEVADRLLDHALFLREGRAAASIAQPKHLRSTYQDVMTRPIDGARA

Samples

Sample ID Description Type Environment
1 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
120 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
121 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
122 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
123 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
124 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
130 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
133 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
134 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.5
Rhizosphere 99.25
Stem 0
Stem Tuber 0
Unclassified 2.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207704_10381538 3300025938 Bacteria 1106
2 JGI25406J46586_10001300 3300003203 Bacteria 11756
3 JGI25406J46586_10002200 3300003203 Bacteria 9201
4 Ga0065707_10129017 3300005295 Bacteria 1955
5 Ga0070676_10029888 3300005328 Bacteria 3102
6 Ga0070676_10156647 3300005328 Bacteria 1462
7 Ga0070690_100009865 3300005330 Bacteria 5543
8 Ga0070690_100027677 3300005330 Bacteria 3505
9 Ga0070690_100122958 3300005330 Bacteria 1744
10 Ga0070690_100174169 3300005330 Bacteria 1483
11 Ga0070670_100000526 3300005331 Bacteria 30727
12 Ga0070677_10023114 3300005333 Unclassified 2298
13 Ga0068869_100000513 3300005334 Bacteria 21600
14 Ga0068869_100045846 3300005334 Bacteria 3149
15 Ga0070666_10038138 3300005335 Bacteria 3196
16 Ga0070666_10242028 3300005335 Bacteria 1276
17 Ga0070666_10300119 3300005335 Bacteria 1144
18 Ga0070680_100113322 3300005336 Bacteria 2259
19 Ga0070682_100143557 3300005337 Bacteria 1630
20 Ga0068868_100133775 3300005338 Bacteria 2031
21 Ga0068868_100145926 3300005338 Bacteria 1946
22 Ga0070660_100205060 3300005339 Bacteria 1600
23 Ga0070660_100353628 3300005339 Bacteria 1210
24 Ga0070689_100051319 3300005340 Bacteria 3188
25 Ga0070689_100158759 3300005340 Bacteria 1827
26 Ga0070689_100546468 3300005340 Bacteria 998
27 Ga0070687_100009821 3300005343 Bacteria 4110
28 Ga0070668_100050490 3300005347 Bacteria 3202
29 Ga0070668_100389868 3300005347 Bacteria 1187
30 Ga0070669_100002903 3300005353 Bacteria 12356
31 Ga0070669_100005838 3300005353 Bacteria 8876
32 Ga0070669_100019921 3300005353 Bacteria 4792
33 Ga0070669_100022226 3300005353 Bacteria 4536
34 Ga0070675_100004062 3300005354 Bacteria 11109
35 Ga0070675_100015237 3300005354 Bacteria 6072
36 Ga0070675_100033477 3300005354 Bacteria 4167
37 Ga0070675_100039722 3300005354 Bacteria 3841
38 Ga0070675_100128190 3300005354 Bacteria 2160
39 Ga0070675_100257869 3300005354 Bacteria 1527
40 Ga0070675_100380046 3300005354 Bacteria 1257
41 Ga0070675_100381029 3300005354 Bacteria 1255
42 Ga0070671_100008831 3300005355 Bacteria 8088
43 Ga0070671_100011537 3300005355 Bacteria 7105
44 Ga0070671_100038354 3300005355 Bacteria 3977
45 Ga0070673_100006040 3300005364 Bacteria 7843
46 Ga0070673_100006899 3300005364 Bacteria 7427
47 Ga0070673_100021207 3300005364 Bacteria 4703
48 Ga0070673_100051378 3300005364 Bacteria 3228
49 Ga0070673_100066776 3300005364 Bacteria 2874
50 Ga0070673_100081895 3300005364 Bacteria 2618
51 Ga0070673_100131170 3300005364 Bacteria 2103
52 Ga0070673_100208176 3300005364 Bacteria 1688
53 Ga0070673_100361690 3300005364 Bacteria 1290
54 Ga0070673_100559651 3300005364 Bacteria 1039
55 Ga0070688_100003518 3300005365 Bacteria 8070
56 Ga0070688_100221746 3300005365 Bacteria 1333
57 Ga0070659_100419778 3300005366 Bacteria 1131
58 Ga0070667_100052134 3300005367 Bacteria 3451
59 Ga0070667_100090662 3300005367 Bacteria 2628
60 Ga0070667_100120436 3300005367 Unclassified 2282
61 Ga0070667_100226949 3300005367 Bacteria 1664
62 Ga0070701_10025305 3300005438 Bacteria 2881
63 Ga0070701_10133312 3300005438 Bacteria 1414
64 Ga0070701_10285696 3300005438 Bacteria 1009
65 Ga0070700_100004537 3300005441 Bacteria 7261
66 Ga0070700_100050536 3300005441 Bacteria 2585
67 Ga0070700_100100434 3300005441 Bacteria 1905
68 Ga0070694_100157593 3300005444 Unclassified 1663
69 Ga0070694_100319847 3300005444 Bacteria 1194
70 Ga0070694_100346226 3300005444 Bacteria 1150
71 Ga0070663_100133566 3300005455 Bacteria 1887
72 Ga0070678_100038811 3300005456 Unclassified 3355
73 Ga0070678_100044281 3300005456 Bacteria 3177
74 Ga0070678_100511096 3300005456 Bacteria 1061
75 Ga0070662_100123590 3300005457 Bacteria 1986
76 Ga0070662_100308664 3300005457 Bacteria 1287
77 Ga0068867_100044552 3300005459 Unclassified 3251
78 Ga0068867_100058210 3300005459 Bacteria 2863
79 Ga0070685_10013505 3300005466 Bacteria 4308
80 Ga0070685_10079066 3300005466 Bacteria 1967
81 Ga0070698_100071278 3300005471 Bacteria 3485
82 Ga0070698_100141145 3300005471 Bacteria 2360
83 Ga0070699_100047683 3300005518 Bacteria 3707
84 Ga0070699_100053751 3300005518 Bacteria 3485
85 Ga0070699_100463773 3300005518 Bacteria 1149
86 Ga0070672_100015831 3300005543 Bacteria 5384
87 Ga0070672_100167956 3300005543 Bacteria 1823
88 Ga0070672_100289523 3300005543 Bacteria 1386
89 Ga0070686_100030107 3300005544 Bacteria 3308
90 Ga0070686_100034631 3300005544 Bacteria 3113
91 Ga0070686_100175584 3300005544 Bacteria 1518
92 Ga0070686_100262658 3300005544 Bacteria 1266
93 Ga0070696_100031359 3300005546 Bacteria 3642
94 Ga0070665_100023796 3300005548 Bacteria 6170
95 Ga0070665_100325128 3300005548 Bacteria 1542
96 Ga0070704_100020951 3300005549 Bacteria 4228
97 Ga0070704_100144868 3300005549 Unclassified 1860
98 Ga0070664_100001309 3300005564 Bacteria 19886
99 Ga0070664_100064232 3300005564 Bacteria 3130
100 Ga0070664_100339158 3300005564 Bacteria 1365
101 Ga0070664_100399859 3300005564 Bacteria 1256
102 Ga0068852_100089400 3300005616 Bacteria 2753
103 Ga0068859_100003112 3300005617 Bacteria 16848
104 Ga0068859_100112328 3300005617 Bacteria 2788
105 Ga0068859_100317465 3300005617 Bacteria 1652
106 Ga0068864_100026815 3300005618 Bacteria 4860
107 Ga0068864_100102646 3300005618 Bacteria 2538
108 Ga0068864_100168432 3300005618 Bacteria 1996
109 Ga0068864_100179153 3300005618 Bacteria 1937
110 Ga0068864_100274232 3300005618 Bacteria 1572
111 Ga0068864_100333338 3300005618 Bacteria 1428
112 Ga0068864_100497732 3300005618 Bacteria 1172
113 Ga0068866_10106907 3300005718 Bacteria 1554
114 Ga0068861_100017974 3300005719 Bacteria 5028
115 Ga0068861_100088470 3300005719 Bacteria 2439
116 Ga0068870_10040688 3300005840 Bacteria 2412
117 Ga0068870_10055636 3300005840 Bacteria 2108
118 Ga0068863_100002257 3300005841 Bacteria 19143
119 Ga0068863_100013402 3300005841 Bacteria 7905
120 Ga0068863_100083505 3300005841 Bacteria 3027
121 Ga0068858_100051484 3300005842 Bacteria 3809
122 Ga0068858_100061988 3300005842 Bacteria 3458
123 Ga0068860_100008762 3300005843 Bacteria 10077
124 Ga0068860_100088519 3300005843 Bacteria 2947
125 Ga0068862_100005972 3300005844 Bacteria 10138
126 Ga0068862_100068813 3300005844 Bacteria 3055
127 Ga0068862_100114416 3300005844 Bacteria 2371
128 Ga0081455_10006627 3300005937 Bacteria 12385
129 Ga0081539_10000056 3300005985 Bacteria 256522
130 Ga0081539_10000722 3300005985 Bacteria 66164
131 Ga0081539_10009261 3300005985 Bacteria 8284
132 Ga0068871_100052330 3300006358 Bacteria 3307
133 Ga0068871_100086472 3300006358 Bacteria 2605
134 Ga0075428_100003449 3300006844 Bacteria 17298
135 Ga0075428_100059900 3300006844 Bacteria 4168
136 Ga0075428_100122316 3300006844 Bacteria 2833
137 Ga0075428_100523270 3300006844 Bacteria 1268
138 Ga0075430_100029256 3300006846 Bacteria 4676
139 Ga0075431_100002351 3300006847 Bacteria 18162
140 Ga0075431_100176174 3300006847 Bacteria 2196
141 Ga0075431_100280679 3300006847 Bacteria 1686
142 Ga0075433_10068598 3300006852 Bacteria 3113
143 Ga0075433_10150271 3300006852 Bacteria 2072
144 Ga0075433_10362154 3300006852 Bacteria 1281
145 Ga0075434_100005669 3300006871 Bacteria 11392
146 Ga0075434_100151582 3300006871 Bacteria 2338
147 Ga0075434_100263218 3300006871 Bacteria 1744
148 Ga0075429_100002030 3300006880 Bacteria 16848
149 Ga0075429_100055704 3300006880 Bacteria 3441
150 Ga0075429_100524740 3300006880 Bacteria 1038
151 Ga0075429_100765146 3300006880 Bacteria 846
152 Ga0068865_100014669 3300006881 Bacteria 4985
153 Ga0068865_100427252 3300006881 Bacteria 1091
154 Ga0097620_100003113 3300006931 Bacteria 16848
155 Ga0097620_100112320 3300006931 Bacteria 2788
156 Ga0097620_100222798 3300006931 Bacteria 1974
157 Ga0097620_100317461 3300006931 Bacteria 1652
158 Ga0075435_100072929 3300007076 Bacteria 2805
159 Ga0075435_100093906 3300007076 Bacteria 2479
160 Ga0075435_100306819 3300007076 Bacteria 1358
161 Ga0075435_100462561 3300007076 Bacteria 1094
162 Ga0111539_10002358 3300009094 Bacteria 25105
163 Ga0111539_10004734 3300009094 Bacteria 17780
164 Ga0111539_10019376 3300009094 Bacteria 8399
165 Ga0111539_10020640 3300009094 Bacteria 8114
166 Ga0111539_10032497 3300009094 Bacteria 6336
167 Ga0111539_10123599 3300009094 Bacteria 3033
168 Ga0114129_10009350 3300009147 Bacteria 13978
169 Ga0114129_10021003 3300009147 Bacteria 9272
170 Ga0114129_10034364 3300009147 Bacteria 7160
171 Ga0114129_10189950 3300009147 Bacteria 2790
172 Ga0114129_10258965 3300009147 Bacteria 2333
173 Ga0114129_10758713 3300009147 Bacteria 1241
174 Ga0114129_10836684 3300009147 Bacteria 1171
175 Ga0105243_10066619 3300009148 Bacteria 2897
176 Ga0105242_10007286 3300009176 Bacteria 8527
177 Ga0105242_10267193 3300009176 Bacteria 1548
178 Ga0105248_10006611 3300009177 Bacteria 12704
179 Ga0105248_10100008 3300009177 Bacteria 3267
180 Ga0105248_10292106 3300009177 Bacteria 1835
181 Ga0105248_10592362 3300009177 Bacteria 1251
182 Ga0105249_10055648 3300009553 Unclassified 3620
183 Ga0105249_10486692 3300009553 Bacteria 1277
184 Ga0157371_10101972 3300013102 Bacteria 2036
185 Ga0163162_10002897 3300013306 Bacteria 16338
186 Ga0157375_10060116 3300013308 Bacteria 3767
187 Ga0157375_10530342 3300013308 Bacteria 1340
188 Ga0163163_10000019 3300014325 Bacteria 199037
189 Ga0163163_10006508 3300014325 Bacteria 10222
190 Ga0163163_10064265 3300014325 Bacteria 3641
191 Ga0157380_10111275 3300014326 Bacteria 2302
192 Ga0157380_10126875 3300014326 Bacteria 2170
193 Ga0157377_10006696 3300014745 Bacteria 5516
194 Ga0157377_10023419 3300014745 Bacteria 3272
195 Ga0157377_10101621 3300014745 Bacteria 1714
196 Ga0157379_10027097 3300014968 Bacteria 5101
197 Ga0157376_10115866 3300014969 Bacteria 2366
198 Ga0157376_10432180 3300014969 Bacteria 1280
199 Ga0163161_10009809 3300017792 Bacteria 6634
200 Ga0163161_10167633 3300017792 Bacteria 1678
201 Ga0207697_10002011 3300025315 Bacteria 10760
202 Ga0207697_10156919 3300025315 Bacteria 991
203 Ga0207682_10000261 3300025893 Bacteria 23676
204 Ga0207682_10058446 3300025893 Bacteria 1609
205 Ga0207642_10114506 3300025899 Bacteria 1379
206 Ga0207688_10009470 3300025901 Bacteria 5303
207 Ga0207645_10000265 3300025907 Bacteria 43245
208 Ga0207645_10004655 3300025907 Bacteria 10106
209 Ga0207643_10009921 3300025908 Bacteria 5118
210 Ga0207643_10032962 3300025908 Bacteria 2897
211 Ga0207643_10062964 3300025908 Bacteria 2120
212 Ga0207643_10164425 3300025908 Bacteria 1336
213 Ga0207705_10078611 3300025909 Bacteria 2401
214 Ga0207660_10108550 3300025917 Bacteria 2084
215 Ga0207662_10030373 3300025918 Bacteria 3135
216 Ga0207681_10014602 3300025923 Bacteria 4887
217 Ga0207681_10017964 3300025923 Bacteria 4448
218 Ga0207681_10029921 3300025923 Bacteria 3545
219 Ga0207681_10037438 3300025923 Bacteria 3206
220 Ga0207681_10163262 3300025923 Bacteria 1681
221 Ga0207650_10017711 3300025925 Bacteria 4991
222 Ga0207650_10137335 3300025925 Bacteria 1919
223 Ga0207650_10138878 3300025925 Bacteria 1909
224 Ga0207659_10008346 3300025926 Bacteria 6425
225 Ga0207659_10012765 3300025926 Bacteria 5362
226 Ga0207659_10014894 3300025926 Bacteria 5027
227 Ga0207659_10027613 3300025926 Bacteria 3846
228 Ga0207659_10066363 3300025926 Bacteria 2618
229 Ga0207659_10071594 3300025926 Unclassified 2532
230 Ga0207659_10104075 3300025926 Bacteria 2146
231 Ga0207659_10119251 3300025926 Bacteria 2019
232 Ga0207659_10362209 3300025926 Bacteria 1205
233 Ga0207644_10056781 3300025931 Bacteria 2825
234 Ga0207706_10090554 3300025933 Bacteria 2689
235 Ga0207706_10476052 3300025933 Bacteria 1079
236 Ga0207709_10064737 3300025935 Bacteria 2297
237 Ga0207670_10096530 3300025936 Bacteria 2102
238 Ga0207704_10072877 3300025938 Bacteria 2185
239 Ga0207704_10110628 3300025938 Bacteria 1856
240 Ga0207691_10001814 3300025940 Bacteria 20886
241 Ga0207691_10003236 3300025940 Bacteria 15868
242 Ga0207691_10004926 3300025940 Bacteria 12887
243 Ga0207691_10039761 3300025940 Bacteria 4350
244 Ga0207691_10149615 3300025940 Bacteria 2053
245 Ga0207691_10262969 3300025940 Bacteria 1487
246 Ga0207691_10436368 3300025940 Bacteria 1115
247 Ga0207691_10665264 3300025940 Bacteria 879
248 Ga0207711_10129129 3300025941 Bacteria 2264
249 Ga0207711_10158535 3300025941 Bacteria 2047
250 Ga0207711_10194588 3300025941 Bacteria 1849
251 Ga0207689_10000555 3300025942 Bacteria 35656
252 Ga0207689_10017487 3300025942 Bacteria 6067
253 Ga0207689_10414528 3300025942 Bacteria 1123
254 Ga0207661_10112636 3300025944 Bacteria 2304
255 Ga0207679_10053615 3300025945 Bacteria 2965
256 Ga0207679_10069858 3300025945 Bacteria 2645
257 Ga0207679_10154279 3300025945 Bacteria 1873
258 Ga0207651_10000524 3300025960 Bacteria 16117
259 Ga0207651_10019450 3300025960 Bacteria 4070
260 Ga0207651_10026565 3300025960 Bacteria 3620
261 Ga0207651_10058823 3300025960 Bacteria 2658
262 Ga0207651_10167904 3300025960 Bacteria 1727
263 Ga0207651_10249600 3300025960 Bacteria 1451
264 Ga0207651_10460141 3300025960 Bacteria 1093
265 Ga0207658_10135905 3300025986 Unclassified 1982
266 Ga0207658_10147720 3300025986 Bacteria 1911
267 Ga0207677_10119142 3300026023 Bacteria 1982
268 Ga0207677_10372031 3300026023 Bacteria 1203
269 Ga0207703_10046517 3300026035 Bacteria 3495
270 Ga0207703_10075915 3300026035 Bacteria 2786
271 Ga0207703_10103449 3300026035 Bacteria 2418
272 Ga0207703_10144393 3300026035 Bacteria 2068
273 Ga0207678_10502435 3300026067 Bacteria 1057
274 Ga0207708_10010621 3300026075 Bacteria 6838
275 Ga0207708_10010674 3300026075 Bacteria 6824
276 Ga0207708_10267616 3300026075 Bacteria 1381
277 Ga0207641_10007977 3300026088 Bacteria 8774
278 Ga0207641_10453063 3300026088 Bacteria 1240
279 Ga0207648_10020970 3300026089 Bacteria 5883
280 Ga0207648_10023916 3300026089 Bacteria 5461
281 Ga0207676_10025616 3300026095 Bacteria 4377
282 Ga0207676_10061883 3300026095 Bacteria 2966
283 Ga0207676_10073838 3300026095 Bacteria 2746
284 Ga0207676_10099672 3300026095 Bacteria 2405
285 Ga0207676_10245131 3300026095 Bacteria 1610
286 Ga0207675_100004571 3300026118 Bacteria 13348
287 Ga0207675_100055336 3300026118 Bacteria 3701
288 Ga0207675_100460370 3300026118 Bacteria 1261
289 Ga0207675_100615270 3300026118 Bacteria 1090
290 Ga0207675_100896893 3300026118 Bacteria 903
291 Ga0207683_10009546 3300026121 Bacteria 8269
292 Ga0207683_10066071 3300026121 Bacteria 3189
293 Ga0207683_10126511 3300026121 Bacteria 2297
294 Ga0207683_10240085 3300026121 Bacteria 1653
295 Ga0209974_10106995 3300027876 Bacteria 982
296 Ga0207428_10001538 3300027907 Bacteria 24126
297 Ga0207428_10002136 3300027907 Bacteria 19871
298 Ga0207428_10016614 3300027907 Bacteria 6327
299 Ga0207428_10019269 3300027907 Bacteria 5818
300 Ga0207428_10150909 3300027907 Bacteria 1769
301 Ga0268266_10204795 3300028379 Bacteria 1807
302 Ga0268265_10008531 3300028380 Bacteria 6928
303 Ga0268265_10012822 3300028380 Bacteria 5691
304 Ga0268264_10075984 3300028381 Bacteria 2857
305 Ga0268264_10137478 3300028381 Bacteria 2174
306 Ga0307408_100273207 3300031548 Bacteria 1404
307 Ga0307405_10321051 3300031731 Bacteria 1183
308 Ga0307412_10061773 3300031911 Bacteria 2520
309 Ga0307409_100040195 3300031995 Bacteria 3479
310 Ga0307416_100009542 3300032002 Bacteria 6359
311 Ga0307416_100626721 3300032002 Bacteria 1158
312 Ga0373958_0017005 3300034819 Bacteria 1302
313 Ga0373940_0050691 3300035088 Bacteria 1165
314 Ga0373939_0055462 3300035114 Bacteria 1244
315 Ga0373941_0142052 3300035115 Bacteria 874
316 Ga0373960_0062350 3300035121 Bacteria 1134
317 Ga0373961_0021169 3300035241 Bacteria 1727
318 Ga0373931_0053974 3300035691 Bacteria 2146
319 Ga0373947_0075875 3300035725 Bacteria 2071
320 Ga0373925_0204396 3300037068 Bacteria 1572
321 Ga0451853_0185627 3300041512 Bacteria 970
322 Ga0439450_041125 3300042008 Bacteria 1074
323 Ga0450896_004366 3300042133 Bacteria 1916
324 Ga0439435_0004006 3300042436 Bacteria 3132
325 Ga0439444_0025509 3300042437 Bacteria 1075
326 Ga0439464_0014403 3300042439 Bacteria 2126
327 Ga0439440_0015041 3300042993 Bacteria 1678
328 Ga0451576_0088833 3300045051 Unclassified 3214
329 Ga0451576_0092914 3300045051 Bacteria 3137
330 Ga0495592_0036886 3300046454 Bacteria 3681
331 Ga0495592_0145737 3300046454 Bacteria 1642
332 Ga0495580_0307070 3300046472 Bacteria 1080
333 Ga0495584_0116929 3300046491 Bacteria 1350
334 Ga0495594_0052428 3300046499 Bacteria 2246
335 Ga0495594_0124378 3300046499 Bacteria 1459
336 Ga0495594_0299739 3300046499 Bacteria 916
337 Ga0495607_0169919 3300046501 Bacteria 1102
338 Ga0495643_0006565 3300046522 Bacteria 7652
339 Ga0495598_0030104 3300046537 Bacteria 1518
340 Ga0495621_0122296 3300046539 Bacteria 1007
341 Ga0495659_0002156 3300046664 Bacteria 6412
342 Ga0495659_0024500 3300046664 Bacteria 2059
343 Ga0495659_0065987 3300046664 Bacteria 1347
344 Ga0495588_0069298 3300046674 Bacteria 1833
345 Ga0495588_0134562 3300046674 Bacteria 1304
346 Ga0495613_0068899 3300046689 Bacteria 2580
347 Ga0495636_0090083 3300047318 Bacteria 1331
348 Ga0496108_0152880 3300048911 Bacteria 1992
349 Ga0496110_0219879 3300048913 Bacteria 1727
350 Ga0501040_0388244 3300049576 Bacteria 1002
351 Ga0501067_0030099 3300049583 Bacteria 3010
352 Ga0501079_0108963 3300049741 Bacteria 2151
353 Ga0501079_0149024 3300049741 Bacteria 1824
354 Ga0501080_0148652 3300049742 Bacteria 2166
355 Ga0501035_0138983 3300049822 Unclassified 2113
356 nmdc:mga05p37_118519_c1 3300050507 Bacteria 3253
357 nmdc:mga05p37_126016_c1 3300050507 Bacteria 3145
358 nmdc:mga05p37_184234_c1 3300050507 Bacteria 2539
359 nmdc:mga05p37_228273_c1 3300050507 Bacteria 2244
360 nmdc:mga05p37_544059_c1 3300050507 Bacteria 1323
361 nmdc:mga09592_16744_c1 3300050508 Bacteria 5999
362 nmdc:mga09592_194947_c1 3300050508 Bacteria 1754
363 nmdc:mga09592_314908_c1 3300050508 Bacteria 1356
364 nmdc:mga09592_441198_c1 3300050508 Bacteria 1123
365 nmdc:mga09592_479446_c1 3300050508 Bacteria 1072
366 nmdc:mga0qj67_1126_c1 3300050509 Bacteria 18537
367 nmdc:mga0qj67_49432_c1 3300050509 Bacteria 3324
368 nmdc:mga0qj67_79152_c1 3300050509 Bacteria 2632
369 nmdc:mga0qj67_93344_c1 3300050509 Bacteria 2420
370 nmdc:mga06r32_153431_c1 3300050510 Bacteria 2283
371 nmdc:mga06r32_368080_c1 3300050510 Bacteria 1421
372 nmdc:mga06r32_433873_c1 3300050510 Bacteria 1294
373 nmdc:mga06r32_72234_c1 3300050510 Bacteria 3341
374 nmdc:mga06r32_898272_c1 3300050510 Bacteria 842
375 nmdc:mga08y16_112018_c1 3300050511 Bacteria 2841
376 nmdc:mga08y16_151516_c1 3300050511 Bacteria 2410
377 nmdc:mga08y16_3783_c1 3300050511 Bacteria 15762
378 nmdc:mga08y16_5173_c1 3300050511 Bacteria 13621
379 nmdc:mga08y16_7557_c2 3300050511 Bacteria 3898
380 nmdc:mga08y16_7979_c1 3300050511 Bacteria 11078
381 nmdc:mga08y16_89499_c1 3300050511 Bacteria 3208
382 nmdc:mga0n895_111346_c1 3300050512 Bacteria 2754
383 nmdc:mga0n895_192315_c1 3300050512 Bacteria 2072
384 nmdc:mga0n895_4464_c1 3300050512 Bacteria 11500
385 nmdc:mga0n895_56305_c1 3300050512 Bacteria 3873
386 nmdc:mga0n895_598043_c1 3300050512 Bacteria 1106
387 nmdc:mga0rr50_205896_c1 3300050513 Bacteria 1619
388 nmdc:mga0rr50_638418_c1 3300050513 Bacteria 908
389 nmdc:mga0rr50_9994_c1 3300050513 Bacteria 6000
390 nmdc:mga08x19_430410_c1 3300050514 Bacteria 927
391 nmdc:mga0a205_26953_c1 3300050515 Bacteria 5486
392 nmdc:mga0a205_31955_c1 3300050515 Bacteria 5045
393 nmdc:mga0a205_35739_c2 3300050515 Bacteria 3849
394 nmdc:mga0a205_7830_c1 3300050515 Bacteria 9706
395 Ga0501084_0254956 3300054114 Bacteria 1481
396 Ga0501084_0398540 3300054114 Bacteria 1163
397 Ga0501082_0088461 3300060353 Bacteria 2673
398 Ga0501082_0245370 3300060353 Bacteria 1559
399 Ga0530510_0191586 3300061734 Bacteria 1518
400 Ga0207704_10381538
401 JGI25406J46586_10001300
402 JGI25406J46586_10002200
403 Ga0065707_10129017
404 Ga0070676_10029888
405 Ga0070676_10156647
406 Ga0070690_100009865
407 Ga0070690_100027677
408 Ga0070690_100122958
409 Ga0070690_100174169
410 Ga0070670_100000526
411 Ga0070677_10023114
412 Ga0068869_100000513
413 Ga0068869_100045846
414 Ga0070666_10038138
415 Ga0070666_10242028
416 Ga0070666_10300119
417 Ga0070680_100113322
418 Ga0070682_100143557
419 Ga0068868_100133775
420 Ga0068868_100145926
421 Ga0070660_100205060
422 Ga0070660_100353628
423 Ga0070689_100051319
424 Ga0070689_100158759
425 Ga0070689_100546468
426 Ga0070687_100009821
427 Ga0070668_100050490
428 Ga0070668_100389868
429 Ga0070669_100002903
430 Ga0070669_100005838
431 Ga0070669_100019921
432 Ga0070669_100022226
433 Ga0070675_100004062
434 Ga0070675_100015237
435 Ga0070675_100033477
436 Ga0070675_100039722
437 Ga0070675_100128190
438 Ga0070675_100257869
439 Ga0070675_100380046
440 Ga0070675_100381029
441 Ga0070671_100008831
442 Ga0070671_100011537
443 Ga0070671_100038354
444 Ga0070673_100006040
445 Ga0070673_100006899
446 Ga0070673_100021207
447 Ga0070673_100051378
448 Ga0070673_100066776
449 Ga0070673_100081895
450 Ga0070673_100131170
451 Ga0070673_100208176
452 Ga0070673_100361690
453 Ga0070673_100559651
454 Ga0070688_100003518
455 Ga0070688_100221746
456 Ga0070659_100419778
457 Ga0070667_100052134
458 Ga0070667_100090662
459 Ga0070667_100120436
460 Ga0070667_100226949
461 Ga0070701_10025305
462 Ga0070701_10133312
463 Ga0070701_10285696
464 Ga0070700_100004537
465 Ga0070700_100050536
466 Ga0070700_100100434
467 Ga0070694_100157593
468 Ga0070694_100319847
469 Ga0070694_100346226
470 Ga0070663_100133566
471 Ga0070678_100038811
472 Ga0070678_100044281
473 Ga0070678_100511096
474 Ga0070662_100123590
475 Ga0070662_100308664
476 Ga0068867_100044552
477 Ga0068867_100058210
478 Ga0070685_10013505
479 Ga0070685_10079066
480 Ga0070698_100071278
481 Ga0070698_100141145
482 Ga0070699_100047683
483 Ga0070699_100053751
484 Ga0070699_100463773
485 Ga0070672_100015831
486 Ga0070672_100167956
487 Ga0070672_100289523
488 Ga0070686_100030107
489 Ga0070686_100034631
490 Ga0070686_100175584
491 Ga0070686_100262658
492 Ga0070696_100031359
493 Ga0070665_100023796
494 Ga0070665_100325128
495 Ga0070704_100020951
496 Ga0070704_100144868
497 Ga0070664_100001309
498 Ga0070664_100064232
499 Ga0070664_100339158
500 Ga0070664_100399859
501 Ga0068852_100089400
502 Ga0068859_100003112
503 Ga0068859_100112328
504 Ga0068859_100317465
505 Ga0068864_100026815
506 Ga0068864_100102646
507 Ga0068864_100168432
508 Ga0068864_100179153
509 Ga0068864_100274232
510 Ga0068864_100333338
511 Ga0068864_100497732
512 Ga0068866_10106907
513 Ga0068861_100017974
514 Ga0068861_100088470
515 Ga0068870_10040688
516 Ga0068870_10055636
517 Ga0068863_100002257
518 Ga0068863_100013402
519 Ga0068863_100083505
520 Ga0068858_100051484
521 Ga0068858_100061988
522 Ga0068860_100008762
523 Ga0068860_100088519
524 Ga0068862_100005972
525 Ga0068862_100068813
526 Ga0068862_100114416
527 Ga0081455_10006627
528 Ga0081539_10000056
529 Ga0081539_10000722
530 Ga0081539_10009261
531 Ga0068871_100052330
532 Ga0068871_100086472
533 Ga0075428_100003449
534 Ga0075428_100059900
535 Ga0075428_100122316
536 Ga0075428_100523270
537 Ga0075430_100029256
538 Ga0075431_100002351
539 Ga0075431_100176174
540 Ga0075431_100280679
541 Ga0075433_10068598
542 Ga0075433_10150271
543 Ga0075433_10362154
544 Ga0075434_100005669
545 Ga0075434_100151582
546 Ga0075434_100263218
547 Ga0075429_100002030
548 Ga0075429_100055704
549 Ga0075429_100524740
550 Ga0075429_100765146
551 Ga0068865_100014669
552 Ga0068865_100427252
553 Ga0097620_100003113
554 Ga0097620_100112320
555 Ga0097620_100222798
556 Ga0097620_100317461
557 Ga0075435_100072929
558 Ga0075435_100093906
559 Ga0075435_100306819
560 Ga0075435_100462561
561 Ga0111539_10002358
562 Ga0111539_10004734
563 Ga0111539_10019376
564 Ga0111539_10020640
565 Ga0111539_10032497
566 Ga0111539_10123599
567 Ga0114129_10009350
568 Ga0114129_10021003
569 Ga0114129_10034364
570 Ga0114129_10189950
571 Ga0114129_10258965
572 Ga0114129_10758713
573 Ga0114129_10836684
574 Ga0105243_10066619
575 Ga0105242_10007286
576 Ga0105242_10267193
577 Ga0105248_10006611
578 Ga0105248_10100008
579 Ga0105248_10292106
580 Ga0105248_10592362
581 Ga0105249_10055648
582 Ga0105249_10486692
583 Ga0157371_10101972
584 Ga0163162_10002897
585 Ga0157375_10060116
586 Ga0157375_10530342
587 Ga0163163_10000019
588 Ga0163163_10006508
589 Ga0163163_10064265
590 Ga0157380_10111275
591 Ga0157380_10126875
592 Ga0157377_10006696
593 Ga0157377_10023419
594 Ga0157377_10101621
595 Ga0157379_10027097
596 Ga0157376_10115866
597 Ga0157376_10432180
598 Ga0163161_10009809
599 Ga0163161_10167633
600 Ga0207697_10002011
601 Ga0207697_10156919
602 Ga0207682_10000261
603 Ga0207682_10058446
604 Ga0207642_10114506
605 Ga0207688_10009470
606 Ga0207645_10000265
607 Ga0207645_10004655
608 Ga0207643_10009921
609 Ga0207643_10032962
610 Ga0207643_10062964
611 Ga0207643_10164425
612 Ga0207705_10078611
613 Ga0207660_10108550
614 Ga0207662_10030373
615 Ga0207681_10014602
616 Ga0207681_10017964
617 Ga0207681_10029921
618 Ga0207681_10037438
619 Ga0207681_10163262
620 Ga0207650_10017711
621 Ga0207650_10137335
622 Ga0207650_10138878
623 Ga0207659_10008346
624 Ga0207659_10012765
625 Ga0207659_10014894
626 Ga0207659_10027613
627 Ga0207659_10066363
628 Ga0207659_10071594
629 Ga0207659_10104075
630 Ga0207659_10119251
631 Ga0207659_10362209
632 Ga0207644_10056781
633 Ga0207706_10090554
634 Ga0207706_10476052
635 Ga0207709_10064737
636 Ga0207670_10096530
637 Ga0207704_10072877
638 Ga0207704_10110628
639 Ga0207691_10001814
640 Ga0207691_10003236
641 Ga0207691_10004926
642 Ga0207691_10039761
643 Ga0207691_10149615
644 Ga0207691_10262969
645 Ga0207691_10436368
646 Ga0207691_10665264
647 Ga0207711_10129129
648 Ga0207711_10158535
649 Ga0207711_10194588
650 Ga0207689_10000555
651 Ga0207689_10017487
652 Ga0207689_10414528
653 Ga0207661_10112636
654 Ga0207679_10053615
655 Ga0207679_10069858
656 Ga0207679_10154279
657 Ga0207651_10000524
658 Ga0207651_10019450
659 Ga0207651_10026565
660 Ga0207651_10058823
661 Ga0207651_10167904
662 Ga0207651_10249600
663 Ga0207651_10460141
664 Ga0207658_10135905
665 Ga0207658_10147720
666 Ga0207677_10119142
667 Ga0207677_10372031
668 Ga0207703_10046517
669 Ga0207703_10075915
670 Ga0207703_10103449
671 Ga0207703_10144393
672 Ga0207678_10502435
673 Ga0207708_10010621
674 Ga0207708_10010674
675 Ga0207708_10267616
676 Ga0207641_10007977
677 Ga0207641_10453063
678 Ga0207648_10020970
679 Ga0207648_10023916
680 Ga0207676_10025616
681 Ga0207676_10061883
682 Ga0207676_10073838
683 Ga0207676_10099672
684 Ga0207676_10245131
685 Ga0207675_100004571
686 Ga0207675_100055336
687 Ga0207675_100460370
688 Ga0207675_100615270
689 Ga0207675_100896893
690 Ga0207683_10009546
691 Ga0207683_10066071
692 Ga0207683_10126511
693 Ga0207683_10240085
694 Ga0209974_10106995
695 Ga0207428_10001538
696 Ga0207428_10002136
697 Ga0207428_10016614
698 Ga0207428_10019269
699 Ga0207428_10150909
700 Ga0268266_10204795
701 Ga0268265_10008531
702 Ga0268265_10012822
703 Ga0268264_10075984
704 Ga0268264_10137478
705 Ga0307408_100273207
706 Ga0307405_10321051
707 Ga0307412_10061773
708 Ga0307409_100040195
709 Ga0307416_100009542
710 Ga0307416_100626721
711 Ga0373958_0017005
712 Ga0373940_0050691
713 Ga0373939_0055462
714 Ga0373941_0142052
715 Ga0373960_0062350
716 Ga0373961_0021169
717 Ga0373931_0053974
718 Ga0373947_0075875
719 Ga0373925_0204396
720 Ga0451853_0185627
721 Ga0439450_041125
722 Ga0450896_004366
723 Ga0439435_0004006
724 Ga0439444_0025509
725 Ga0439464_0014403
726 Ga0439440_0015041
727 Ga0451576_0088833
728 Ga0451576_0092914
729 Ga0495592_0036886
730 Ga0495592_0145737
731 Ga0495580_0307070
732 Ga0495584_0116929
733 Ga0495594_0052428
734 Ga0495594_0124378
735 Ga0495594_0299739
736 Ga0495607_0169919
737 Ga0495643_0006565
738 Ga0495598_0030104
739 Ga0495621_0122296
740 Ga0495659_0002156
741 Ga0495659_0024500
742 Ga0495659_0065987
743 Ga0495588_0069298
744 Ga0495588_0134562
745 Ga0495613_0068899
746 Ga0495636_0090083
747 Ga0496108_0152880
748 Ga0496110_0219879
749 Ga0501040_0388244
750 Ga0501067_0030099
751 Ga0501079_0108963
752 Ga0501079_0149024
753 Ga0501080_0148652
754 Ga0501035_0138983
755 nmdc:mga05p37_118519_c1
756 nmdc:mga05p37_126016_c1
757 nmdc:mga05p37_184234_c1
758 nmdc:mga05p37_228273_c1
759 nmdc:mga05p37_544059_c1
760 nmdc:mga09592_16744_c1
761 nmdc:mga09592_194947_c1
762 nmdc:mga09592_314908_c1
763 nmdc:mga09592_441198_c1
764 nmdc:mga09592_479446_c1
765 nmdc:mga0qj67_1126_c1
766 nmdc:mga0qj67_49432_c1
767 nmdc:mga0qj67_79152_c1
768 nmdc:mga0qj67_93344_c1
769 nmdc:mga06r32_153431_c1
770 nmdc:mga06r32_368080_c1
771 nmdc:mga06r32_433873_c1
772 nmdc:mga06r32_72234_c1
773 nmdc:mga06r32_898272_c1
774 nmdc:mga08y16_112018_c1
775 nmdc:mga08y16_151516_c1
776 nmdc:mga08y16_3783_c1
777 nmdc:mga08y16_5173_c1
778 nmdc:mga08y16_7557_c2
779 nmdc:mga08y16_7979_c1
780 nmdc:mga08y16_89499_c1
781 nmdc:mga0n895_111346_c1
782 nmdc:mga0n895_192315_c1
783 nmdc:mga0n895_4464_c1
784 nmdc:mga0n895_56305_c1
785 nmdc:mga0n895_598043_c1
786 nmdc:mga0rr50_205896_c1
787 nmdc:mga0rr50_638418_c1
788 nmdc:mga0rr50_9994_c1
789 nmdc:mga08x19_430410_c1
790 nmdc:mga0a205_26953_c1
791 nmdc:mga0a205_31955_c1
792 nmdc:mga0a205_35739_c2
793 nmdc:mga0a205_7830_c1
794 Ga0501084_0254956
795 Ga0501084_0398540
796 Ga0501082_0088461
797 Ga0501082_0245370
798 Ga0530510_0191586

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

77

219

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9229 13 230
7osf-assembly1.cif.gz_B abc transporter complex nosdfyl, r-domain 1 0.9169 11 227
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9153 13 239
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9112 11 227
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9111 13 228
ID Description Score Start End Superfamily
af_P9WQL5_26_341_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9285 12 228 3.40.50.300
af_Q2FVR1_1_221_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9207 12 224 3.40.50.300
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9199 13 229 3.40.50.300
af_P0A9R7_1_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9187 13 222 3.40.50.300
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9175 8 228 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7W0NCA5-F1-model_v4 ABC transporter ATP-binding protein 0.9582 13 227 GO:0005524
GO:0016887
AF-A0A653IHJ7-F1-model_v4 ABC transporter ATP-binding protein 0.9467 13 227 GO:0005524
GO:0016887
AF-A0A2P6VUG4-F1-model_v4 ABC transporter domain-containing protein 0.9436 13 228 GO:0005524
GO:0016887
AF-A0A2S8VFI8-F1-model_v4 Multidrug ABC transporter ATP-binding protein 0.9427 14 227 GO:0005524
GO:0005886
GO:0016887
AF-A0A7W9V0L3-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9426 13 227 GO:0005524
GO:0016887
GO:0043215
GO:0046677
GO:1900753

Map