F434239
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 399 | 229 | 399 | 247 |
Family's Representative Sequence
| Representative Sequence | 3300005439|Ga0070711_100001172|Ga0070711_10000117210 |
| Length | 282 |
| Sequence | VPLAPTLSSPLFPHAGTKGELTVEISWRAVLIASVSTDPAAGVGVFAALAAGVVSFLSPCVLPLVPGYLSAVSGVSAAELNSAGWRRVLAPSLLFVASFSAIFVAEGLTATALGAAFQEHEQLLTKIAAALIIAMGVLFVLSLFVTRLNREWHVDALLARAGKGGPIVAGAAFAIAWTPCIGPTLGAILAAAALSSSAGRGAFLLAVYSAGLAIPFLLTAIAFSRMTTAFAIVKRHYQAIVATGGLILIAMGILIWTDQLTVLNAEAQRWASSVGLEFLNGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 78 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 79 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 80 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 125 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 126 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 127 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 128 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 129 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 130 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 131 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 133 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 134 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 135 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 136 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 137 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 138 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 139 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 140 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 141 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 142 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 143 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 144 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 189 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 190 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 191 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 192 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 193 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 194 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 197 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 198 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 199 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 200 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 201 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 202 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 203 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 204 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 205 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 206 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 207 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 208 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 209 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 217 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 218 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 219 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 227 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 228 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.76 |
| Nodule | 0 |
| Rhizoplane | 14.04 |
| Rhizosphere | 79.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000917 | 3300001979 | Bacteria | 13090 |
| 2 | JGI24034J26672_10001024 | 3300002239 | Bacteria | 3650 |
| 3 | JGI24751J29686_10014224 | 3300002459 | Bacteria | 1643 |
| 4 | JGI25406J46586_10031400 | 3300003203 | Bacteria | 1987 |
| 5 | Ga0070683_100010678 | 3300005329 | Bacteria | 7898 |
| 6 | Ga0070683_100019867 | 3300005329 | Bacteria | 5971 |
| 7 | Ga0070683_100050151 | 3300005329 | Bacteria | 3863 |
| 8 | Ga0070677_10000008 | 3300005333 | Bacteria | 74027 |
| 9 | Ga0070682_100000075 | 3300005337 | Bacteria | 90547 |
| 10 | Ga0070682_100027477 | 3300005337 | Bacteria | 3415 |
| 11 | Ga0068868_100000355 | 3300005338 | Bacteria | 31041 |
| 12 | Ga0068868_100067595 | 3300005338 | Bacteria | 2844 |
| 13 | Ga0070691_10000021 | 3300005341 | Bacteria | 45268 |
| 14 | Ga0070661_100001224 | 3300005344 | Bacteria | 18054 |
| 15 | Ga0070692_10142140 | 3300005345 | Bacteria | 1359 |
| 16 | Ga0070668_100367002 | 3300005347 | Bacteria | 1222 |
| 17 | Ga0070669_100424384 | 3300005353 | Bacteria | 1092 |
| 18 | Ga0070675_100000106 | 3300005354 | Bacteria | 49336 |
| 19 | Ga0070674_100000023 | 3300005356 | Bacteria | 84887 |
| 20 | Ga0070674_100026945 | 3300005356 | Bacteria | 3761 |
| 21 | Ga0070674_100479065 | 3300005356 | Bacteria | 1032 |
| 22 | Ga0070673_100018525 | 3300005364 | Bacteria | 4975 |
| 23 | Ga0070659_100187409 | 3300005366 | Bacteria | 1699 |
| 24 | Ga0070667_100001183 | 3300005367 | Bacteria | 23762 |
| 25 | Ga0070667_100087697 | 3300005367 | Bacteria | 2671 |
| 26 | Ga0070667_100383409 | 3300005367 | Bacteria | 1277 |
| 27 | Ga0070713_100000010 | 3300005436 | Bacteria | 151790 |
| 28 | Ga0070713_100537456 | 3300005436 | Bacteria | 1106 |
| 29 | Ga0070711_100001172 | 3300005439 | Bacteria | 14098 |
| 30 | Ga0070711_100042198 | 3300005439 | Bacteria | 3082 |
| 31 | Ga0070711_100059837 | 3300005439 | Bacteria | 2646 |
| 32 | Ga0070705_100217860 | 3300005440 | Unclassified | 1320 |
| 33 | Ga0070700_100069534 | 3300005441 | Bacteria | 2242 |
| 34 | Ga0070700_100267862 | 3300005441 | Bacteria | 1233 |
| 35 | Ga0070694_100323187 | 3300005444 | Bacteria | 1188 |
| 36 | Ga0070663_100548814 | 3300005455 | Bacteria | 966 |
| 37 | Ga0070678_100006315 | 3300005456 | Bacteria | 6947 |
| 38 | Ga0070662_100000061 | 3300005457 | Bacteria | 58911 |
| 39 | Ga0070681_10155391 | 3300005458 | Bacteria | 2213 |
| 40 | Ga0068867_100000226 | 3300005459 | Bacteria | 36850 |
| 41 | Ga0068867_100374088 | 3300005459 | Bacteria | 1195 |
| 42 | Ga0070685_10096978 | 3300005466 | Bacteria | 1794 |
| 43 | Ga0070707_100441334 | 3300005468 | Bacteria | 1262 |
| 44 | Ga0070679_100003330 | 3300005530 | Bacteria | 14708 |
| 45 | Ga0070684_100016434 | 3300005535 | Bacteria | 6049 |
| 46 | Ga0070684_100041903 | 3300005535 | Bacteria | 3950 |
| 47 | Ga0068853_100005071 | 3300005539 | Bacteria | 10275 |
| 48 | Ga0070672_100000001 | 3300005543 | Bacteria | 204624 |
| 49 | Ga0070686_100044247 | 3300005544 | Bacteria | 2797 |
| 50 | Ga0070695_100046786 | 3300005545 | Bacteria | 2761 |
| 51 | Ga0070695_100394284 | 3300005545 | Bacteria | 1048 |
| 52 | Ga0070693_100000087 | 3300005547 | Bacteria | 39196 |
| 53 | Ga0070665_100006209 | 3300005548 | Bacteria | 12225 |
| 54 | Ga0070665_100038810 | 3300005548 | Bacteria | 4788 |
| 55 | Ga0070665_100197775 | 3300005548 | Bacteria | 2011 |
| 56 | Ga0070665_100262082 | 3300005548 | Bacteria | 1729 |
| 57 | Ga0068855_100182443 | 3300005563 | Bacteria | 2372 |
| 58 | Ga0070664_100042970 | 3300005564 | Bacteria | 3813 |
| 59 | Ga0068854_100151094 | 3300005578 | Bacteria | 1791 |
| 60 | Ga0070702_100114647 | 3300005615 | Bacteria | 1677 |
| 61 | Ga0068852_100241003 | 3300005616 | Bacteria | 1728 |
| 62 | Ga0068864_100000031 | 3300005618 | Bacteria | 215331 |
| 63 | Ga0068866_10000008 | 3300005718 | Bacteria | 117658 |
| 64 | Ga0068866_10000195 | 3300005718 | Bacteria | 28485 |
| 65 | Ga0068863_100000022 | 3300005841 | Bacteria | 188278 |
| 66 | Ga0068858_100000097 | 3300005842 | Bacteria | 91503 |
| 67 | Ga0068858_100348730 | 3300005842 | Bacteria | 1418 |
| 68 | Ga0068858_100429704 | 3300005842 | Bacteria | 1271 |
| 69 | Ga0068860_100033508 | 3300005843 | Bacteria | 4928 |
| 70 | Ga0068862_100005896 | 3300005844 | Bacteria | 10205 |
| 71 | Ga0081455_10011586 | 3300005937 | Bacteria | 8850 |
| 72 | Ga0081455_10018012 | 3300005937 | Bacteria | 6745 |
| 73 | Ga0081455_10048656 | 3300005937 | Bacteria | 3661 |
| 74 | Ga0081455_10239456 | 3300005937 | Bacteria | 1334 |
| 75 | Ga0081540_1001342 | 3300005983 | Bacteria | 21421 |
| 76 | Ga0081540_1041691 | 3300005983 | Bacteria | 2377 |
| 77 | Ga0081539_10003769 | 3300005985 | Bacteria | 17944 |
| 78 | Ga0081539_10024258 | 3300005985 | Bacteria | 3941 |
| 79 | Ga0075365_10007570 | 3300006038 | Bacteria | 6098 |
| 80 | Ga0075365_10338027 | 3300006038 | Bacteria | 1061 |
| 81 | Ga0075365_10503674 | 3300006038 | Bacteria | 856 |
| 82 | Ga0075363_100120359 | 3300006048 | Bacteria | 1466 |
| 83 | Ga0075364_10038548 | 3300006051 | Bacteria | 3096 |
| 84 | Ga0075364_10162564 | 3300006051 | Bacteria | 1507 |
| 85 | Ga0075364_10252838 | 3300006051 | Bacteria | 1198 |
| 86 | Ga0070715_10000021 | 3300006163 | Bacteria | 119283 |
| 87 | Ga0070715_10092390 | 3300006163 | Bacteria | 1395 |
| 88 | Ga0070712_100002205 | 3300006175 | Bacteria | 11981 |
| 89 | Ga0068865_100155283 | 3300006881 | Bacteria | 1740 |
| 90 | Ga0105245_10000130 | 3300009098 | Bacteria | 72166 |
| 91 | Ga0105245_10000349 | 3300009098 | Bacteria | 43123 |
| 92 | Ga0105245_10001228 | 3300009098 | Bacteria | 23130 |
| 93 | Ga0105245_10180785 | 3300009098 | Bacteria | 2015 |
| 94 | Ga0105247_10043391 | 3300009101 | Bacteria | 2755 |
| 95 | Ga0105247_10068822 | 3300009101 | Bacteria | 2208 |
| 96 | Ga0114129_10491141 | 3300009147 | Bacteria | 1605 |
| 97 | Ga0105243_10026348 | 3300009148 | Bacteria | 4450 |
| 98 | Ga0105243_10041676 | 3300009148 | Bacteria | 3590 |
| 99 | Ga0105243_10067073 | 3300009148 | Bacteria | 2888 |
| 100 | Ga0105243_10199240 | 3300009148 | Bacteria | 1755 |
| 101 | Ga0105241_10383866 | 3300009174 | Bacteria | 1228 |
| 102 | Ga0105242_10002595 | 3300009176 | Bacteria | 14157 |
| 103 | Ga0105242_10053855 | 3300009176 | Bacteria | 3287 |
| 104 | Ga0105248_10508532 | 3300009177 | Bacteria | 1358 |
| 105 | Ga0105248_10602328 | 3300009177 | Bacteria | 1240 |
| 106 | Ga0105238_10000055 | 3300009551 | Bacteria | 139232 |
| 107 | Ga0105249_10000332 | 3300009553 | Bacteria | 47770 |
| 108 | Ga0105249_10001967 | 3300009553 | Bacteria | 17832 |
| 109 | Ga0105249_10151846 | 3300009553 | Bacteria | 2231 |
| 110 | Ga0105239_10071425 | 3300010375 | Bacteria | 3814 |
| 111 | Ga0105239_10252258 | 3300010375 | Bacteria | 1982 |
| 112 | Ga0105239_10729312 | 3300010375 | Bacteria | 1134 |
| 113 | Ga0157370_10006631 | 3300013104 | Bacteria | 12720 |
| 114 | Ga0157374_10003052 | 3300013296 | Bacteria | 14043 |
| 115 | Ga0157374_10330557 | 3300013296 | Bacteria | 1512 |
| 116 | Ga0157375_10126425 | 3300013308 | Bacteria | 2671 |
| 117 | Ga0163163_10085437 | 3300014325 | Bacteria | 3164 |
| 118 | Ga0163163_10194650 | 3300014325 | Bacteria | 2075 |
| 119 | Ga0157380_10001049 | 3300014326 | Bacteria | 17675 |
| 120 | Ga0157380_10005999 | 3300014326 | Bacteria | 8504 |
| 121 | Ga0157380_10424835 | 3300014326 | Bacteria | 1269 |
| 122 | Ga0157379_10016077 | 3300014968 | Bacteria | 6580 |
| 123 | Ga0157379_10189923 | 3300014968 | Bacteria | 1856 |
| 124 | Ga0157379_10225371 | 3300014968 | Bacteria | 1699 |
| 125 | Ga0157376_10014311 | 3300014969 | Bacteria | 5950 |
| 126 | Ga0163161_10018649 | 3300017792 | Bacteria | 4864 |
| 127 | Ga0213873_10041512 | 3300021358 | Bacteria | 1186 |
| 128 | Ga0213874_10043764 | 3300021377 | Bacteria | 1350 |
| 129 | Ga0213875_10163399 | 3300021388 | Bacteria | 1045 |
| 130 | Ga0207682_10000022 | 3300025893 | Bacteria | 62630 |
| 131 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 132 | Ga0207642_10000354 | 3300025899 | Bacteria | 13777 |
| 133 | Ga0207710_10026403 | 3300025900 | Bacteria | 2510 |
| 134 | Ga0207685_10000028 | 3300025905 | Bacteria | 97935 |
| 135 | Ga0207685_10014951 | 3300025905 | Bacteria | 2444 |
| 136 | Ga0207705_10241607 | 3300025909 | Bacteria | 1376 |
| 137 | Ga0207707_10070616 | 3300025912 | Bacteria | 3043 |
| 138 | Ga0207693_10004358 | 3300025915 | Bacteria | 11969 |
| 139 | Ga0207693_10004663 | 3300025915 | Bacteria | 11551 |
| 140 | Ga0207663_10001408 | 3300025916 | Bacteria | 11150 |
| 141 | Ga0207663_10014418 | 3300025916 | Bacteria | 4325 |
| 142 | Ga0207662_10429907 | 3300025918 | Bacteria | 900 |
| 143 | Ga0207649_10000189 | 3300025920 | Bacteria | 50504 |
| 144 | Ga0207652_10001902 | 3300025921 | Bacteria | 18086 |
| 145 | Ga0207694_10000063 | 3300025924 | Bacteria | 139700 |
| 146 | Ga0207659_10000013 | 3300025926 | Bacteria | 172742 |
| 147 | Ga0207687_10000032 | 3300025927 | Bacteria | 143196 |
| 148 | Ga0207687_10000073 | 3300025927 | Bacteria | 73917 |
| 149 | Ga0207687_10552983 | 3300025927 | Bacteria | 966 |
| 150 | Ga0207700_10000007 | 3300025928 | Bacteria | 345720 |
| 151 | Ga0207690_10113290 | 3300025932 | Bacteria | 1957 |
| 152 | Ga0207706_10000250 | 3300025933 | Bacteria | 58868 |
| 153 | Ga0207686_10000073 | 3300025934 | Bacteria | 92009 |
| 154 | Ga0207686_10043179 | 3300025934 | Bacteria | 2761 |
| 155 | Ga0207709_10009884 | 3300025935 | Bacteria | 5253 |
| 156 | Ga0207709_10120872 | 3300025935 | Bacteria | 1768 |
| 157 | Ga0207669_10000006 | 3300025937 | Bacteria | 176348 |
| 158 | Ga0207669_10000026 | 3300025937 | Bacteria | 92199 |
| 159 | Ga0207704_10129988 | 3300025938 | Bacteria | 1742 |
| 160 | Ga0207691_10000529 | 3300025940 | Bacteria | 38127 |
| 161 | Ga0207711_10194391 | 3300025941 | Bacteria | 1850 |
| 162 | Ga0207661_10004637 | 3300025944 | Bacteria | 9630 |
| 163 | Ga0207661_10007540 | 3300025944 | Bacteria | 7736 |
| 164 | Ga0207661_10030591 | 3300025944 | Bacteria | 4149 |
| 165 | Ga0207661_10121703 | 3300025944 | Bacteria | 2222 |
| 166 | Ga0207661_10773570 | 3300025944 | Bacteria | 884 |
| 167 | Ga0207679_10374393 | 3300025945 | Bacteria | 1247 |
| 168 | Ga0207667_10196092 | 3300025949 | Bacteria | 2072 |
| 169 | Ga0207651_10011357 | 3300025960 | Bacteria | 4984 |
| 170 | Ga0207712_10000058 | 3300025961 | Bacteria | 140948 |
| 171 | Ga0207712_10362554 | 3300025961 | Bacteria | 1208 |
| 172 | Ga0207668_10020527 | 3300025972 | Bacteria | 4199 |
| 173 | Ga0207668_10203221 | 3300025972 | Bacteria | 1579 |
| 174 | Ga0207640_10146641 | 3300025981 | Bacteria | 1728 |
| 175 | Ga0207658_10161558 | 3300025986 | Bacteria | 1836 |
| 176 | Ga0207658_10374104 | 3300025986 | Bacteria | 1246 |
| 177 | Ga0207677_10000263 | 3300026023 | Bacteria | 39869 |
| 178 | Ga0207677_10003506 | 3300026023 | Bacteria | 8314 |
| 179 | Ga0207677_10233099 | 3300026023 | Bacteria | 1484 |
| 180 | Ga0207703_10000103 | 3300026035 | Bacteria | 99918 |
| 181 | Ga0207703_10189675 | 3300026035 | Bacteria | 1820 |
| 182 | Ga0207703_10205199 | 3300026035 | Bacteria | 1754 |
| 183 | Ga0207703_10262184 | 3300026035 | Bacteria | 1562 |
| 184 | Ga0207639_10002685 | 3300026041 | Bacteria | 11937 |
| 185 | Ga0207678_10413350 | 3300026067 | Bacteria | 1169 |
| 186 | Ga0207708_10077251 | 3300026075 | Bacteria | 2555 |
| 187 | Ga0207708_10245681 | 3300026075 | Bacteria | 1441 |
| 188 | Ga0207702_10003521 | 3300026078 | Bacteria | 14268 |
| 189 | Ga0207641_10000016 | 3300026088 | Bacteria | 307363 |
| 190 | Ga0207641_10041404 | 3300026088 | Bacteria | 3860 |
| 191 | Ga0207648_10000907 | 3300026089 | Bacteria | 33370 |
| 192 | Ga0207648_10254189 | 3300026089 | Bacteria | 1567 |
| 193 | Ga0207676_10000031 | 3300026095 | Bacteria | 215877 |
| 194 | Ga0207698_10183326 | 3300026142 | Bacteria | 1857 |
| 195 | Ga0268266_10016366 | 3300028379 | Bacteria | 6340 |
| 196 | Ga0268266_10062779 | 3300028379 | Bacteria | 3207 |
| 197 | Ga0268266_10412716 | 3300028379 | Bacteria | 1278 |
| 198 | Ga0268265_10004309 | 3300028380 | Bacteria | 9920 |
| 199 | Ga0268264_10002136 | 3300028381 | Bacteria | 17638 |
| 200 | Ga0307409_100310458 | 3300031995 | Bacteria | 1471 |
| 201 | Ga0307409_100925038 | 3300031995 | Bacteria | 887 |
| 202 | Ga0307411_10263909 | 3300032005 | Bacteria | 1361 |
| 203 | Ga0307415_100213454 | 3300032126 | Bacteria | 1541 |
| 204 | Ga0373941_0015774 | 3300035115 | Bacteria | 2043 |
| 205 | Ga0373955_0056062 | 3300035172 | Bacteria | 2161 |
| 206 | Ga0316574_0211352 | 3300035398 | Bacteria | 1245 |
| 207 | Ga0373931_0396736 | 3300035691 | Bacteria | 873 |
| 208 | Ga0373937_0008069 | 3300036401 | Bacteria | 9135 |
| 209 | Ga0373937_0150083 | 3300036401 | Bacteria | 2183 |
| 210 | Ga0373937_0151869 | 3300036401 | Bacteria | 2170 |
| 211 | Ga0395899_0062737 | 3300037312 | Bacteria | 2736 |
| 212 | Ga0395899_0068402 | 3300037312 | Bacteria | 2604 |
| 213 | Ga0395900_0005975 | 3300037418 | Bacteria | 12709 |
| 214 | Ga0395900_0196421 | 3300037418 | Bacteria | 2044 |
| 215 | Ga0395900_0199670 | 3300037418 | Bacteria | 2024 |
| 216 | Ga0395898_0002563 | 3300037466 | Bacteria | 21298 |
| 217 | Ga0395898_0003725 | 3300037466 | Bacteria | 16905 |
| 218 | Ga0395898_0097404 | 3300037466 | Bacteria | 2825 |
| 219 | Ga0395898_0279832 | 3300037466 | Bacteria | 1591 |
| 220 | Ga0395905_0010892 | 3300037471 | Bacteria | 8806 |
| 221 | Ga0395901_0013880 | 3300038443 | Bacteria | 8196 |
| 222 | Ga0395901_0044450 | 3300038443 | Bacteria | 4607 |
| 223 | Ga0395901_0052752 | 3300038443 | Bacteria | 4227 |
| 224 | Ga0395901_0082895 | 3300038443 | Bacteria | 3351 |
| 225 | Ga0395901_0094883 | 3300038443 | Bacteria | 3126 |
| 226 | Ga0395901_0170046 | 3300038443 | Bacteria | 2287 |
| 227 | Ga0395901_0206855 | 3300038443 | Bacteria | 2055 |
| 228 | Ga0395901_0601312 | 3300038443 | Bacteria | 1109 |
| 229 | Ga0436365_0113700 | 3300039437 | Bacteria | 8878 |
| 230 | Ga0436365_1296942 | 3300039437 | Bacteria | 1300 |
| 231 | Ga0436362_0677671 | 3300039453 | Bacteria | 4157 |
| 232 | Ga0451853_1776708 | 3300041512 | Bacteria | 8267 |
| 233 | Ga0466963_0000008 | 3300044694 | Bacteria | 74916 |
| 234 | Ga0466971_0107381 | 3300044719 | Bacteria | 1286 |
| 235 | Ga0466968_0021505 | 3300044735 | Bacteria | 2614 |
| 236 | Ga0466960_0029268 | 3300044901 | Bacteria | 2527 |
| 237 | Ga0495592_0000267 | 3300046454 | Bacteria | 44729 |
| 238 | Ga0495592_0044074 | 3300046454 | Bacteria | 3335 |
| 239 | Ga0495603_0001834 | 3300046455 | Bacteria | 12525 |
| 240 | Ga0495603_0002539 | 3300046455 | Bacteria | 10746 |
| 241 | Ga0495603_0160604 | 3300046455 | Bacteria | 1304 |
| 242 | Ga0495629_0061667 | 3300046459 | Bacteria | 2621 |
| 243 | Ga0495638_0058326 | 3300046460 | Bacteria | 2392 |
| 244 | Ga0495641_0000027 | 3300046461 | Bacteria | 100420 |
| 245 | Ga0495641_0000244 | 3300046461 | Bacteria | 42830 |
| 246 | Ga0495582_0000001 | 3300046473 | Bacteria | 252434 |
| 247 | Ga0495662_0000079 | 3300046476 | Bacteria | 34644 |
| 248 | Ga0495662_0234397 | 3300046476 | Bacteria | 905 |
| 249 | Ga0495594_0000030 | 3300046499 | Bacteria | 66443 |
| 250 | Ga0495596_0040466 | 3300046500 | Bacteria | 1841 |
| 251 | Ga0495596_0160149 | 3300046500 | Bacteria | 875 |
| 252 | Ga0495608_0000641 | 3300046511 | Bacteria | 24067 |
| 253 | Ga0495610_0048641 | 3300046512 | Bacteria | 2081 |
| 254 | Ga0495616_0106979 | 3300046513 | Bacteria | 1304 |
| 255 | Ga0495618_0000091 | 3300046514 | Bacteria | 64654 |
| 256 | Ga0495620_0000211 | 3300046515 | Bacteria | 43874 |
| 257 | Ga0495628_0001838 | 3300046516 | Bacteria | 19271 |
| 258 | Ga0495628_0011426 | 3300046516 | Bacteria | 7510 |
| 259 | Ga0495630_0286274 | 3300046517 | Bacteria | 1259 |
| 260 | Ga0495630_0701719 | 3300046517 | Bacteria | 774 |
| 261 | Ga0495637_0134742 | 3300046520 | Bacteria | 941 |
| 262 | Ga0495644_0000579 | 3300046523 | Bacteria | 15352 |
| 263 | Ga0495644_0011682 | 3300046523 | Bacteria | 3381 |
| 264 | Ga0495652_0000022 | 3300046529 | Bacteria | 178368 |
| 265 | Ga0495640_0005787 | 3300046533 | Bacteria | 9816 |
| 266 | Ga0495640_0007284 | 3300046533 | Bacteria | 8716 |
| 267 | Ga0495586_0001045 | 3300046535 | Bacteria | 15626 |
| 268 | Ga0495598_0001130 | 3300046537 | Bacteria | 5144 |
| 269 | Ga0495622_0000387 | 3300046557 | Bacteria | 30369 |
| 270 | Ga0495633_0132923 | 3300046558 | Bacteria | 1151 |
| 271 | Ga0495656_0000497 | 3300046615 | Bacteria | 12860 |
| 272 | Ga0495656_0241467 | 3300046615 | Bacteria | 910 |
| 273 | Ga0495656_0287972 | 3300046615 | Bacteria | 839 |
| 274 | Ga0495668_0135127 | 3300046616 | Bacteria | 1350 |
| 275 | Ga0495634_0000031 | 3300046642 | Bacteria | 110396 |
| 276 | Ga0495634_0000381 | 3300046642 | Bacteria | 43342 |
| 277 | Ga0495634_0335247 | 3300046642 | Bacteria | 908 |
| 278 | Ga0495635_0000086 | 3300046663 | Bacteria | 55020 |
| 279 | Ga0495635_0088846 | 3300046663 | Bacteria | 2114 |
| 280 | Ga0495647_0000001 | 3300046681 | Bacteria | 222371 |
| 281 | Ga0495647_0018544 | 3300046681 | Bacteria | 2479 |
| 282 | Ga0495658_0000002 | 3300046683 | Bacteria | 309651 |
| 283 | Ga0495658_0007377 | 3300046683 | Bacteria | 5438 |
| 284 | Ga0495669_0000904 | 3300046684 | Bacteria | 12495 |
| 285 | Ga0495669_0013860 | 3300046684 | Bacteria | 3441 |
| 286 | Ga0495613_0000005 | 3300046689 | Bacteria | 222558 |
| 287 | Ga0495649_0003839 | 3300046694 | Bacteria | 9950 |
| 288 | Ga0495600_0004097 | 3300046809 | Bacteria | 8674 |
| 289 | Ga0495600_0004828 | 3300046809 | Bacteria | 8094 |
| 290 | Ga0495600_0102841 | 3300046809 | Bacteria | 1862 |
| 291 | Ga0495600_0308190 | 3300046809 | Bacteria | 998 |
| 292 | Ga0495581_0200504 | 3300047315 | Bacteria | 1167 |
| 293 | Ga0495604_0102567 | 3300047317 | Bacteria | 2100 |
| 294 | Ga0495674_0000030 | 3300047319 | Bacteria | 115975 |
| 295 | Ga0495676_0000131 | 3300047321 | Bacteria | 56689 |
| 296 | Ga0495680_0000212 | 3300047322 | Bacteria | 63418 |
| 297 | Ga0495680_0000241 | 3300047322 | Bacteria | 60168 |
| 298 | Ga0495680_0002123 | 3300047322 | Bacteria | 20590 |
| 299 | Ga0495680_0132163 | 3300047322 | Bacteria | 1833 |
| 300 | Ga0495680_0241683 | 3300047322 | Bacteria | 1282 |
| 301 | Ga0495673_0025820 | 3300047469 | Bacteria | 2816 |
| 302 | Ga0495686_0000020 | 3300047472 | Bacteria | 429191 |
| 303 | Ga0495686_0001936 | 3300047472 | Bacteria | 20622 |
| 304 | Ga0495686_0014957 | 3300047472 | Bacteria | 5322 |
| 305 | Ga0495686_0137383 | 3300047472 | Bacteria | 1445 |
| 306 | Ga0495602_0030523 | 3300048088 | Bacteria | 5111 |
| 307 | Ga0496100_0000013 | 3300048903 | Bacteria | 177476 |
| 308 | Ga0496100_0048671 | 3300048903 | Bacteria | 2737 |
| 309 | Ga0496101_0000035 | 3300048904 | Bacteria | 177237 |
| 310 | Ga0496101_0001595 | 3300048904 | Bacteria | 13624 |
| 311 | Ga0496102_0000211 | 3300048905 | Bacteria | 77793 |
| 312 | Ga0496102_0009029 | 3300048905 | Bacteria | 8555 |
| 313 | Ga0496102_0487163 | 3300048905 | Bacteria | 1155 |
| 314 | Ga0496103_0000174 | 3300048906 | Bacteria | 67124 |
| 315 | Ga0496103_0002624 | 3300048906 | Bacteria | 11263 |
| 316 | Ga0496103_0138824 | 3300048906 | Bacteria | 1554 |
| 317 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 318 | Ga0496104_0000052 | 3300048907 | Bacteria | 137286 |
| 319 | Ga0496104_0001240 | 3300048907 | Bacteria | 21960 |
| 320 | Ga0496104_0030683 | 3300048907 | Bacteria | 4996 |
| 321 | Ga0496104_0256614 | 3300048907 | Bacteria | 1661 |
| 322 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 323 | Ga0496105_0000030 | 3300048908 | Bacteria | 137325 |
| 324 | Ga0496105_0000782 | 3300048908 | Bacteria | 21486 |
| 325 | Ga0496105_0001308 | 3300048908 | Bacteria | 17427 |
| 326 | Ga0496106_0000062 | 3300048909 | Bacteria | 85769 |
| 327 | Ga0496106_0000139 | 3300048909 | Bacteria | 54238 |
| 328 | Ga0496106_0236593 | 3300048909 | Bacteria | 1459 |
| 329 | Ga0496107_0000020 | 3300048910 | Bacteria | 148990 |
| 330 | Ga0496107_0052192 | 3300048910 | Bacteria | 2949 |
| 331 | Ga0496107_0060072 | 3300048910 | Bacteria | 2751 |
| 332 | Ga0496108_0001157 | 3300048911 | Bacteria | 20581 |
| 333 | Ga0496108_0005051 | 3300048911 | Bacteria | 10660 |
| 334 | Ga0496108_0071892 | 3300048911 | Bacteria | 2919 |
| 335 | Ga0496108_0074613 | 3300048911 | Bacteria | 2864 |
| 336 | Ga0496108_0683452 | 3300048911 | Bacteria | 891 |
| 337 | Ga0496109_0000218 | 3300048912 | Bacteria | 56316 |
| 338 | Ga0496109_0000261 | 3300048912 | Bacteria | 50812 |
| 339 | Ga0496109_0004663 | 3300048912 | Bacteria | 11445 |
| 340 | Ga0496110_0062126 | 3300048913 | Bacteria | 3298 |
| 341 | Ga0496110_0069189 | 3300048913 | Bacteria | 3126 |
| 342 | Ga0496110_0144317 | 3300048913 | Bacteria | 2153 |
| 343 | Ga0496110_0686916 | 3300048913 | Bacteria | 924 |
| 344 | Ga0496110_0702475 | 3300048913 | Bacteria | 913 |
| 345 | Ga0496111_0015496 | 3300048914 | Bacteria | 5235 |
| 346 | Ga0496111_0068157 | 3300048914 | Bacteria | 2585 |
| 347 | Ga0496112_0000025 | 3300048915 | Bacteria | 146197 |
| 348 | Ga0496112_0011145 | 3300048915 | Bacteria | 8197 |
| 349 | Ga0496112_0169768 | 3300048915 | Bacteria | 2147 |
| 350 | Ga0496112_0286701 | 3300048915 | Bacteria | 1593 |
| 351 | Ga0496112_0559207 | 3300048915 | Bacteria | 1078 |
| 352 | Ga0496113_0005145 | 3300048916 | Bacteria | 8131 |
| 353 | Ga0496113_0167473 | 3300048916 | Bacteria | 1739 |
| 354 | Ga0496113_0172384 | 3300048916 | Bacteria | 1714 |
| 355 | Ga0496113_0435151 | 3300048916 | Bacteria | 1054 |
| 356 | Ga0496113_0614205 | 3300048916 | Bacteria | 870 |
| 357 | Ga0496114_0000039 | 3300048917 | Bacteria | 138486 |
| 358 | Ga0496114_0000827 | 3300048917 | Bacteria | 23217 |
| 359 | Ga0496114_0009207 | 3300048917 | Bacteria | 7830 |
| 360 | Ga0496115_0000011 | 3300048918 | Bacteria | 222529 |
| 361 | Ga0496115_0000162 | 3300048918 | Bacteria | 62522 |
| 362 | Ga0496115_0006440 | 3300048918 | Bacteria | 8604 |
| 363 | Ga0496117_0002925 | 3300048920 | Bacteria | 20664 |
| 364 | Ga0496118_0006451 | 3300048921 | Bacteria | 12887 |
| 365 | Ga0496119_0007580 | 3300048922 | Bacteria | 9737 |
| 366 | Ga0496120_0004208 | 3300048923 | Bacteria | 12289 |
| 367 | Ga0496121_0011664 | 3300048924 | Bacteria | 9714 |
| 368 | Ga0496125_0040529 | 3300048928 | Bacteria | 3994 |
| 369 | Ga0496126_0012102 | 3300048929 | Bacteria | 8857 |
| 370 | Ga0501039_0052883 | 3300049575 | Bacteria | 3142 |
| 371 | Ga0501072_0291673 | 3300049588 | Bacteria | 1297 |
| 372 | Ga0501074_0369906 | 3300049590 | Bacteria | 1017 |
| 373 | Ga0501075_0001791 | 3300049591 | Bacteria | 14133 |
| 374 | Ga0501075_0192788 | 3300049591 | Bacteria | 1554 |
| 375 | Ga0501076_0241528 | 3300049592 | Bacteria | 1478 |
| 376 | Ga0501083_0039236 | 3300049744 | Bacteria | 3216 |
| 377 | Ga0501083_0114807 | 3300049744 | Bacteria | 1768 |
| 378 | Ga0501044_0143994 | 3300049823 | Bacteria | 2370 |
| 379 | nmdc:mga00v17_204414_c1 | 3300050491 | Bacteria | 1277 |
| 380 | nmdc:mga00v17_89567_c1 | 3300050491 | Bacteria | 1931 |
| 381 | nmdc:mga0yw44_165607_c1 | 3300050492 | Bacteria | 1449 |
| 382 | nmdc:mga0yw44_46541_c1 | 3300050492 | Bacteria | 2606 |
| 383 | nmdc:mga0yw44_84924_c1 | 3300050492 | Bacteria | 1991 |
| 384 | nmdc:mga06z11_335808_c1 | 3300050494 | Bacteria | 903 |
| 385 | nmdc:mga06r32_53205_c1 | 3300050510 | Bacteria | 3878 |
| 386 | nmdc:mga0a205_113_c1 | 3300050515 | Bacteria | 30301 |
| 387 | Ga0495601_0000254 | 3300053077 | Bacteria | 28596 |
| 388 | Ga0495601_0001148 | 3300053077 | Bacteria | 14465 |
| 389 | Ga0495601_0082855 | 3300053077 | Bacteria | 2059 |
| 390 | Ga0495612_0000230 | 3300053078 | Bacteria | 23681 |
| 391 | Ga0495612_0000678 | 3300053078 | Bacteria | 13705 |
| 392 | Ga0495655_0000002 | 3300053083 | Bacteria | 312752 |
| 393 | Ga0495595_0000150 | 3300053084 | Bacteria | 27718 |
| 394 | Ga0495619_0000084 | 3300053085 | Bacteria | 70164 |
| 395 | Ga0495619_0001745 | 3300053085 | Bacteria | 14442 |
| 396 | Ga0500614_000036 | 3300053123 | Bacteria | 29472 |
| 397 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
| 398 | Ga0501084_0495010 | 3300054114 | Bacteria | 1033 |
| 399 | Ga0466962_0025970 | 3300061719 | Bacteria | 2812 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025934 | Ga0207686_10000073 | Ga0207686_1000007366 | 195 |
| 2 | 3300026088 | Ga0207641_10041404 | Ga0207641_100414043 | 195 |
| 3 | 3300046517 | Ga0495630_0701719 | Ga0495630_0701719_51_698 | 198 |
| 4 | 3300005545 | Ga0070695_100394284 | Ga0070695_1003942842 | 211 |
| 5 | 3300005341 | Ga0070691_10000021 | Ga0070691_1000002148 | 212 |
| 6 | 3300006163 | Ga0070715_10092390 | Ga0070715_100923902 | 213 |
| 7 | 3300006038 | Ga0075365_10007570 | Ga0075365_100075705 | 214 |
| 8 | 3300006051 | Ga0075364_10038548 | Ga0075364_100385482 | 214 |
| 9 | 3300046533 | Ga0495640_0005787 | Ga0495640_0005787_6107_6835 | 214 |
| 10 | 3300047319 | Ga0495674_0000030 | Ga0495674_0000030_79896_80624 | 214 |
| 11 | 3300005347 | Ga0070668_100367002 | Ga0070668_1003670022 | 215 |
| 12 | 3300025972 | Ga0207668_10203221 | Ga0207668_102032212 | 215 |
| 13 | 3300036401 | Ga0373937_0150083 | Ga0373937_0150083_1355_2113 | 216 |
| 14 | 3300046663 | Ga0495635_0088846 | Ga0495635_0088846_912_1670 | 216 |
| 15 | 3300047322 | Ga0495680_0241683 | Ga0495680_0241683_432_1190 | 216 |
| 16 | 3300053085 | Ga0495619_0001745 | Ga0495619_0001745_8589_9347 | 216 |
| 17 | 3300005459 | Ga0068867_100000226 | Ga0068867_1000002265 | 217 |
| 18 | 3300005842 | Ga0068858_100429704 | Ga0068858_1004297042 | 217 |
| 19 | 3300026035 | Ga0207703_10262184 | Ga0207703_102621842 | 217 |
| 20 | 3300026089 | Ga0207648_10000907 | Ga0207648_100009073 | 217 |
| 21 | 3300053083 | Ga0495655_0000002 | Ga0495655_0000002_266677_267399 | 217 |
| 22 | 3300053129 | Ga0500628_000001 | Ga0500628_000001_355346_356068 | 217 |
| 23 | 3300014968 | Ga0157379_10225371 | Ga0157379_102253712 | 218 |
| 24 | 3300044901 | Ga0466960_0029268 | Ga0466960_0029268_768_1529 | 219 |
| 25 | 3300046499 | Ga0495594_0000030 | Ga0495594_0000030_64634_65395 | 219 |
| 26 | 3300046615 | Ga0495656_0287972 | Ga0495656_0287972_55_777 | 219 |
| 27 | 3300047472 | Ga0495686_0014957 | Ga0495686_0014957_3757_4545 | 219 |
| 28 | 3300006038 | Ga0075365_10338027 | Ga0075365_103380272 | 221 |
| 29 | 3300021358 | Ga0213873_10041512 | Ga0213873_100415122 | 221 |
| 30 | 3300021388 | Ga0213875_10163399 | Ga0213875_101633991 | 221 |
| 31 | 3300031995 | Ga0307409_100925038 | Ga0307409_1009250382 | 221 |
| 32 | 3300039437 | Ga0436365_0113700 | Ga0436365_0113700_4314_5027 | 221 |
| 33 | 3300039453 | Ga0436362_0677671 | Ga0436362_0677671_23_736 | 221 |
| 34 | 3300049590 | Ga0501074_0369906 | Ga0501074_0369906_157_891 | 221 |
| 35 | 3300005353 | Ga0070669_100424384 | Ga0070669_1004243842 | 223 |
| 36 | 3300005615 | Ga0070702_100114647 | Ga0070702_1001146472 | 223 |
| 37 | 3300005937 | Ga0081455_10048656 | Ga0081455_100486563 | 223 |
| 38 | 3300010375 | Ga0105239_10729312 | Ga0105239_107293121 | 223 |
| 39 | 3300046809 | Ga0495600_0004097 | Ga0495600_0004097_7937_8656 | 223 |
| 40 | 3300005337 | Ga0070682_100000075 | Ga0070682_10000007575 | 224 |
| 41 | 3300005337 | Ga0070682_100027477 | Ga0070682_1000274774 | 224 |
| 42 | 3300005367 | Ga0070667_100001183 | Ga0070667_10000118317 | 224 |
| 43 | 3300005436 | Ga0070713_100000010 | Ga0070713_10000001098 | 224 |
| 44 | 3300005439 | Ga0070711_100042198 | Ga0070711_1000421983 | 224 |
| 45 | 3300005543 | Ga0070672_100000001 | Ga0070672_10000000128 | 224 |
| 46 | 3300005548 | Ga0070665_100262082 | Ga0070665_1002620822 | 224 |
| 47 | 3300005842 | Ga0068858_100348730 | Ga0068858_1003487302 | 224 |
| 48 | 3300005844 | Ga0068862_100005896 | Ga0068862_1000058967 | 224 |
| 49 | 3300005937 | Ga0081455_10018012 | Ga0081455_100180126 | 224 |
| 50 | 3300009553 | Ga0105249_10001967 | Ga0105249_1000196713 | 224 |
| 51 | 3300014969 | Ga0157376_10014311 | Ga0157376_100143115 | 224 |
| 52 | 3300025905 | Ga0207685_10014951 | Ga0207685_100149513 | 224 |
| 53 | 3300025928 | Ga0207700_10000007 | Ga0207700_10000007299 | 224 |
| 54 | 3300025940 | Ga0207691_10000529 | Ga0207691_1000052916 | 224 |
| 55 | 3300025972 | Ga0207668_10020527 | Ga0207668_100205274 | 224 |
| 56 | 3300025986 | Ga0207658_10161558 | Ga0207658_101615582 | 224 |
| 57 | 3300026035 | Ga0207703_10205199 | Ga0207703_102051992 | 224 |
| 58 | 3300028379 | Ga0268266_10412716 | Ga0268266_104127162 | 224 |
| 59 | 3300028380 | Ga0268265_10004309 | Ga0268265_100043097 | 224 |
| 60 | 3300046476 | Ga0495662_0234397 | Ga0495662_0234397_102_824 | 224 |
| 61 | 3300046642 | Ga0495634_0335247 | Ga0495634_0335247_26_748 | 224 |
| 62 | 3300048916 | Ga0496113_0614205 | Ga0496113_0614205_67_789 | 224 |
| 63 | 3300048917 | Ga0496114_0000039 | Ga0496114_0000039_95225_95947 | 224 |
| 64 | 3300048918 | Ga0496115_0000011 | Ga0496115_0000011_38989_39711 | 224 |
| 65 | 3300048918 | Ga0496115_0000162 | Ga0496115_0000162_20924_21646 | 224 |
| 66 | 3300053077 | Ga0495601_0001148 | Ga0495601_0001148_13057_13779 | 224 |
| 67 | 3300005843 | Ga0068860_100033508 | Ga0068860_1000335083 | 225 |
| 68 | 3300006163 | Ga0070715_10000021 | Ga0070715_1000002178 | 225 |
| 69 | 3300025905 | Ga0207685_10000028 | Ga0207685_1000002847 | 225 |
| 70 | 3300028381 | Ga0268264_10002136 | Ga0268264_100021365 | 225 |
| 71 | 3300038443 | Ga0395901_0082895 | Ga0395901_0082895_263_994 | 225 |
| 72 | 3300044719 | Ga0466971_0107381 | Ga0466971_0107381_238_990 | 225 |
| 73 | 3300048907 | Ga0496104_0001240 | Ga0496104_0001240_20582_21343 | 225 |
| 74 | 3300048908 | Ga0496105_0000782 | Ga0496105_0000782_13348_14109 | 225 |
| 75 | 3300053077 | Ga0495601_0082855 | Ga0495601_0082855_1175_1936 | 225 |
| 76 | 3300061719 | Ga0466962_0025970 | Ga0466962_0025970_916_1668 | 225 |
| 77 | 3300006038 | Ga0075365_10503674 | Ga0075365_105036741 | 226 |
| 78 | 3300035115 | Ga0373941_0015774 | Ga0373941_0015774_359_1087 | 226 |
| 79 | 3300046459 | Ga0495629_0061667 | Ga0495629_0061667_1154_1885 | 226 |
| 80 | 3300046461 | Ga0495641_0000244 | Ga0495641_0000244_22042_22773 | 226 |
| 81 | 3300046500 | Ga0495596_0040466 | Ga0495596_0040466_820_1551 | 226 |
| 82 | 3300046513 | Ga0495616_0106979 | Ga0495616_0106979_371_1102 | 226 |
| 83 | 3300046520 | Ga0495637_0134742 | Ga0495637_0134742_64_795 | 226 |
| 84 | 3300046523 | Ga0495644_0011682 | Ga0495644_0011682_832_1563 | 226 |
| 85 | 3300046529 | Ga0495652_0000022 | Ga0495652_0000022_29857_30585 | 226 |
| 86 | 3300046683 | Ga0495658_0007377 | Ga0495658_0007377_3829_4560 | 226 |
| 87 | 3300047469 | Ga0495673_0025820 | Ga0495673_0025820_1518_2249 | 226 |
| 88 | 3300047472 | Ga0495686_0000020 | Ga0495686_0000020_342721_343452 | 226 |
| 89 | 3300047472 | Ga0495686_0001936 | Ga0495686_0001936_5265_5996 | 226 |
| 90 | 3300047472 | Ga0495686_0137383 | Ga0495686_0137383_261_992 | 226 |
| 91 | 3300025909 | Ga0207705_10241607 | Ga0207705_102416071 | 227 |
| 92 | 3300003203 | JGI25406J46586_10031400 | JGI25406J46586_100314002 | 228 |
| 93 | 3300005338 | Ga0068868_100067595 | Ga0068868_1000675952 | 228 |
| 94 | 3300005345 | Ga0070692_10142140 | Ga0070692_101421401 | 228 |
| 95 | 3300005356 | Ga0070674_100026945 | Ga0070674_1000269454 | 228 |
| 96 | 3300005367 | Ga0070667_100383409 | Ga0070667_1003834092 | 228 |
| 97 | 3300005436 | Ga0070713_100537456 | Ga0070713_1005374561 | 228 |
| 98 | 3300005439 | Ga0070711_100059837 | Ga0070711_1000598373 | 228 |
| 99 | 3300005441 | Ga0070700_100267862 | Ga0070700_1002678621 | 228 |
| 100 | 3300005444 | Ga0070694_100323187 | Ga0070694_1003231871 | 228 |
| 101 | 3300005455 | Ga0070663_100548814 | Ga0070663_1005488142 | 228 |
| 102 | 3300005459 | Ga0068867_100374088 | Ga0068867_1003740882 | 228 |
| 103 | 3300005466 | Ga0070685_10096978 | Ga0070685_100969782 | 228 |
| 104 | 3300005468 | Ga0070707_100441334 | Ga0070707_1004413342 | 228 |
| 105 | 3300005545 | Ga0070695_100046786 | Ga0070695_1000467863 | 228 |
| 106 | 3300005548 | Ga0070665_100006209 | Ga0070665_1000062098 | 228 |
| 107 | 3300005985 | Ga0081539_10003769 | Ga0081539_1000376915 | 228 |
| 108 | 3300006881 | Ga0068865_100155283 | Ga0068865_1001552833 | 228 |
| 109 | 3300009098 | Ga0105245_10000349 | Ga0105245_1000034912 | 228 |
| 110 | 3300009101 | Ga0105247_10043391 | Ga0105247_100433913 | 228 |
| 111 | 3300009148 | Ga0105243_10026348 | Ga0105243_100263485 | 228 |
| 112 | 3300009148 | Ga0105243_10067073 | Ga0105243_100670733 | 228 |
| 113 | 3300009174 | Ga0105241_10383866 | Ga0105241_103838662 | 228 |
| 114 | 3300009177 | Ga0105248_10508532 | Ga0105248_105085322 | 228 |
| 115 | 3300009553 | Ga0105249_10151846 | Ga0105249_101518462 | 228 |
| 116 | 3300010375 | Ga0105239_10071425 | Ga0105239_100714254 | 228 |
| 117 | 3300013308 | Ga0157375_10126425 | Ga0157375_101264251 | 228 |
| 118 | 3300014325 | Ga0163163_10194650 | Ga0163163_101946503 | 228 |
| 119 | 3300014326 | Ga0157380_10424835 | Ga0157380_104248352 | 228 |
| 120 | 3300014968 | Ga0157379_10189923 | Ga0157379_101899232 | 228 |
| 121 | 3300021377 | Ga0213874_10043764 | Ga0213874_100437641 | 228 |
| 122 | 3300025900 | Ga0207710_10026403 | Ga0207710_100264033 | 228 |
| 123 | 3300025915 | Ga0207693_10004663 | Ga0207693_100046633 | 228 |
| 124 | 3300025916 | Ga0207663_10014418 | Ga0207663_100144186 | 228 |
| 125 | 3300025935 | Ga0207709_10009884 | Ga0207709_100098846 | 228 |
| 126 | 3300025938 | Ga0207704_10129988 | Ga0207704_101299883 | 228 |
| 127 | 3300025941 | Ga0207711_10194391 | Ga0207711_101943912 | 228 |
| 128 | 3300025944 | Ga0207661_10773570 | Ga0207661_107735702 | 228 |
| 129 | 3300025961 | Ga0207712_10362554 | Ga0207712_103625542 | 228 |
| 130 | 3300026023 | Ga0207677_10233099 | Ga0207677_102330991 | 228 |
| 131 | 3300026035 | Ga0207703_10189675 | Ga0207703_101896753 | 228 |
| 132 | 3300026067 | Ga0207678_10413350 | Ga0207678_104133502 | 228 |
| 133 | 3300026089 | Ga0207648_10254189 | Ga0207648_102541893 | 228 |
| 134 | 3300028379 | Ga0268266_10016366 | Ga0268266_100163663 | 228 |
| 135 | 3300035691 | Ga0373931_0396736 | Ga0373931_0396736_92_826 | 228 |
| 136 | 3300037312 | Ga0395899_0068402 | Ga0395899_0068402_1214_1948 | 228 |
| 137 | 3300037418 | Ga0395900_0005975 | Ga0395900_0005975_281_1015 | 228 |
| 138 | 3300037466 | Ga0395898_0002563 | Ga0395898_0002563_13616_14350 | 228 |
| 139 | 3300037471 | Ga0395905_0010892 | Ga0395905_0010892_152_886 | 228 |
| 140 | 3300038443 | Ga0395901_0013880 | Ga0395901_0013880_4273_5007 | 228 |
| 141 | 3300046557 | Ga0495622_0000387 | Ga0495622_0000387_23357_24118 | 228 |
| 142 | 3300048903 | Ga0496100_0048671 | Ga0496100_0048671_504_1238 | 228 |
| 143 | 3300048904 | Ga0496101_0001595 | Ga0496101_0001595_217_951 | 228 |
| 144 | 3300048905 | Ga0496102_0009029 | Ga0496102_0009029_3553_4287 | 228 |
| 145 | 3300048906 | Ga0496103_0002624 | Ga0496103_0002624_6816_7550 | 228 |
| 146 | 3300048907 | Ga0496104_0030683 | Ga0496104_0030683_1550_2284 | 228 |
| 147 | 3300048907 | Ga0496104_0256614 | Ga0496104_0256614_449_1189 | 228 |
| 148 | 3300048908 | Ga0496105_0001308 | Ga0496105_0001308_3590_4324 | 228 |
| 149 | 3300048910 | Ga0496107_0052192 | Ga0496107_0052192_1846_2580 | 228 |
| 150 | 3300048911 | Ga0496108_0071892 | Ga0496108_0071892_1822_2556 | 228 |
| 151 | 3300048912 | Ga0496109_0004663 | Ga0496109_0004663_2582_3316 | 228 |
| 152 | 3300048913 | Ga0496110_0062126 | Ga0496110_0062126_1735_2469 | 228 |
| 153 | 3300048914 | Ga0496111_0015496 | Ga0496111_0015496_1558_2292 | 228 |
| 154 | 3300048915 | Ga0496112_0011145 | Ga0496112_0011145_4618_5352 | 228 |
| 155 | 3300048917 | Ga0496114_0000827 | Ga0496114_0000827_19093_19827 | 228 |
| 156 | 3300048918 | Ga0496115_0006440 | Ga0496115_0006440_1190_1924 | 228 |
| 157 | 3300050492 | nmdc:mga0yw44_46541_c1 | nmdc:mga0yw44_46541_c1_1564_2298 | 228 |
| 158 | 3300050494 | nmdc:mga06z11_335808_c1 | nmdc:mga06z11_335808_c1_53_787 | 228 |
| 159 | 3300005367 | Ga0070667_100087697 | Ga0070667_1000876972 | 230 |
| 160 | 3300005564 | Ga0070664_100042970 | Ga0070664_1000429705 | 230 |
| 161 | 3300005985 | Ga0081539_10024258 | Ga0081539_100242583 | 230 |
| 162 | 3300009098 | Ga0105245_10180785 | Ga0105245_101807852 | 230 |
| 163 | 3300009101 | Ga0105247_10068822 | Ga0105247_100688223 | 230 |
| 164 | 3300009176 | Ga0105242_10002595 | Ga0105242_1000259513 | 230 |
| 165 | 3300009177 | Ga0105248_10602328 | Ga0105248_106023282 | 230 |
| 166 | 3300013296 | Ga0157374_10330557 | Ga0157374_103305572 | 230 |
| 167 | 3300014326 | Ga0157380_10001049 | Ga0157380_1000104912 | 230 |
| 168 | 3300025918 | Ga0207662_10429907 | Ga0207662_104299072 | 230 |
| 169 | 3300025927 | Ga0207687_10552983 | Ga0207687_105529832 | 230 |
| 170 | 3300025935 | Ga0207709_10120872 | Ga0207709_101208722 | 230 |
| 171 | 3300025945 | Ga0207679_10374393 | Ga0207679_103743932 | 230 |
| 172 | 3300025986 | Ga0207658_10374104 | Ga0207658_103741042 | 230 |
| 173 | 3300026075 | Ga0207708_10077251 | Ga0207708_100772513 | 230 |
| 174 | 3300026142 | Ga0207698_10183326 | Ga0207698_101833262 | 230 |
| 175 | 3300035398 | Ga0316574_0211352 | Ga0316574_0211352_337_1077 | 230 |
| 176 | 3300046500 | Ga0495596_0160149 | Ga0495596_0160149_17_757 | 230 |
| 177 | 3300046616 | Ga0495668_0135127 | Ga0495668_0135127_385_1125 | 230 |
| 178 | 3300048905 | Ga0496102_0000211 | Ga0496102_0000211_75139_75900 | 230 |
| 179 | 3300048906 | Ga0496103_0000174 | Ga0496103_0000174_42959_43720 | 230 |
| 180 | 3300048913 | Ga0496110_0702475 | Ga0496110_0702475_40_780 | 230 |
| 181 | 3300049744 | Ga0501083_0039236 | Ga0501083_0039236_1221_1991 | 230 |
| 182 | 3300049823 | Ga0501044_0143994 | Ga0501044_0143994_1498_2268 | 230 |
| 183 | 3300054114 | Ga0501084_0495010 | Ga0501084_0495010_131_871 | 230 |
| 184 | 3300005548 | Ga0070665_100038810 | Ga0070665_1000388102 | 231 |
| 185 | 3300009147 | Ga0114129_10491141 | Ga0114129_104911412 | 231 |
| 186 | 3300028379 | Ga0268266_10062779 | Ga0268266_100627792 | 231 |
| 187 | 3300038443 | Ga0395901_0094883 | Ga0395901_0094883_1501_2244 | 231 |
| 188 | 3300046455 | Ga0495603_0160604 | Ga0495603_0160604_91_834 | 231 |
| 189 | 3300048906 | Ga0496103_0138824 | Ga0496103_0138824_355_1116 | 231 |
| 190 | 3300048907 | Ga0496104_0000015 | Ga0496104_0000015_328575_329342 | 231 |
| 191 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_146457_147224 | 231 |
| 192 | 3300048913 | Ga0496110_0069189 | Ga0496110_0069189_2256_2999 | 231 |
| 193 | 3300048922 | Ga0496119_0007580 | Ga0496119_0007580_7196_7963 | 231 |
| 194 | 3300048923 | Ga0496120_0004208 | Ga0496120_0004208_2287_3048 | 231 |
| 195 | 3300048924 | Ga0496121_0011664 | Ga0496121_0011664_712_1473 | 231 |
| 196 | 3300048928 | Ga0496125_0040529 | Ga0496125_0040529_1197_1958 | 231 |
| 197 | 3300050510 | nmdc:mga06r32_53205_c1 | nmdc:mga06r32_53205_c1_1545_2288 | 231 |
| 198 | 3300005440 | Ga0070705_100217860 | Ga0070705_1002178602 | 232 |
| 199 | 3300005937 | Ga0081455_10011586 | Ga0081455_100115869 | 232 |
| 200 | 3300005937 | Ga0081455_10239456 | Ga0081455_102394562 | 232 |
| 201 | 3300005983 | Ga0081540_1001342 | Ga0081540_10013428 | 232 |
| 202 | 3300005983 | Ga0081540_1041691 | Ga0081540_10416912 | 232 |
| 203 | 3300006048 | Ga0075363_100120359 | Ga0075363_1001203591 | 232 |
| 204 | 3300009148 | Ga0105243_10199240 | Ga0105243_101992402 | 232 |
| 205 | 3300026023 | Ga0207677_10003506 | Ga0207677_100035066 | 232 |
| 206 | 3300031995 | Ga0307409_100310458 | Ga0307409_1003104582 | 232 |
| 207 | 3300032005 | Ga0307411_10263909 | Ga0307411_102639092 | 232 |
| 208 | 3300032126 | Ga0307415_100213454 | Ga0307415_1002134542 | 232 |
| 209 | 3300037418 | Ga0395900_0196421 | Ga0395900_0196421_871_1617 | 232 |
| 210 | 3300037466 | Ga0395898_0097404 | Ga0395898_0097404_201_947 | 232 |
| 211 | 3300038443 | Ga0395901_0052752 | Ga0395901_0052752_475_1221 | 232 |
| 212 | 3300038443 | Ga0395901_0170046 | Ga0395901_0170046_189_935 | 232 |
| 213 | 3300038443 | Ga0395901_0601312 | Ga0395901_0601312_218_964 | 232 |
| 214 | 3300046615 | Ga0495656_0241467 | Ga0495656_0241467_54_800 | 232 |
| 215 | 3300048905 | Ga0496102_0487163 | Ga0496102_0487163_38_784 | 232 |
| 216 | 3300048909 | Ga0496106_0236593 | Ga0496106_0236593_260_1006 | 232 |
| 217 | 3300048911 | Ga0496108_0683452 | Ga0496108_0683452_113_859 | 232 |
| 218 | 3300048913 | Ga0496110_0144317 | Ga0496110_0144317_1104_1850 | 232 |
| 219 | 3300048915 | Ga0496112_0559207 | Ga0496112_0559207_134_883 | 232 |
| 220 | 3300048929 | Ga0496126_0012102 | Ga0496126_0012102_3958_4713 | 232 |
| 221 | 3300006051 | Ga0075364_10162564 | Ga0075364_101625642 | 234 |
| 222 | 3300006051 | Ga0075364_10252838 | Ga0075364_102528382 | 234 |
| 223 | 3300037312 | Ga0395899_0062737 | Ga0395899_0062737_1952_2707 | 234 |
| 224 | 3300037418 | Ga0395900_0199670 | Ga0395900_0199670_973_1728 | 234 |
| 225 | 3300037466 | Ga0395898_0003725 | Ga0395898_0003725_11044_11799 | 234 |
| 226 | 3300037466 | Ga0395898_0279832 | Ga0395898_0279832_522_1277 | 234 |
| 227 | 3300038443 | Ga0395901_0044450 | Ga0395901_0044450_2545_3300 | 234 |
| 228 | 3300038443 | Ga0395901_0206855 | Ga0395901_0206855_1028_1783 | 234 |
| 229 | 3300050491 | nmdc:mga00v17_204414_c1 | nmdc:mga00v17_204414_c1_480_1232 | 234 |
| 230 | 3300050491 | nmdc:mga00v17_89567_c1 | nmdc:mga00v17_89567_c1_70_822 | 234 |
| 231 | 3300050492 | nmdc:mga0yw44_165607_c1 | nmdc:mga0yw44_165607_c1_374_1126 | 234 |
| 232 | 3300050492 | nmdc:mga0yw44_84924_c1 | nmdc:mga0yw44_84924_c1_496_1248 | 234 |
| 233 | 3300046689 | Ga0495613_0000005 | Ga0495613_0000005_35572_36327 | 235 |
| 234 | 3300048916 | Ga0496113_0435151 | Ga0496113_0435151_44_802 | 235 |
| 235 | 3300005356 | Ga0070674_100000023 | Ga0070674_10000002374 | 236 |
| 236 | 3300005364 | Ga0070673_100018525 | Ga0070673_1000185254 | 236 |
| 237 | 3300005718 | Ga0068866_10000008 | Ga0068866_1000000848 | 236 |
| 238 | 3300014325 | Ga0163163_10085437 | Ga0163163_100854374 | 236 |
| 239 | 3300025899 | Ga0207642_10000002 | Ga0207642_10000002621 | 236 |
| 240 | 3300025937 | Ga0207669_10000026 | Ga0207669_1000002681 | 236 |
| 241 | 3300025960 | Ga0207651_10011357 | Ga0207651_100113575 | 236 |
| 242 | 3300046454 | Ga0495592_0044074 | Ga0495592_0044074_808_1566 | 236 |
| 243 | 3300046455 | Ga0495603_0001834 | Ga0495603_0001834_4032_4790 | 236 |
| 244 | 3300046515 | Ga0495620_0000211 | Ga0495620_0000211_41102_41860 | 236 |
| 245 | 3300046537 | Ga0495598_0001130 | Ga0495598_0001130_2909_3667 | 236 |
| 246 | 3300046684 | Ga0495669_0013860 | Ga0495669_0013860_2065_2823 | 236 |
| 247 | 3300046809 | Ga0495600_0004828 | Ga0495600_0004828_7108_7866 | 236 |
| 248 | 3300048913 | Ga0496110_0686916 | Ga0496110_0686916_153_911 | 236 |
| 249 | 3300048914 | Ga0496111_0068157 | Ga0496111_0068157_869_1627 | 236 |
| 250 | 3300048915 | Ga0496112_0169768 | Ga0496112_0169768_404_1162 | 236 |
| 251 | 3300048915 | Ga0496112_0286701 | Ga0496112_0286701_462_1220 | 236 |
| 252 | 3300048916 | Ga0496113_0005145 | Ga0496113_0005145_2453_3211 | 236 |
| 253 | 3300048916 | Ga0496113_0172384 | Ga0496113_0172384_917_1675 | 236 |
| 254 | 3300049591 | Ga0501075_0001791 | Ga0501075_0001791_6205_6963 | 236 |
| 255 | 3300053078 | Ga0495612_0000678 | Ga0495612_0000678_5006_5764 | 236 |
| 256 | 3300002239 | JGI24034J26672_10001024 | JGI24034J26672_100010244 | 237 |
| 257 | 3300002459 | JGI24751J29686_10014224 | JGI24751J29686_100142243 | 237 |
| 258 | 3300005329 | Ga0070683_100010678 | Ga0070683_1000106785 | 237 |
| 259 | 3300005329 | Ga0070683_100019867 | Ga0070683_1000198673 | 237 |
| 260 | 3300005329 | Ga0070683_100050151 | Ga0070683_1000501512 | 237 |
| 261 | 3300005333 | Ga0070677_10000008 | Ga0070677_100000087 | 237 |
| 262 | 3300005338 | Ga0068868_100000355 | Ga0068868_10000035521 | 237 |
| 263 | 3300005344 | Ga0070661_100001224 | Ga0070661_1000012243 | 237 |
| 264 | 3300005354 | Ga0070675_100000106 | Ga0070675_1000001066 | 237 |
| 265 | 3300005366 | Ga0070659_100187409 | Ga0070659_1001874093 | 237 |
| 266 | 3300005441 | Ga0070700_100069534 | Ga0070700_1000695341 | 237 |
| 267 | 3300005456 | Ga0070678_100006315 | Ga0070678_1000063156 | 237 |
| 268 | 3300005457 | Ga0070662_100000061 | Ga0070662_10000006137 | 237 |
| 269 | 3300005458 | Ga0070681_10155391 | Ga0070681_101553912 | 237 |
| 270 | 3300005530 | Ga0070679_100003330 | Ga0070679_10000333010 | 237 |
| 271 | 3300005535 | Ga0070684_100016434 | Ga0070684_1000164346 | 237 |
| 272 | 3300005535 | Ga0070684_100041903 | Ga0070684_1000419033 | 237 |
| 273 | 3300005539 | Ga0068853_100005071 | Ga0068853_1000050717 | 237 |
| 274 | 3300005544 | Ga0070686_100044247 | Ga0070686_1000442472 | 237 |
| 275 | 3300005547 | Ga0070693_100000087 | Ga0070693_10000008711 | 237 |
| 276 | 3300005548 | Ga0070665_100197775 | Ga0070665_1001977751 | 237 |
| 277 | 3300005563 | Ga0068855_100182443 | Ga0068855_1001824432 | 237 |
| 278 | 3300005578 | Ga0068854_100151094 | Ga0068854_1001510943 | 237 |
| 279 | 3300005616 | Ga0068852_100241003 | Ga0068852_1002410032 | 237 |
| 280 | 3300005618 | Ga0068864_100000031 | Ga0068864_10000003123 | 237 |
| 281 | 3300005718 | Ga0068866_10000195 | Ga0068866_100001954 | 237 |
| 282 | 3300005841 | Ga0068863_100000022 | Ga0068863_100000022137 | 237 |
| 283 | 3300006175 | Ga0070712_100002205 | Ga0070712_10000220512 | 237 |
| 284 | 3300009098 | Ga0105245_10000130 | Ga0105245_1000013054 | 237 |
| 285 | 3300009098 | Ga0105245_10001228 | Ga0105245_1000122815 | 237 |
| 286 | 3300009148 | Ga0105243_10041676 | Ga0105243_100416765 | 237 |
| 287 | 3300009176 | Ga0105242_10053855 | Ga0105242_100538553 | 237 |
| 288 | 3300009551 | Ga0105238_10000055 | Ga0105238_1000005593 | 237 |
| 289 | 3300009553 | Ga0105249_10000332 | Ga0105249_1000033251 | 237 |
| 290 | 3300010375 | Ga0105239_10252258 | Ga0105239_102522583 | 237 |
| 291 | 3300013104 | Ga0157370_10006631 | Ga0157370_100066319 | 237 |
| 292 | 3300014326 | Ga0157380_10005999 | Ga0157380_100059994 | 237 |
| 293 | 3300014968 | Ga0157379_10016077 | Ga0157379_100160776 | 237 |
| 294 | 3300017792 | Ga0163161_10018649 | Ga0163161_100186496 | 237 |
| 295 | 3300025893 | Ga0207682_10000022 | Ga0207682_1000002251 | 237 |
| 296 | 3300025899 | Ga0207642_10000354 | Ga0207642_100003542 | 237 |
| 297 | 3300025912 | Ga0207707_10070616 | Ga0207707_100706163 | 237 |
| 298 | 3300025915 | Ga0207693_10004358 | Ga0207693_1000435811 | 237 |
| 299 | 3300025920 | Ga0207649_10000189 | Ga0207649_1000018949 | 237 |
| 300 | 3300025921 | Ga0207652_10001902 | Ga0207652_1000190214 | 237 |
| 301 | 3300025924 | Ga0207694_10000063 | Ga0207694_1000006348 | 237 |
| 302 | 3300025926 | Ga0207659_10000013 | Ga0207659_1000001321 | 237 |
| 303 | 3300025927 | Ga0207687_10000032 | Ga0207687_1000003294 | 237 |
| 304 | 3300025927 | Ga0207687_10000073 | Ga0207687_1000007351 | 237 |
| 305 | 3300025932 | Ga0207690_10113290 | Ga0207690_101132902 | 237 |
| 306 | 3300025933 | Ga0207706_10000250 | Ga0207706_1000025028 | 237 |
| 307 | 3300025934 | Ga0207686_10043179 | Ga0207686_100431793 | 237 |
| 308 | 3300025937 | Ga0207669_10000006 | Ga0207669_10000006145 | 237 |
| 309 | 3300025944 | Ga0207661_10004637 | Ga0207661_100046375 | 237 |
| 310 | 3300025944 | Ga0207661_10007540 | Ga0207661_100075405 | 237 |
| 311 | 3300025944 | Ga0207661_10030591 | Ga0207661_100305913 | 237 |
| 312 | 3300025944 | Ga0207661_10121703 | Ga0207661_101217033 | 237 |
| 313 | 3300025949 | Ga0207667_10196092 | Ga0207667_101960923 | 237 |
| 314 | 3300025961 | Ga0207712_10000058 | Ga0207712_1000005850 | 237 |
| 315 | 3300025981 | Ga0207640_10146641 | Ga0207640_101466412 | 237 |
| 316 | 3300026023 | Ga0207677_10000263 | Ga0207677_1000026321 | 237 |
| 317 | 3300026041 | Ga0207639_10002685 | Ga0207639_100026856 | 237 |
| 318 | 3300026075 | Ga0207708_10245681 | Ga0207708_102456812 | 237 |
| 319 | 3300026078 | Ga0207702_10003521 | Ga0207702_100035215 | 237 |
| 320 | 3300026088 | Ga0207641_10000016 | Ga0207641_10000016259 | 237 |
| 321 | 3300026095 | Ga0207676_10000031 | Ga0207676_1000003123 | 237 |
| 322 | 3300036401 | Ga0373937_0151869 | Ga0373937_0151869_753_1514 | 237 |
| 323 | 3300041512 | Ga0451853_1776708 | Ga0451853_1776708_6076_6837 | 237 |
| 324 | 3300044694 | Ga0466963_0000008 | Ga0466963_0000008_29243_30004 | 237 |
| 325 | 3300046454 | Ga0495592_0000267 | Ga0495592_0000267_14806_15567 | 237 |
| 326 | 3300046455 | Ga0495603_0002539 | Ga0495603_0002539_1698_2459 | 237 |
| 327 | 3300046460 | Ga0495638_0058326 | Ga0495638_0058326_83_844 | 237 |
| 328 | 3300046461 | Ga0495641_0000027 | Ga0495641_0000027_93503_94264 | 237 |
| 329 | 3300046473 | Ga0495582_0000001 | Ga0495582_0000001_143961_144722 | 237 |
| 330 | 3300046476 | Ga0495662_0000079 | Ga0495662_0000079_33495_34256 | 237 |
| 331 | 3300046511 | Ga0495608_0000641 | Ga0495608_0000641_11973_12734 | 237 |
| 332 | 3300046512 | Ga0495610_0048641 | Ga0495610_0048641_476_1237 | 237 |
| 333 | 3300046514 | Ga0495618_0000091 | Ga0495618_0000091_45409_46170 | 237 |
| 334 | 3300046516 | Ga0495628_0001838 | Ga0495628_0001838_9387_10148 | 237 |
| 335 | 3300046516 | Ga0495628_0011426 | Ga0495628_0011426_4867_5628 | 237 |
| 336 | 3300046517 | Ga0495630_0286274 | Ga0495630_0286274_468_1229 | 237 |
| 337 | 3300046523 | Ga0495644_0000579 | Ga0495644_0000579_7429_8190 | 237 |
| 338 | 3300046533 | Ga0495640_0007284 | Ga0495640_0007284_6735_7496 | 237 |
| 339 | 3300046535 | Ga0495586_0001045 | Ga0495586_0001045_8760_9521 | 237 |
| 340 | 3300046558 | Ga0495633_0132923 | Ga0495633_0132923_23_784 | 237 |
| 341 | 3300046615 | Ga0495656_0000497 | Ga0495656_0000497_4509_5270 | 237 |
| 342 | 3300046642 | Ga0495634_0000031 | Ga0495634_0000031_71311_72072 | 237 |
| 343 | 3300046642 | Ga0495634_0000381 | Ga0495634_0000381_24774_25535 | 237 |
| 344 | 3300046663 | Ga0495635_0000086 | Ga0495635_0000086_44742_45503 | 237 |
| 345 | 3300046681 | Ga0495647_0000001 | Ga0495647_0000001_175357_176118 | 237 |
| 346 | 3300046681 | Ga0495647_0018544 | Ga0495647_0018544_517_1278 | 237 |
| 347 | 3300046683 | Ga0495658_0000002 | Ga0495658_0000002_267567_268328 | 237 |
| 348 | 3300046694 | Ga0495649_0003839 | Ga0495649_0003839_5357_6118 | 237 |
| 349 | 3300046809 | Ga0495600_0308190 | Ga0495600_0308190_94_855 | 237 |
| 350 | 3300047315 | Ga0495581_0200504 | Ga0495581_0200504_82_843 | 237 |
| 351 | 3300047317 | Ga0495604_0102567 | Ga0495604_0102567_866_1627 | 237 |
| 352 | 3300047321 | Ga0495676_0000131 | Ga0495676_0000131_28169_28930 | 237 |
| 353 | 3300047322 | Ga0495680_0000212 | Ga0495680_0000212_44339_45100 | 237 |
| 354 | 3300047322 | Ga0495680_0000241 | Ga0495680_0000241_21615_22376 | 237 |
| 355 | 3300047322 | Ga0495680_0132163 | Ga0495680_0132163_1024_1785 | 237 |
| 356 | 3300048088 | Ga0495602_0030523 | Ga0495602_0030523_4298_5059 | 237 |
| 357 | 3300048907 | Ga0496104_0000052 | Ga0496104_0000052_95038_95799 | 237 |
| 358 | 3300048908 | Ga0496105_0000030 | Ga0496105_0000030_41527_42288 | 237 |
| 359 | 3300048909 | Ga0496106_0000139 | Ga0496106_0000139_8460_9221 | 237 |
| 360 | 3300048910 | Ga0496107_0060072 | Ga0496107_0060072_1149_1910 | 237 |
| 361 | 3300048911 | Ga0496108_0001157 | Ga0496108_0001157_8817_9578 | 237 |
| 362 | 3300048911 | Ga0496108_0005051 | Ga0496108_0005051_7009_7770 | 237 |
| 363 | 3300048911 | Ga0496108_0074613 | Ga0496108_0074613_1365_2126 | 237 |
| 364 | 3300048912 | Ga0496109_0000218 | Ga0496109_0000218_16880_17641 | 237 |
| 365 | 3300048912 | Ga0496109_0000261 | Ga0496109_0000261_10254_11015 | 237 |
| 366 | 3300048915 | Ga0496112_0000025 | Ga0496112_0000025_44918_45679 | 237 |
| 367 | 3300048916 | Ga0496113_0167473 | Ga0496113_0167473_724_1485 | 237 |
| 368 | 3300048917 | Ga0496114_0009207 | Ga0496114_0009207_4766_5527 | 237 |
| 369 | 3300048920 | Ga0496117_0002925 | Ga0496117_0002925_698_1459 | 237 |
| 370 | 3300048921 | Ga0496118_0006451 | Ga0496118_0006451_2869_3630 | 237 |
| 371 | 3300049575 | Ga0501039_0052883 | Ga0501039_0052883_1187_1948 | 237 |
| 372 | 3300049588 | Ga0501072_0291673 | Ga0501072_0291673_167_928 | 237 |
| 373 | 3300049591 | Ga0501075_0192788 | Ga0501075_0192788_499_1260 | 237 |
| 374 | 3300049592 | Ga0501076_0241528 | Ga0501076_0241528_277_1038 | 237 |
| 375 | 3300049744 | Ga0501083_0114807 | Ga0501083_0114807_106_867 | 237 |
| 376 | 3300050515 | nmdc:mga0a205_113_c1 | nmdc:mga0a205_113_c1_26501_27262 | 237 |
| 377 | 3300053078 | Ga0495612_0000230 | Ga0495612_0000230_20037_20798 | 237 |
| 378 | 3300053084 | Ga0495595_0000150 | Ga0495595_0000150_13931_14692 | 237 |
| 379 | 3300053085 | Ga0495619_0000084 | Ga0495619_0000084_35240_36001 | 237 |
| 380 | 3300053123 | Ga0500614_000036 | Ga0500614_000036_5572_6333 | 237 |
| 381 | 3300005356 | Ga0070674_100479065 | Ga0070674_1004790651 | 238 |
| 382 | 3300013296 | Ga0157374_10003052 | Ga0157374_100030525 | 238 |
| 383 | 3300035172 | Ga0373955_0056062 | Ga0373955_0056062_1217_1984 | 238 |
| 384 | 3300036401 | Ga0373937_0008069 | Ga0373937_0008069_6969_7736 | 238 |
| 385 | 3300039437 | Ga0436365_1296942 | Ga0436365_1296942_26_802 | 238 |
| 386 | 3300044735 | Ga0466968_0021505 | Ga0466968_0021505_931_1710 | 238 |
| 387 | 3300046684 | Ga0495669_0000904 | Ga0495669_0000904_11576_12340 | 238 |
| 388 | 3300046809 | Ga0495600_0102841 | Ga0495600_0102841_65_832 | 238 |
| 389 | 3300048903 | Ga0496100_0000013 | Ga0496100_0000013_130934_131698 | 238 |
| 390 | 3300048904 | Ga0496101_0000035 | Ga0496101_0000035_130934_131698 | 238 |
| 391 | 3300048909 | Ga0496106_0000062 | Ga0496106_0000062_39466_40230 | 238 |
| 392 | 3300048910 | Ga0496107_0000020 | Ga0496107_0000020_102083_102847 | 238 |
| 393 | 3300053077 | Ga0495601_0000254 | Ga0495601_0000254_3785_4555 | 238 |
| 394 | 3300001979 | JGI24740J21852_10000917 | JGI24740J21852_1000091714 | 239 |
| 395 | 3300005439 | Ga0070711_100001172 | Ga0070711_10000117210 | 239 |
| 396 | 3300005842 | Ga0068858_100000097 | Ga0068858_10000009740 | 239 |
| 397 | 3300025916 | Ga0207663_10001408 | Ga0207663_100014082 | 239 |
| 398 | 3300026035 | Ga0207703_10000103 | Ga0207703_1000010351 | 239 |
| 399 | 3300047322 | Ga0495680_0002123 | Ga0495680_0002123_16793_17614 | 239 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5vkv-assembly1.cif.gz_A | solution nmr structure of the membrane electron transporter ccda | 0.6021 | 17 | 217 |
| 5vkv-assembly1.cif.gz_A | solution nmr structure of the membrane electron transporter ccda | 0.4946 | 17 | 217 |
| 8ahx-assembly1.cif.gz_A | cryo-em structure of the nitrogen-fixation associated nadh:ferredoxin oxidoreductase rnf from azotobacter vinelandii | 0.4713 | 64 | 221 |
| 7xgg-assembly2.cif.gz_D | crystal structure of bcl-xl in complex with computationally designed inhibitor protein | 0.3918 | 49 | 197 |
| 8ahx-assembly1.cif.gz_A | cryo-em structure of the nitrogen-fixation associated nadh:ferredoxin oxidoreductase rnf from azotobacter vinelandii | 0.3815 | 64 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A766_4_191_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.4208 | 18 | 221 | 1.10.1760.20 |
| af_P0A766_4_191_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.4032 | 18 | 221 | 1.10.1760.20 |
| af_O44196_80_262_1.10.357.20 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain | 0.3306 | 21 | 197 | 1.10.357.20 |
| af_O44196_80_262_1.10.357.20 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain | 0.3179 | 21 | 197 | 1.10.357.20 |
| 5x9hB03 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain | 0.3178 | 19 | 198 | 1.10.357.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A498GV14-F1-model_v4 | Cytochrome c biogenesis protein CcdA | 0.7717 | 15 | 202 |
GO:0016020
GO:0017004 |
| AF-A0A2N1U2Y6-F1-model_v4 | Thioredoxin domain-containing protein | 0.7617 | 18 | 205 |
GO:0005886
GO:0015035 GO:0017004 GO:0045454 |
| AF-A0A2H5WRG9-F1-model_v4 | Thiol:disulfide interchange protein DsbD (EC 1.8.1.8) | 0.7558 | 18 | 198 |
GO:0005886
GO:0017004 GO:0045454 GO:0047134 |
| AF-A0A7K4C433-F1-model_v4 | deleted | 0.7515 | 17 | 202 |
|
| AF-A0A545B8E6-F1-model_v4 | Protein-disulfide reductase DsbD (EC 1.8.1.8) | 0.7514 | 17 | 203 |
GO:0005886
GO:0017004 GO:0045454 GO:0047134 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar