F434239

General Info

Members Datasets Scaffolds Average Seq Length
399 229 399 247

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100001172|Ga0070711_10000117210
Length 282
Sequence VPLAPTLSSPLFPHAGTKGELTVEISWRAVLIASVSTDPAAGVGVFAALAAGVVSFLSPCVLPLVPGYLSAVSGVSAAELNSAGWRRVLAPSLLFVASFSAIFVAEGLTATALGAAFQEHEQLLTKIAAALIIAMGVLFVLSLFVTRLNREWHVDALLARAGKGGPIVAGAAFAIAWTPCIGPTLGAILAAAALSSSAGRGAFLLAVYSAGLAIPFLLTAIAFSRMTTAFAIVKRHYQAIVATGGLILIAMGILIWTDQLTVLNAEAQRWASSVGLEFLNGV

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
78 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
161 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
166 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
227 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.76
Nodule 0
Rhizoplane 14.04
Rhizosphere 79.2
Stem 0
Stem Tuber 0
Unclassified 3.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000917 3300001979 Bacteria 13090
2 JGI24034J26672_10001024 3300002239 Bacteria 3650
3 JGI24751J29686_10014224 3300002459 Bacteria 1643
4 JGI25406J46586_10031400 3300003203 Bacteria 1987
5 Ga0070683_100010678 3300005329 Bacteria 7898
6 Ga0070683_100019867 3300005329 Bacteria 5971
7 Ga0070683_100050151 3300005329 Bacteria 3863
8 Ga0070677_10000008 3300005333 Bacteria 74027
9 Ga0070682_100000075 3300005337 Bacteria 90547
10 Ga0070682_100027477 3300005337 Bacteria 3415
11 Ga0068868_100000355 3300005338 Bacteria 31041
12 Ga0068868_100067595 3300005338 Bacteria 2844
13 Ga0070691_10000021 3300005341 Bacteria 45268
14 Ga0070661_100001224 3300005344 Bacteria 18054
15 Ga0070692_10142140 3300005345 Bacteria 1359
16 Ga0070668_100367002 3300005347 Bacteria 1222
17 Ga0070669_100424384 3300005353 Bacteria 1092
18 Ga0070675_100000106 3300005354 Bacteria 49336
19 Ga0070674_100000023 3300005356 Bacteria 84887
20 Ga0070674_100026945 3300005356 Bacteria 3761
21 Ga0070674_100479065 3300005356 Bacteria 1032
22 Ga0070673_100018525 3300005364 Bacteria 4975
23 Ga0070659_100187409 3300005366 Bacteria 1699
24 Ga0070667_100001183 3300005367 Bacteria 23762
25 Ga0070667_100087697 3300005367 Bacteria 2671
26 Ga0070667_100383409 3300005367 Bacteria 1277
27 Ga0070713_100000010 3300005436 Bacteria 151790
28 Ga0070713_100537456 3300005436 Bacteria 1106
29 Ga0070711_100001172 3300005439 Bacteria 14098
30 Ga0070711_100042198 3300005439 Bacteria 3082
31 Ga0070711_100059837 3300005439 Bacteria 2646
32 Ga0070705_100217860 3300005440 Unclassified 1320
33 Ga0070700_100069534 3300005441 Bacteria 2242
34 Ga0070700_100267862 3300005441 Bacteria 1233
35 Ga0070694_100323187 3300005444 Bacteria 1188
36 Ga0070663_100548814 3300005455 Bacteria 966
37 Ga0070678_100006315 3300005456 Bacteria 6947
38 Ga0070662_100000061 3300005457 Bacteria 58911
39 Ga0070681_10155391 3300005458 Bacteria 2213
40 Ga0068867_100000226 3300005459 Bacteria 36850
41 Ga0068867_100374088 3300005459 Bacteria 1195
42 Ga0070685_10096978 3300005466 Bacteria 1794
43 Ga0070707_100441334 3300005468 Bacteria 1262
44 Ga0070679_100003330 3300005530 Bacteria 14708
45 Ga0070684_100016434 3300005535 Bacteria 6049
46 Ga0070684_100041903 3300005535 Bacteria 3950
47 Ga0068853_100005071 3300005539 Bacteria 10275
48 Ga0070672_100000001 3300005543 Bacteria 204624
49 Ga0070686_100044247 3300005544 Bacteria 2797
50 Ga0070695_100046786 3300005545 Bacteria 2761
51 Ga0070695_100394284 3300005545 Bacteria 1048
52 Ga0070693_100000087 3300005547 Bacteria 39196
53 Ga0070665_100006209 3300005548 Bacteria 12225
54 Ga0070665_100038810 3300005548 Bacteria 4788
55 Ga0070665_100197775 3300005548 Bacteria 2011
56 Ga0070665_100262082 3300005548 Bacteria 1729
57 Ga0068855_100182443 3300005563 Bacteria 2372
58 Ga0070664_100042970 3300005564 Bacteria 3813
59 Ga0068854_100151094 3300005578 Bacteria 1791
60 Ga0070702_100114647 3300005615 Bacteria 1677
61 Ga0068852_100241003 3300005616 Bacteria 1728
62 Ga0068864_100000031 3300005618 Bacteria 215331
63 Ga0068866_10000008 3300005718 Bacteria 117658
64 Ga0068866_10000195 3300005718 Bacteria 28485
65 Ga0068863_100000022 3300005841 Bacteria 188278
66 Ga0068858_100000097 3300005842 Bacteria 91503
67 Ga0068858_100348730 3300005842 Bacteria 1418
68 Ga0068858_100429704 3300005842 Bacteria 1271
69 Ga0068860_100033508 3300005843 Bacteria 4928
70 Ga0068862_100005896 3300005844 Bacteria 10205
71 Ga0081455_10011586 3300005937 Bacteria 8850
72 Ga0081455_10018012 3300005937 Bacteria 6745
73 Ga0081455_10048656 3300005937 Bacteria 3661
74 Ga0081455_10239456 3300005937 Bacteria 1334
75 Ga0081540_1001342 3300005983 Bacteria 21421
76 Ga0081540_1041691 3300005983 Bacteria 2377
77 Ga0081539_10003769 3300005985 Bacteria 17944
78 Ga0081539_10024258 3300005985 Bacteria 3941
79 Ga0075365_10007570 3300006038 Bacteria 6098
80 Ga0075365_10338027 3300006038 Bacteria 1061
81 Ga0075365_10503674 3300006038 Bacteria 856
82 Ga0075363_100120359 3300006048 Bacteria 1466
83 Ga0075364_10038548 3300006051 Bacteria 3096
84 Ga0075364_10162564 3300006051 Bacteria 1507
85 Ga0075364_10252838 3300006051 Bacteria 1198
86 Ga0070715_10000021 3300006163 Bacteria 119283
87 Ga0070715_10092390 3300006163 Bacteria 1395
88 Ga0070712_100002205 3300006175 Bacteria 11981
89 Ga0068865_100155283 3300006881 Bacteria 1740
90 Ga0105245_10000130 3300009098 Bacteria 72166
91 Ga0105245_10000349 3300009098 Bacteria 43123
92 Ga0105245_10001228 3300009098 Bacteria 23130
93 Ga0105245_10180785 3300009098 Bacteria 2015
94 Ga0105247_10043391 3300009101 Bacteria 2755
95 Ga0105247_10068822 3300009101 Bacteria 2208
96 Ga0114129_10491141 3300009147 Bacteria 1605
97 Ga0105243_10026348 3300009148 Bacteria 4450
98 Ga0105243_10041676 3300009148 Bacteria 3590
99 Ga0105243_10067073 3300009148 Bacteria 2888
100 Ga0105243_10199240 3300009148 Bacteria 1755
101 Ga0105241_10383866 3300009174 Bacteria 1228
102 Ga0105242_10002595 3300009176 Bacteria 14157
103 Ga0105242_10053855 3300009176 Bacteria 3287
104 Ga0105248_10508532 3300009177 Bacteria 1358
105 Ga0105248_10602328 3300009177 Bacteria 1240
106 Ga0105238_10000055 3300009551 Bacteria 139232
107 Ga0105249_10000332 3300009553 Bacteria 47770
108 Ga0105249_10001967 3300009553 Bacteria 17832
109 Ga0105249_10151846 3300009553 Bacteria 2231
110 Ga0105239_10071425 3300010375 Bacteria 3814
111 Ga0105239_10252258 3300010375 Bacteria 1982
112 Ga0105239_10729312 3300010375 Bacteria 1134
113 Ga0157370_10006631 3300013104 Bacteria 12720
114 Ga0157374_10003052 3300013296 Bacteria 14043
115 Ga0157374_10330557 3300013296 Bacteria 1512
116 Ga0157375_10126425 3300013308 Bacteria 2671
117 Ga0163163_10085437 3300014325 Bacteria 3164
118 Ga0163163_10194650 3300014325 Bacteria 2075
119 Ga0157380_10001049 3300014326 Bacteria 17675
120 Ga0157380_10005999 3300014326 Bacteria 8504
121 Ga0157380_10424835 3300014326 Bacteria 1269
122 Ga0157379_10016077 3300014968 Bacteria 6580
123 Ga0157379_10189923 3300014968 Bacteria 1856
124 Ga0157379_10225371 3300014968 Bacteria 1699
125 Ga0157376_10014311 3300014969 Bacteria 5950
126 Ga0163161_10018649 3300017792 Bacteria 4864
127 Ga0213873_10041512 3300021358 Bacteria 1186
128 Ga0213874_10043764 3300021377 Bacteria 1350
129 Ga0213875_10163399 3300021388 Bacteria 1045
130 Ga0207682_10000022 3300025893 Bacteria 62630
131 Ga0207642_10000002 3300025899 Bacteria 658166
132 Ga0207642_10000354 3300025899 Bacteria 13777
133 Ga0207710_10026403 3300025900 Bacteria 2510
134 Ga0207685_10000028 3300025905 Bacteria 97935
135 Ga0207685_10014951 3300025905 Bacteria 2444
136 Ga0207705_10241607 3300025909 Bacteria 1376
137 Ga0207707_10070616 3300025912 Bacteria 3043
138 Ga0207693_10004358 3300025915 Bacteria 11969
139 Ga0207693_10004663 3300025915 Bacteria 11551
140 Ga0207663_10001408 3300025916 Bacteria 11150
141 Ga0207663_10014418 3300025916 Bacteria 4325
142 Ga0207662_10429907 3300025918 Bacteria 900
143 Ga0207649_10000189 3300025920 Bacteria 50504
144 Ga0207652_10001902 3300025921 Bacteria 18086
145 Ga0207694_10000063 3300025924 Bacteria 139700
146 Ga0207659_10000013 3300025926 Bacteria 172742
147 Ga0207687_10000032 3300025927 Bacteria 143196
148 Ga0207687_10000073 3300025927 Bacteria 73917
149 Ga0207687_10552983 3300025927 Bacteria 966
150 Ga0207700_10000007 3300025928 Bacteria 345720
151 Ga0207690_10113290 3300025932 Bacteria 1957
152 Ga0207706_10000250 3300025933 Bacteria 58868
153 Ga0207686_10000073 3300025934 Bacteria 92009
154 Ga0207686_10043179 3300025934 Bacteria 2761
155 Ga0207709_10009884 3300025935 Bacteria 5253
156 Ga0207709_10120872 3300025935 Bacteria 1768
157 Ga0207669_10000006 3300025937 Bacteria 176348
158 Ga0207669_10000026 3300025937 Bacteria 92199
159 Ga0207704_10129988 3300025938 Bacteria 1742
160 Ga0207691_10000529 3300025940 Bacteria 38127
161 Ga0207711_10194391 3300025941 Bacteria 1850
162 Ga0207661_10004637 3300025944 Bacteria 9630
163 Ga0207661_10007540 3300025944 Bacteria 7736
164 Ga0207661_10030591 3300025944 Bacteria 4149
165 Ga0207661_10121703 3300025944 Bacteria 2222
166 Ga0207661_10773570 3300025944 Bacteria 884
167 Ga0207679_10374393 3300025945 Bacteria 1247
168 Ga0207667_10196092 3300025949 Bacteria 2072
169 Ga0207651_10011357 3300025960 Bacteria 4984
170 Ga0207712_10000058 3300025961 Bacteria 140948
171 Ga0207712_10362554 3300025961 Bacteria 1208
172 Ga0207668_10020527 3300025972 Bacteria 4199
173 Ga0207668_10203221 3300025972 Bacteria 1579
174 Ga0207640_10146641 3300025981 Bacteria 1728
175 Ga0207658_10161558 3300025986 Bacteria 1836
176 Ga0207658_10374104 3300025986 Bacteria 1246
177 Ga0207677_10000263 3300026023 Bacteria 39869
178 Ga0207677_10003506 3300026023 Bacteria 8314
179 Ga0207677_10233099 3300026023 Bacteria 1484
180 Ga0207703_10000103 3300026035 Bacteria 99918
181 Ga0207703_10189675 3300026035 Bacteria 1820
182 Ga0207703_10205199 3300026035 Bacteria 1754
183 Ga0207703_10262184 3300026035 Bacteria 1562
184 Ga0207639_10002685 3300026041 Bacteria 11937
185 Ga0207678_10413350 3300026067 Bacteria 1169
186 Ga0207708_10077251 3300026075 Bacteria 2555
187 Ga0207708_10245681 3300026075 Bacteria 1441
188 Ga0207702_10003521 3300026078 Bacteria 14268
189 Ga0207641_10000016 3300026088 Bacteria 307363
190 Ga0207641_10041404 3300026088 Bacteria 3860
191 Ga0207648_10000907 3300026089 Bacteria 33370
192 Ga0207648_10254189 3300026089 Bacteria 1567
193 Ga0207676_10000031 3300026095 Bacteria 215877
194 Ga0207698_10183326 3300026142 Bacteria 1857
195 Ga0268266_10016366 3300028379 Bacteria 6340
196 Ga0268266_10062779 3300028379 Bacteria 3207
197 Ga0268266_10412716 3300028379 Bacteria 1278
198 Ga0268265_10004309 3300028380 Bacteria 9920
199 Ga0268264_10002136 3300028381 Bacteria 17638
200 Ga0307409_100310458 3300031995 Bacteria 1471
201 Ga0307409_100925038 3300031995 Bacteria 887
202 Ga0307411_10263909 3300032005 Bacteria 1361
203 Ga0307415_100213454 3300032126 Bacteria 1541
204 Ga0373941_0015774 3300035115 Bacteria 2043
205 Ga0373955_0056062 3300035172 Bacteria 2161
206 Ga0316574_0211352 3300035398 Bacteria 1245
207 Ga0373931_0396736 3300035691 Bacteria 873
208 Ga0373937_0008069 3300036401 Bacteria 9135
209 Ga0373937_0150083 3300036401 Bacteria 2183
210 Ga0373937_0151869 3300036401 Bacteria 2170
211 Ga0395899_0062737 3300037312 Bacteria 2736
212 Ga0395899_0068402 3300037312 Bacteria 2604
213 Ga0395900_0005975 3300037418 Bacteria 12709
214 Ga0395900_0196421 3300037418 Bacteria 2044
215 Ga0395900_0199670 3300037418 Bacteria 2024
216 Ga0395898_0002563 3300037466 Bacteria 21298
217 Ga0395898_0003725 3300037466 Bacteria 16905
218 Ga0395898_0097404 3300037466 Bacteria 2825
219 Ga0395898_0279832 3300037466 Bacteria 1591
220 Ga0395905_0010892 3300037471 Bacteria 8806
221 Ga0395901_0013880 3300038443 Bacteria 8196
222 Ga0395901_0044450 3300038443 Bacteria 4607
223 Ga0395901_0052752 3300038443 Bacteria 4227
224 Ga0395901_0082895 3300038443 Bacteria 3351
225 Ga0395901_0094883 3300038443 Bacteria 3126
226 Ga0395901_0170046 3300038443 Bacteria 2287
227 Ga0395901_0206855 3300038443 Bacteria 2055
228 Ga0395901_0601312 3300038443 Bacteria 1109
229 Ga0436365_0113700 3300039437 Bacteria 8878
230 Ga0436365_1296942 3300039437 Bacteria 1300
231 Ga0436362_0677671 3300039453 Bacteria 4157
232 Ga0451853_1776708 3300041512 Bacteria 8267
233 Ga0466963_0000008 3300044694 Bacteria 74916
234 Ga0466971_0107381 3300044719 Bacteria 1286
235 Ga0466968_0021505 3300044735 Bacteria 2614
236 Ga0466960_0029268 3300044901 Bacteria 2527
237 Ga0495592_0000267 3300046454 Bacteria 44729
238 Ga0495592_0044074 3300046454 Bacteria 3335
239 Ga0495603_0001834 3300046455 Bacteria 12525
240 Ga0495603_0002539 3300046455 Bacteria 10746
241 Ga0495603_0160604 3300046455 Bacteria 1304
242 Ga0495629_0061667 3300046459 Bacteria 2621
243 Ga0495638_0058326 3300046460 Bacteria 2392
244 Ga0495641_0000027 3300046461 Bacteria 100420
245 Ga0495641_0000244 3300046461 Bacteria 42830
246 Ga0495582_0000001 3300046473 Bacteria 252434
247 Ga0495662_0000079 3300046476 Bacteria 34644
248 Ga0495662_0234397 3300046476 Bacteria 905
249 Ga0495594_0000030 3300046499 Bacteria 66443
250 Ga0495596_0040466 3300046500 Bacteria 1841
251 Ga0495596_0160149 3300046500 Bacteria 875
252 Ga0495608_0000641 3300046511 Bacteria 24067
253 Ga0495610_0048641 3300046512 Bacteria 2081
254 Ga0495616_0106979 3300046513 Bacteria 1304
255 Ga0495618_0000091 3300046514 Bacteria 64654
256 Ga0495620_0000211 3300046515 Bacteria 43874
257 Ga0495628_0001838 3300046516 Bacteria 19271
258 Ga0495628_0011426 3300046516 Bacteria 7510
259 Ga0495630_0286274 3300046517 Bacteria 1259
260 Ga0495630_0701719 3300046517 Bacteria 774
261 Ga0495637_0134742 3300046520 Bacteria 941
262 Ga0495644_0000579 3300046523 Bacteria 15352
263 Ga0495644_0011682 3300046523 Bacteria 3381
264 Ga0495652_0000022 3300046529 Bacteria 178368
265 Ga0495640_0005787 3300046533 Bacteria 9816
266 Ga0495640_0007284 3300046533 Bacteria 8716
267 Ga0495586_0001045 3300046535 Bacteria 15626
268 Ga0495598_0001130 3300046537 Bacteria 5144
269 Ga0495622_0000387 3300046557 Bacteria 30369
270 Ga0495633_0132923 3300046558 Bacteria 1151
271 Ga0495656_0000497 3300046615 Bacteria 12860
272 Ga0495656_0241467 3300046615 Bacteria 910
273 Ga0495656_0287972 3300046615 Bacteria 839
274 Ga0495668_0135127 3300046616 Bacteria 1350
275 Ga0495634_0000031 3300046642 Bacteria 110396
276 Ga0495634_0000381 3300046642 Bacteria 43342
277 Ga0495634_0335247 3300046642 Bacteria 908
278 Ga0495635_0000086 3300046663 Bacteria 55020
279 Ga0495635_0088846 3300046663 Bacteria 2114
280 Ga0495647_0000001 3300046681 Bacteria 222371
281 Ga0495647_0018544 3300046681 Bacteria 2479
282 Ga0495658_0000002 3300046683 Bacteria 309651
283 Ga0495658_0007377 3300046683 Bacteria 5438
284 Ga0495669_0000904 3300046684 Bacteria 12495
285 Ga0495669_0013860 3300046684 Bacteria 3441
286 Ga0495613_0000005 3300046689 Bacteria 222558
287 Ga0495649_0003839 3300046694 Bacteria 9950
288 Ga0495600_0004097 3300046809 Bacteria 8674
289 Ga0495600_0004828 3300046809 Bacteria 8094
290 Ga0495600_0102841 3300046809 Bacteria 1862
291 Ga0495600_0308190 3300046809 Bacteria 998
292 Ga0495581_0200504 3300047315 Bacteria 1167
293 Ga0495604_0102567 3300047317 Bacteria 2100
294 Ga0495674_0000030 3300047319 Bacteria 115975
295 Ga0495676_0000131 3300047321 Bacteria 56689
296 Ga0495680_0000212 3300047322 Bacteria 63418
297 Ga0495680_0000241 3300047322 Bacteria 60168
298 Ga0495680_0002123 3300047322 Bacteria 20590
299 Ga0495680_0132163 3300047322 Bacteria 1833
300 Ga0495680_0241683 3300047322 Bacteria 1282
301 Ga0495673_0025820 3300047469 Bacteria 2816
302 Ga0495686_0000020 3300047472 Bacteria 429191
303 Ga0495686_0001936 3300047472 Bacteria 20622
304 Ga0495686_0014957 3300047472 Bacteria 5322
305 Ga0495686_0137383 3300047472 Bacteria 1445
306 Ga0495602_0030523 3300048088 Bacteria 5111
307 Ga0496100_0000013 3300048903 Bacteria 177476
308 Ga0496100_0048671 3300048903 Bacteria 2737
309 Ga0496101_0000035 3300048904 Bacteria 177237
310 Ga0496101_0001595 3300048904 Bacteria 13624
311 Ga0496102_0000211 3300048905 Bacteria 77793
312 Ga0496102_0009029 3300048905 Bacteria 8555
313 Ga0496102_0487163 3300048905 Bacteria 1155
314 Ga0496103_0000174 3300048906 Bacteria 67124
315 Ga0496103_0002624 3300048906 Bacteria 11263
316 Ga0496103_0138824 3300048906 Bacteria 1554
317 Ga0496104_0000015 3300048907 Bacteria 374530
318 Ga0496104_0000052 3300048907 Bacteria 137286
319 Ga0496104_0001240 3300048907 Bacteria 21960
320 Ga0496104_0030683 3300048907 Bacteria 4996
321 Ga0496104_0256614 3300048907 Bacteria 1661
322 Ga0496105_0000004 3300048908 Bacteria 475798
323 Ga0496105_0000030 3300048908 Bacteria 137325
324 Ga0496105_0000782 3300048908 Bacteria 21486
325 Ga0496105_0001308 3300048908 Bacteria 17427
326 Ga0496106_0000062 3300048909 Bacteria 85769
327 Ga0496106_0000139 3300048909 Bacteria 54238
328 Ga0496106_0236593 3300048909 Bacteria 1459
329 Ga0496107_0000020 3300048910 Bacteria 148990
330 Ga0496107_0052192 3300048910 Bacteria 2949
331 Ga0496107_0060072 3300048910 Bacteria 2751
332 Ga0496108_0001157 3300048911 Bacteria 20581
333 Ga0496108_0005051 3300048911 Bacteria 10660
334 Ga0496108_0071892 3300048911 Bacteria 2919
335 Ga0496108_0074613 3300048911 Bacteria 2864
336 Ga0496108_0683452 3300048911 Bacteria 891
337 Ga0496109_0000218 3300048912 Bacteria 56316
338 Ga0496109_0000261 3300048912 Bacteria 50812
339 Ga0496109_0004663 3300048912 Bacteria 11445
340 Ga0496110_0062126 3300048913 Bacteria 3298
341 Ga0496110_0069189 3300048913 Bacteria 3126
342 Ga0496110_0144317 3300048913 Bacteria 2153
343 Ga0496110_0686916 3300048913 Bacteria 924
344 Ga0496110_0702475 3300048913 Bacteria 913
345 Ga0496111_0015496 3300048914 Bacteria 5235
346 Ga0496111_0068157 3300048914 Bacteria 2585
347 Ga0496112_0000025 3300048915 Bacteria 146197
348 Ga0496112_0011145 3300048915 Bacteria 8197
349 Ga0496112_0169768 3300048915 Bacteria 2147
350 Ga0496112_0286701 3300048915 Bacteria 1593
351 Ga0496112_0559207 3300048915 Bacteria 1078
352 Ga0496113_0005145 3300048916 Bacteria 8131
353 Ga0496113_0167473 3300048916 Bacteria 1739
354 Ga0496113_0172384 3300048916 Bacteria 1714
355 Ga0496113_0435151 3300048916 Bacteria 1054
356 Ga0496113_0614205 3300048916 Bacteria 870
357 Ga0496114_0000039 3300048917 Bacteria 138486
358 Ga0496114_0000827 3300048917 Bacteria 23217
359 Ga0496114_0009207 3300048917 Bacteria 7830
360 Ga0496115_0000011 3300048918 Bacteria 222529
361 Ga0496115_0000162 3300048918 Bacteria 62522
362 Ga0496115_0006440 3300048918 Bacteria 8604
363 Ga0496117_0002925 3300048920 Bacteria 20664
364 Ga0496118_0006451 3300048921 Bacteria 12887
365 Ga0496119_0007580 3300048922 Bacteria 9737
366 Ga0496120_0004208 3300048923 Bacteria 12289
367 Ga0496121_0011664 3300048924 Bacteria 9714
368 Ga0496125_0040529 3300048928 Bacteria 3994
369 Ga0496126_0012102 3300048929 Bacteria 8857
370 Ga0501039_0052883 3300049575 Bacteria 3142
371 Ga0501072_0291673 3300049588 Bacteria 1297
372 Ga0501074_0369906 3300049590 Bacteria 1017
373 Ga0501075_0001791 3300049591 Bacteria 14133
374 Ga0501075_0192788 3300049591 Bacteria 1554
375 Ga0501076_0241528 3300049592 Bacteria 1478
376 Ga0501083_0039236 3300049744 Bacteria 3216
377 Ga0501083_0114807 3300049744 Bacteria 1768
378 Ga0501044_0143994 3300049823 Bacteria 2370
379 nmdc:mga00v17_204414_c1 3300050491 Bacteria 1277
380 nmdc:mga00v17_89567_c1 3300050491 Bacteria 1931
381 nmdc:mga0yw44_165607_c1 3300050492 Bacteria 1449
382 nmdc:mga0yw44_46541_c1 3300050492 Bacteria 2606
383 nmdc:mga0yw44_84924_c1 3300050492 Bacteria 1991
384 nmdc:mga06z11_335808_c1 3300050494 Bacteria 903
385 nmdc:mga06r32_53205_c1 3300050510 Bacteria 3878
386 nmdc:mga0a205_113_c1 3300050515 Bacteria 30301
387 Ga0495601_0000254 3300053077 Bacteria 28596
388 Ga0495601_0001148 3300053077 Bacteria 14465
389 Ga0495601_0082855 3300053077 Bacteria 2059
390 Ga0495612_0000230 3300053078 Bacteria 23681
391 Ga0495612_0000678 3300053078 Bacteria 13705
392 Ga0495655_0000002 3300053083 Bacteria 312752
393 Ga0495595_0000150 3300053084 Bacteria 27718
394 Ga0495619_0000084 3300053085 Bacteria 70164
395 Ga0495619_0001745 3300053085 Bacteria 14442
396 Ga0500614_000036 3300053123 Bacteria 29472
397 Ga0500628_000001 3300053129 Bacteria 564074
398 Ga0501084_0495010 3300054114 Bacteria 1033
399 Ga0466962_0025970 3300061719 Bacteria 2812

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025934 Ga0207686_10000073 Ga0207686_1000007366 195
2 3300026088 Ga0207641_10041404 Ga0207641_100414043 195
3 3300046517 Ga0495630_0701719 Ga0495630_0701719_51_698 198
4 3300005545 Ga0070695_100394284 Ga0070695_1003942842 211
5 3300005341 Ga0070691_10000021 Ga0070691_1000002148 212
6 3300006163 Ga0070715_10092390 Ga0070715_100923902 213
7 3300006038 Ga0075365_10007570 Ga0075365_100075705 214
8 3300006051 Ga0075364_10038548 Ga0075364_100385482 214
9 3300046533 Ga0495640_0005787 Ga0495640_0005787_6107_6835 214
10 3300047319 Ga0495674_0000030 Ga0495674_0000030_79896_80624 214
11 3300005347 Ga0070668_100367002 Ga0070668_1003670022 215
12 3300025972 Ga0207668_10203221 Ga0207668_102032212 215
13 3300036401 Ga0373937_0150083 Ga0373937_0150083_1355_2113 216
14 3300046663 Ga0495635_0088846 Ga0495635_0088846_912_1670 216
15 3300047322 Ga0495680_0241683 Ga0495680_0241683_432_1190 216
16 3300053085 Ga0495619_0001745 Ga0495619_0001745_8589_9347 216
17 3300005459 Ga0068867_100000226 Ga0068867_1000002265 217
18 3300005842 Ga0068858_100429704 Ga0068858_1004297042 217
19 3300026035 Ga0207703_10262184 Ga0207703_102621842 217
20 3300026089 Ga0207648_10000907 Ga0207648_100009073 217
21 3300053083 Ga0495655_0000002 Ga0495655_0000002_266677_267399 217
22 3300053129 Ga0500628_000001 Ga0500628_000001_355346_356068 217
23 3300014968 Ga0157379_10225371 Ga0157379_102253712 218
24 3300044901 Ga0466960_0029268 Ga0466960_0029268_768_1529 219
25 3300046499 Ga0495594_0000030 Ga0495594_0000030_64634_65395 219
26 3300046615 Ga0495656_0287972 Ga0495656_0287972_55_777 219
27 3300047472 Ga0495686_0014957 Ga0495686_0014957_3757_4545 219
28 3300006038 Ga0075365_10338027 Ga0075365_103380272 221
29 3300021358 Ga0213873_10041512 Ga0213873_100415122 221
30 3300021388 Ga0213875_10163399 Ga0213875_101633991 221
31 3300031995 Ga0307409_100925038 Ga0307409_1009250382 221
32 3300039437 Ga0436365_0113700 Ga0436365_0113700_4314_5027 221
33 3300039453 Ga0436362_0677671 Ga0436362_0677671_23_736 221
34 3300049590 Ga0501074_0369906 Ga0501074_0369906_157_891 221
35 3300005353 Ga0070669_100424384 Ga0070669_1004243842 223
36 3300005615 Ga0070702_100114647 Ga0070702_1001146472 223
37 3300005937 Ga0081455_10048656 Ga0081455_100486563 223
38 3300010375 Ga0105239_10729312 Ga0105239_107293121 223
39 3300046809 Ga0495600_0004097 Ga0495600_0004097_7937_8656 223
40 3300005337 Ga0070682_100000075 Ga0070682_10000007575 224
41 3300005337 Ga0070682_100027477 Ga0070682_1000274774 224
42 3300005367 Ga0070667_100001183 Ga0070667_10000118317 224
43 3300005436 Ga0070713_100000010 Ga0070713_10000001098 224
44 3300005439 Ga0070711_100042198 Ga0070711_1000421983 224
45 3300005543 Ga0070672_100000001 Ga0070672_10000000128 224
46 3300005548 Ga0070665_100262082 Ga0070665_1002620822 224
47 3300005842 Ga0068858_100348730 Ga0068858_1003487302 224
48 3300005844 Ga0068862_100005896 Ga0068862_1000058967 224
49 3300005937 Ga0081455_10018012 Ga0081455_100180126 224
50 3300009553 Ga0105249_10001967 Ga0105249_1000196713 224
51 3300014969 Ga0157376_10014311 Ga0157376_100143115 224
52 3300025905 Ga0207685_10014951 Ga0207685_100149513 224
53 3300025928 Ga0207700_10000007 Ga0207700_10000007299 224
54 3300025940 Ga0207691_10000529 Ga0207691_1000052916 224
55 3300025972 Ga0207668_10020527 Ga0207668_100205274 224
56 3300025986 Ga0207658_10161558 Ga0207658_101615582 224
57 3300026035 Ga0207703_10205199 Ga0207703_102051992 224
58 3300028379 Ga0268266_10412716 Ga0268266_104127162 224
59 3300028380 Ga0268265_10004309 Ga0268265_100043097 224
60 3300046476 Ga0495662_0234397 Ga0495662_0234397_102_824 224
61 3300046642 Ga0495634_0335247 Ga0495634_0335247_26_748 224
62 3300048916 Ga0496113_0614205 Ga0496113_0614205_67_789 224
63 3300048917 Ga0496114_0000039 Ga0496114_0000039_95225_95947 224
64 3300048918 Ga0496115_0000011 Ga0496115_0000011_38989_39711 224
65 3300048918 Ga0496115_0000162 Ga0496115_0000162_20924_21646 224
66 3300053077 Ga0495601_0001148 Ga0495601_0001148_13057_13779 224
67 3300005843 Ga0068860_100033508 Ga0068860_1000335083 225
68 3300006163 Ga0070715_10000021 Ga0070715_1000002178 225
69 3300025905 Ga0207685_10000028 Ga0207685_1000002847 225
70 3300028381 Ga0268264_10002136 Ga0268264_100021365 225
71 3300038443 Ga0395901_0082895 Ga0395901_0082895_263_994 225
72 3300044719 Ga0466971_0107381 Ga0466971_0107381_238_990 225
73 3300048907 Ga0496104_0001240 Ga0496104_0001240_20582_21343 225
74 3300048908 Ga0496105_0000782 Ga0496105_0000782_13348_14109 225
75 3300053077 Ga0495601_0082855 Ga0495601_0082855_1175_1936 225
76 3300061719 Ga0466962_0025970 Ga0466962_0025970_916_1668 225
77 3300006038 Ga0075365_10503674 Ga0075365_105036741 226
78 3300035115 Ga0373941_0015774 Ga0373941_0015774_359_1087 226
79 3300046459 Ga0495629_0061667 Ga0495629_0061667_1154_1885 226
80 3300046461 Ga0495641_0000244 Ga0495641_0000244_22042_22773 226
81 3300046500 Ga0495596_0040466 Ga0495596_0040466_820_1551 226
82 3300046513 Ga0495616_0106979 Ga0495616_0106979_371_1102 226
83 3300046520 Ga0495637_0134742 Ga0495637_0134742_64_795 226
84 3300046523 Ga0495644_0011682 Ga0495644_0011682_832_1563 226
85 3300046529 Ga0495652_0000022 Ga0495652_0000022_29857_30585 226
86 3300046683 Ga0495658_0007377 Ga0495658_0007377_3829_4560 226
87 3300047469 Ga0495673_0025820 Ga0495673_0025820_1518_2249 226
88 3300047472 Ga0495686_0000020 Ga0495686_0000020_342721_343452 226
89 3300047472 Ga0495686_0001936 Ga0495686_0001936_5265_5996 226
90 3300047472 Ga0495686_0137383 Ga0495686_0137383_261_992 226
91 3300025909 Ga0207705_10241607 Ga0207705_102416071 227
92 3300003203 JGI25406J46586_10031400 JGI25406J46586_100314002 228
93 3300005338 Ga0068868_100067595 Ga0068868_1000675952 228
94 3300005345 Ga0070692_10142140 Ga0070692_101421401 228
95 3300005356 Ga0070674_100026945 Ga0070674_1000269454 228
96 3300005367 Ga0070667_100383409 Ga0070667_1003834092 228
97 3300005436 Ga0070713_100537456 Ga0070713_1005374561 228
98 3300005439 Ga0070711_100059837 Ga0070711_1000598373 228
99 3300005441 Ga0070700_100267862 Ga0070700_1002678621 228
100 3300005444 Ga0070694_100323187 Ga0070694_1003231871 228
101 3300005455 Ga0070663_100548814 Ga0070663_1005488142 228
102 3300005459 Ga0068867_100374088 Ga0068867_1003740882 228
103 3300005466 Ga0070685_10096978 Ga0070685_100969782 228
104 3300005468 Ga0070707_100441334 Ga0070707_1004413342 228
105 3300005545 Ga0070695_100046786 Ga0070695_1000467863 228
106 3300005548 Ga0070665_100006209 Ga0070665_1000062098 228
107 3300005985 Ga0081539_10003769 Ga0081539_1000376915 228
108 3300006881 Ga0068865_100155283 Ga0068865_1001552833 228
109 3300009098 Ga0105245_10000349 Ga0105245_1000034912 228
110 3300009101 Ga0105247_10043391 Ga0105247_100433913 228
111 3300009148 Ga0105243_10026348 Ga0105243_100263485 228
112 3300009148 Ga0105243_10067073 Ga0105243_100670733 228
113 3300009174 Ga0105241_10383866 Ga0105241_103838662 228
114 3300009177 Ga0105248_10508532 Ga0105248_105085322 228
115 3300009553 Ga0105249_10151846 Ga0105249_101518462 228
116 3300010375 Ga0105239_10071425 Ga0105239_100714254 228
117 3300013308 Ga0157375_10126425 Ga0157375_101264251 228
118 3300014325 Ga0163163_10194650 Ga0163163_101946503 228
119 3300014326 Ga0157380_10424835 Ga0157380_104248352 228
120 3300014968 Ga0157379_10189923 Ga0157379_101899232 228
121 3300021377 Ga0213874_10043764 Ga0213874_100437641 228
122 3300025900 Ga0207710_10026403 Ga0207710_100264033 228
123 3300025915 Ga0207693_10004663 Ga0207693_100046633 228
124 3300025916 Ga0207663_10014418 Ga0207663_100144186 228
125 3300025935 Ga0207709_10009884 Ga0207709_100098846 228
126 3300025938 Ga0207704_10129988 Ga0207704_101299883 228
127 3300025941 Ga0207711_10194391 Ga0207711_101943912 228
128 3300025944 Ga0207661_10773570 Ga0207661_107735702 228
129 3300025961 Ga0207712_10362554 Ga0207712_103625542 228
130 3300026023 Ga0207677_10233099 Ga0207677_102330991 228
131 3300026035 Ga0207703_10189675 Ga0207703_101896753 228
132 3300026067 Ga0207678_10413350 Ga0207678_104133502 228
133 3300026089 Ga0207648_10254189 Ga0207648_102541893 228
134 3300028379 Ga0268266_10016366 Ga0268266_100163663 228
135 3300035691 Ga0373931_0396736 Ga0373931_0396736_92_826 228
136 3300037312 Ga0395899_0068402 Ga0395899_0068402_1214_1948 228
137 3300037418 Ga0395900_0005975 Ga0395900_0005975_281_1015 228
138 3300037466 Ga0395898_0002563 Ga0395898_0002563_13616_14350 228
139 3300037471 Ga0395905_0010892 Ga0395905_0010892_152_886 228
140 3300038443 Ga0395901_0013880 Ga0395901_0013880_4273_5007 228
141 3300046557 Ga0495622_0000387 Ga0495622_0000387_23357_24118 228
142 3300048903 Ga0496100_0048671 Ga0496100_0048671_504_1238 228
143 3300048904 Ga0496101_0001595 Ga0496101_0001595_217_951 228
144 3300048905 Ga0496102_0009029 Ga0496102_0009029_3553_4287 228
145 3300048906 Ga0496103_0002624 Ga0496103_0002624_6816_7550 228
146 3300048907 Ga0496104_0030683 Ga0496104_0030683_1550_2284 228
147 3300048907 Ga0496104_0256614 Ga0496104_0256614_449_1189 228
148 3300048908 Ga0496105_0001308 Ga0496105_0001308_3590_4324 228
149 3300048910 Ga0496107_0052192 Ga0496107_0052192_1846_2580 228
150 3300048911 Ga0496108_0071892 Ga0496108_0071892_1822_2556 228
151 3300048912 Ga0496109_0004663 Ga0496109_0004663_2582_3316 228
152 3300048913 Ga0496110_0062126 Ga0496110_0062126_1735_2469 228
153 3300048914 Ga0496111_0015496 Ga0496111_0015496_1558_2292 228
154 3300048915 Ga0496112_0011145 Ga0496112_0011145_4618_5352 228
155 3300048917 Ga0496114_0000827 Ga0496114_0000827_19093_19827 228
156 3300048918 Ga0496115_0006440 Ga0496115_0006440_1190_1924 228
157 3300050492 nmdc:mga0yw44_46541_c1 nmdc:mga0yw44_46541_c1_1564_2298 228
158 3300050494 nmdc:mga06z11_335808_c1 nmdc:mga06z11_335808_c1_53_787 228
159 3300005367 Ga0070667_100087697 Ga0070667_1000876972 230
160 3300005564 Ga0070664_100042970 Ga0070664_1000429705 230
161 3300005985 Ga0081539_10024258 Ga0081539_100242583 230
162 3300009098 Ga0105245_10180785 Ga0105245_101807852 230
163 3300009101 Ga0105247_10068822 Ga0105247_100688223 230
164 3300009176 Ga0105242_10002595 Ga0105242_1000259513 230
165 3300009177 Ga0105248_10602328 Ga0105248_106023282 230
166 3300013296 Ga0157374_10330557 Ga0157374_103305572 230
167 3300014326 Ga0157380_10001049 Ga0157380_1000104912 230
168 3300025918 Ga0207662_10429907 Ga0207662_104299072 230
169 3300025927 Ga0207687_10552983 Ga0207687_105529832 230
170 3300025935 Ga0207709_10120872 Ga0207709_101208722 230
171 3300025945 Ga0207679_10374393 Ga0207679_103743932 230
172 3300025986 Ga0207658_10374104 Ga0207658_103741042 230
173 3300026075 Ga0207708_10077251 Ga0207708_100772513 230
174 3300026142 Ga0207698_10183326 Ga0207698_101833262 230
175 3300035398 Ga0316574_0211352 Ga0316574_0211352_337_1077 230
176 3300046500 Ga0495596_0160149 Ga0495596_0160149_17_757 230
177 3300046616 Ga0495668_0135127 Ga0495668_0135127_385_1125 230
178 3300048905 Ga0496102_0000211 Ga0496102_0000211_75139_75900 230
179 3300048906 Ga0496103_0000174 Ga0496103_0000174_42959_43720 230
180 3300048913 Ga0496110_0702475 Ga0496110_0702475_40_780 230
181 3300049744 Ga0501083_0039236 Ga0501083_0039236_1221_1991 230
182 3300049823 Ga0501044_0143994 Ga0501044_0143994_1498_2268 230
183 3300054114 Ga0501084_0495010 Ga0501084_0495010_131_871 230
184 3300005548 Ga0070665_100038810 Ga0070665_1000388102 231
185 3300009147 Ga0114129_10491141 Ga0114129_104911412 231
186 3300028379 Ga0268266_10062779 Ga0268266_100627792 231
187 3300038443 Ga0395901_0094883 Ga0395901_0094883_1501_2244 231
188 3300046455 Ga0495603_0160604 Ga0495603_0160604_91_834 231
189 3300048906 Ga0496103_0138824 Ga0496103_0138824_355_1116 231
190 3300048907 Ga0496104_0000015 Ga0496104_0000015_328575_329342 231
191 3300048908 Ga0496105_0000004 Ga0496105_0000004_146457_147224 231
192 3300048913 Ga0496110_0069189 Ga0496110_0069189_2256_2999 231
193 3300048922 Ga0496119_0007580 Ga0496119_0007580_7196_7963 231
194 3300048923 Ga0496120_0004208 Ga0496120_0004208_2287_3048 231
195 3300048924 Ga0496121_0011664 Ga0496121_0011664_712_1473 231
196 3300048928 Ga0496125_0040529 Ga0496125_0040529_1197_1958 231
197 3300050510 nmdc:mga06r32_53205_c1 nmdc:mga06r32_53205_c1_1545_2288 231
198 3300005440 Ga0070705_100217860 Ga0070705_1002178602 232
199 3300005937 Ga0081455_10011586 Ga0081455_100115869 232
200 3300005937 Ga0081455_10239456 Ga0081455_102394562 232
201 3300005983 Ga0081540_1001342 Ga0081540_10013428 232
202 3300005983 Ga0081540_1041691 Ga0081540_10416912 232
203 3300006048 Ga0075363_100120359 Ga0075363_1001203591 232
204 3300009148 Ga0105243_10199240 Ga0105243_101992402 232
205 3300026023 Ga0207677_10003506 Ga0207677_100035066 232
206 3300031995 Ga0307409_100310458 Ga0307409_1003104582 232
207 3300032005 Ga0307411_10263909 Ga0307411_102639092 232
208 3300032126 Ga0307415_100213454 Ga0307415_1002134542 232
209 3300037418 Ga0395900_0196421 Ga0395900_0196421_871_1617 232
210 3300037466 Ga0395898_0097404 Ga0395898_0097404_201_947 232
211 3300038443 Ga0395901_0052752 Ga0395901_0052752_475_1221 232
212 3300038443 Ga0395901_0170046 Ga0395901_0170046_189_935 232
213 3300038443 Ga0395901_0601312 Ga0395901_0601312_218_964 232
214 3300046615 Ga0495656_0241467 Ga0495656_0241467_54_800 232
215 3300048905 Ga0496102_0487163 Ga0496102_0487163_38_784 232
216 3300048909 Ga0496106_0236593 Ga0496106_0236593_260_1006 232
217 3300048911 Ga0496108_0683452 Ga0496108_0683452_113_859 232
218 3300048913 Ga0496110_0144317 Ga0496110_0144317_1104_1850 232
219 3300048915 Ga0496112_0559207 Ga0496112_0559207_134_883 232
220 3300048929 Ga0496126_0012102 Ga0496126_0012102_3958_4713 232
221 3300006051 Ga0075364_10162564 Ga0075364_101625642 234
222 3300006051 Ga0075364_10252838 Ga0075364_102528382 234
223 3300037312 Ga0395899_0062737 Ga0395899_0062737_1952_2707 234
224 3300037418 Ga0395900_0199670 Ga0395900_0199670_973_1728 234
225 3300037466 Ga0395898_0003725 Ga0395898_0003725_11044_11799 234
226 3300037466 Ga0395898_0279832 Ga0395898_0279832_522_1277 234
227 3300038443 Ga0395901_0044450 Ga0395901_0044450_2545_3300 234
228 3300038443 Ga0395901_0206855 Ga0395901_0206855_1028_1783 234
229 3300050491 nmdc:mga00v17_204414_c1 nmdc:mga00v17_204414_c1_480_1232 234
230 3300050491 nmdc:mga00v17_89567_c1 nmdc:mga00v17_89567_c1_70_822 234
231 3300050492 nmdc:mga0yw44_165607_c1 nmdc:mga0yw44_165607_c1_374_1126 234
232 3300050492 nmdc:mga0yw44_84924_c1 nmdc:mga0yw44_84924_c1_496_1248 234
233 3300046689 Ga0495613_0000005 Ga0495613_0000005_35572_36327 235
234 3300048916 Ga0496113_0435151 Ga0496113_0435151_44_802 235
235 3300005356 Ga0070674_100000023 Ga0070674_10000002374 236
236 3300005364 Ga0070673_100018525 Ga0070673_1000185254 236
237 3300005718 Ga0068866_10000008 Ga0068866_1000000848 236
238 3300014325 Ga0163163_10085437 Ga0163163_100854374 236
239 3300025899 Ga0207642_10000002 Ga0207642_10000002621 236
240 3300025937 Ga0207669_10000026 Ga0207669_1000002681 236
241 3300025960 Ga0207651_10011357 Ga0207651_100113575 236
242 3300046454 Ga0495592_0044074 Ga0495592_0044074_808_1566 236
243 3300046455 Ga0495603_0001834 Ga0495603_0001834_4032_4790 236
244 3300046515 Ga0495620_0000211 Ga0495620_0000211_41102_41860 236
245 3300046537 Ga0495598_0001130 Ga0495598_0001130_2909_3667 236
246 3300046684 Ga0495669_0013860 Ga0495669_0013860_2065_2823 236
247 3300046809 Ga0495600_0004828 Ga0495600_0004828_7108_7866 236
248 3300048913 Ga0496110_0686916 Ga0496110_0686916_153_911 236
249 3300048914 Ga0496111_0068157 Ga0496111_0068157_869_1627 236
250 3300048915 Ga0496112_0169768 Ga0496112_0169768_404_1162 236
251 3300048915 Ga0496112_0286701 Ga0496112_0286701_462_1220 236
252 3300048916 Ga0496113_0005145 Ga0496113_0005145_2453_3211 236
253 3300048916 Ga0496113_0172384 Ga0496113_0172384_917_1675 236
254 3300049591 Ga0501075_0001791 Ga0501075_0001791_6205_6963 236
255 3300053078 Ga0495612_0000678 Ga0495612_0000678_5006_5764 236
256 3300002239 JGI24034J26672_10001024 JGI24034J26672_100010244 237
257 3300002459 JGI24751J29686_10014224 JGI24751J29686_100142243 237
258 3300005329 Ga0070683_100010678 Ga0070683_1000106785 237
259 3300005329 Ga0070683_100019867 Ga0070683_1000198673 237
260 3300005329 Ga0070683_100050151 Ga0070683_1000501512 237
261 3300005333 Ga0070677_10000008 Ga0070677_100000087 237
262 3300005338 Ga0068868_100000355 Ga0068868_10000035521 237
263 3300005344 Ga0070661_100001224 Ga0070661_1000012243 237
264 3300005354 Ga0070675_100000106 Ga0070675_1000001066 237
265 3300005366 Ga0070659_100187409 Ga0070659_1001874093 237
266 3300005441 Ga0070700_100069534 Ga0070700_1000695341 237
267 3300005456 Ga0070678_100006315 Ga0070678_1000063156 237
268 3300005457 Ga0070662_100000061 Ga0070662_10000006137 237
269 3300005458 Ga0070681_10155391 Ga0070681_101553912 237
270 3300005530 Ga0070679_100003330 Ga0070679_10000333010 237
271 3300005535 Ga0070684_100016434 Ga0070684_1000164346 237
272 3300005535 Ga0070684_100041903 Ga0070684_1000419033 237
273 3300005539 Ga0068853_100005071 Ga0068853_1000050717 237
274 3300005544 Ga0070686_100044247 Ga0070686_1000442472 237
275 3300005547 Ga0070693_100000087 Ga0070693_10000008711 237
276 3300005548 Ga0070665_100197775 Ga0070665_1001977751 237
277 3300005563 Ga0068855_100182443 Ga0068855_1001824432 237
278 3300005578 Ga0068854_100151094 Ga0068854_1001510943 237
279 3300005616 Ga0068852_100241003 Ga0068852_1002410032 237
280 3300005618 Ga0068864_100000031 Ga0068864_10000003123 237
281 3300005718 Ga0068866_10000195 Ga0068866_100001954 237
282 3300005841 Ga0068863_100000022 Ga0068863_100000022137 237
283 3300006175 Ga0070712_100002205 Ga0070712_10000220512 237
284 3300009098 Ga0105245_10000130 Ga0105245_1000013054 237
285 3300009098 Ga0105245_10001228 Ga0105245_1000122815 237
286 3300009148 Ga0105243_10041676 Ga0105243_100416765 237
287 3300009176 Ga0105242_10053855 Ga0105242_100538553 237
288 3300009551 Ga0105238_10000055 Ga0105238_1000005593 237
289 3300009553 Ga0105249_10000332 Ga0105249_1000033251 237
290 3300010375 Ga0105239_10252258 Ga0105239_102522583 237
291 3300013104 Ga0157370_10006631 Ga0157370_100066319 237
292 3300014326 Ga0157380_10005999 Ga0157380_100059994 237
293 3300014968 Ga0157379_10016077 Ga0157379_100160776 237
294 3300017792 Ga0163161_10018649 Ga0163161_100186496 237
295 3300025893 Ga0207682_10000022 Ga0207682_1000002251 237
296 3300025899 Ga0207642_10000354 Ga0207642_100003542 237
297 3300025912 Ga0207707_10070616 Ga0207707_100706163 237
298 3300025915 Ga0207693_10004358 Ga0207693_1000435811 237
299 3300025920 Ga0207649_10000189 Ga0207649_1000018949 237
300 3300025921 Ga0207652_10001902 Ga0207652_1000190214 237
301 3300025924 Ga0207694_10000063 Ga0207694_1000006348 237
302 3300025926 Ga0207659_10000013 Ga0207659_1000001321 237
303 3300025927 Ga0207687_10000032 Ga0207687_1000003294 237
304 3300025927 Ga0207687_10000073 Ga0207687_1000007351 237
305 3300025932 Ga0207690_10113290 Ga0207690_101132902 237
306 3300025933 Ga0207706_10000250 Ga0207706_1000025028 237
307 3300025934 Ga0207686_10043179 Ga0207686_100431793 237
308 3300025937 Ga0207669_10000006 Ga0207669_10000006145 237
309 3300025944 Ga0207661_10004637 Ga0207661_100046375 237
310 3300025944 Ga0207661_10007540 Ga0207661_100075405 237
311 3300025944 Ga0207661_10030591 Ga0207661_100305913 237
312 3300025944 Ga0207661_10121703 Ga0207661_101217033 237
313 3300025949 Ga0207667_10196092 Ga0207667_101960923 237
314 3300025961 Ga0207712_10000058 Ga0207712_1000005850 237
315 3300025981 Ga0207640_10146641 Ga0207640_101466412 237
316 3300026023 Ga0207677_10000263 Ga0207677_1000026321 237
317 3300026041 Ga0207639_10002685 Ga0207639_100026856 237
318 3300026075 Ga0207708_10245681 Ga0207708_102456812 237
319 3300026078 Ga0207702_10003521 Ga0207702_100035215 237
320 3300026088 Ga0207641_10000016 Ga0207641_10000016259 237
321 3300026095 Ga0207676_10000031 Ga0207676_1000003123 237
322 3300036401 Ga0373937_0151869 Ga0373937_0151869_753_1514 237
323 3300041512 Ga0451853_1776708 Ga0451853_1776708_6076_6837 237
324 3300044694 Ga0466963_0000008 Ga0466963_0000008_29243_30004 237
325 3300046454 Ga0495592_0000267 Ga0495592_0000267_14806_15567 237
326 3300046455 Ga0495603_0002539 Ga0495603_0002539_1698_2459 237
327 3300046460 Ga0495638_0058326 Ga0495638_0058326_83_844 237
328 3300046461 Ga0495641_0000027 Ga0495641_0000027_93503_94264 237
329 3300046473 Ga0495582_0000001 Ga0495582_0000001_143961_144722 237
330 3300046476 Ga0495662_0000079 Ga0495662_0000079_33495_34256 237
331 3300046511 Ga0495608_0000641 Ga0495608_0000641_11973_12734 237
332 3300046512 Ga0495610_0048641 Ga0495610_0048641_476_1237 237
333 3300046514 Ga0495618_0000091 Ga0495618_0000091_45409_46170 237
334 3300046516 Ga0495628_0001838 Ga0495628_0001838_9387_10148 237
335 3300046516 Ga0495628_0011426 Ga0495628_0011426_4867_5628 237
336 3300046517 Ga0495630_0286274 Ga0495630_0286274_468_1229 237
337 3300046523 Ga0495644_0000579 Ga0495644_0000579_7429_8190 237
338 3300046533 Ga0495640_0007284 Ga0495640_0007284_6735_7496 237
339 3300046535 Ga0495586_0001045 Ga0495586_0001045_8760_9521 237
340 3300046558 Ga0495633_0132923 Ga0495633_0132923_23_784 237
341 3300046615 Ga0495656_0000497 Ga0495656_0000497_4509_5270 237
342 3300046642 Ga0495634_0000031 Ga0495634_0000031_71311_72072 237
343 3300046642 Ga0495634_0000381 Ga0495634_0000381_24774_25535 237
344 3300046663 Ga0495635_0000086 Ga0495635_0000086_44742_45503 237
345 3300046681 Ga0495647_0000001 Ga0495647_0000001_175357_176118 237
346 3300046681 Ga0495647_0018544 Ga0495647_0018544_517_1278 237
347 3300046683 Ga0495658_0000002 Ga0495658_0000002_267567_268328 237
348 3300046694 Ga0495649_0003839 Ga0495649_0003839_5357_6118 237
349 3300046809 Ga0495600_0308190 Ga0495600_0308190_94_855 237
350 3300047315 Ga0495581_0200504 Ga0495581_0200504_82_843 237
351 3300047317 Ga0495604_0102567 Ga0495604_0102567_866_1627 237
352 3300047321 Ga0495676_0000131 Ga0495676_0000131_28169_28930 237
353 3300047322 Ga0495680_0000212 Ga0495680_0000212_44339_45100 237
354 3300047322 Ga0495680_0000241 Ga0495680_0000241_21615_22376 237
355 3300047322 Ga0495680_0132163 Ga0495680_0132163_1024_1785 237
356 3300048088 Ga0495602_0030523 Ga0495602_0030523_4298_5059 237
357 3300048907 Ga0496104_0000052 Ga0496104_0000052_95038_95799 237
358 3300048908 Ga0496105_0000030 Ga0496105_0000030_41527_42288 237
359 3300048909 Ga0496106_0000139 Ga0496106_0000139_8460_9221 237
360 3300048910 Ga0496107_0060072 Ga0496107_0060072_1149_1910 237
361 3300048911 Ga0496108_0001157 Ga0496108_0001157_8817_9578 237
362 3300048911 Ga0496108_0005051 Ga0496108_0005051_7009_7770 237
363 3300048911 Ga0496108_0074613 Ga0496108_0074613_1365_2126 237
364 3300048912 Ga0496109_0000218 Ga0496109_0000218_16880_17641 237
365 3300048912 Ga0496109_0000261 Ga0496109_0000261_10254_11015 237
366 3300048915 Ga0496112_0000025 Ga0496112_0000025_44918_45679 237
367 3300048916 Ga0496113_0167473 Ga0496113_0167473_724_1485 237
368 3300048917 Ga0496114_0009207 Ga0496114_0009207_4766_5527 237
369 3300048920 Ga0496117_0002925 Ga0496117_0002925_698_1459 237
370 3300048921 Ga0496118_0006451 Ga0496118_0006451_2869_3630 237
371 3300049575 Ga0501039_0052883 Ga0501039_0052883_1187_1948 237
372 3300049588 Ga0501072_0291673 Ga0501072_0291673_167_928 237
373 3300049591 Ga0501075_0192788 Ga0501075_0192788_499_1260 237
374 3300049592 Ga0501076_0241528 Ga0501076_0241528_277_1038 237
375 3300049744 Ga0501083_0114807 Ga0501083_0114807_106_867 237
376 3300050515 nmdc:mga0a205_113_c1 nmdc:mga0a205_113_c1_26501_27262 237
377 3300053078 Ga0495612_0000230 Ga0495612_0000230_20037_20798 237
378 3300053084 Ga0495595_0000150 Ga0495595_0000150_13931_14692 237
379 3300053085 Ga0495619_0000084 Ga0495619_0000084_35240_36001 237
380 3300053123 Ga0500614_000036 Ga0500614_000036_5572_6333 237
381 3300005356 Ga0070674_100479065 Ga0070674_1004790651 238
382 3300013296 Ga0157374_10003052 Ga0157374_100030525 238
383 3300035172 Ga0373955_0056062 Ga0373955_0056062_1217_1984 238
384 3300036401 Ga0373937_0008069 Ga0373937_0008069_6969_7736 238
385 3300039437 Ga0436365_1296942 Ga0436365_1296942_26_802 238
386 3300044735 Ga0466968_0021505 Ga0466968_0021505_931_1710 238
387 3300046684 Ga0495669_0000904 Ga0495669_0000904_11576_12340 238
388 3300046809 Ga0495600_0102841 Ga0495600_0102841_65_832 238
389 3300048903 Ga0496100_0000013 Ga0496100_0000013_130934_131698 238
390 3300048904 Ga0496101_0000035 Ga0496101_0000035_130934_131698 238
391 3300048909 Ga0496106_0000062 Ga0496106_0000062_39466_40230 238
392 3300048910 Ga0496107_0000020 Ga0496107_0000020_102083_102847 238
393 3300053077 Ga0495601_0000254 Ga0495601_0000254_3785_4555 238
394 3300001979 JGI24740J21852_10000917 JGI24740J21852_1000091714 239
395 3300005439 Ga0070711_100001172 Ga0070711_10000117210 239
396 3300005842 Ga0068858_100000097 Ga0068858_10000009740 239
397 3300025916 Ga0207663_10001408 Ga0207663_100014082 239
398 3300026035 Ga0207703_10000103 Ga0207703_1000010351 239
399 3300047322 Ga0495680_0002123 Ga0495680_0002123_16793_17614 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02683

DsbD

Cytochrome C biogenesis protein transmembrane region

48

257

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.6021 17 217
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.4946 17 217
8ahx-assembly1.cif.gz_A cryo-em structure of the nitrogen-fixation associated nadh:ferredoxin oxidoreductase rnf from azotobacter vinelandii 0.4713 64 221
7xgg-assembly2.cif.gz_D crystal structure of bcl-xl in complex with computationally designed inhibitor protein 0.3918 49 197
8ahx-assembly1.cif.gz_A cryo-em structure of the nitrogen-fixation associated nadh:ferredoxin oxidoreductase rnf from azotobacter vinelandii 0.3815 64 221
ID Description Score Start End Superfamily
af_P0A766_4_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4208 18 221 1.10.1760.20
af_P0A766_4_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4032 18 221 1.10.1760.20
af_O44196_80_262_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.3306 21 197 1.10.357.20
af_O44196_80_262_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.3179 21 197 1.10.357.20
5x9hB03 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.3178 19 198 1.10.357.20
ID Description Score Start End GO Terms
AF-A0A498GV14-F1-model_v4 Cytochrome c biogenesis protein CcdA 0.7717 15 202 GO:0016020
GO:0017004
AF-A0A2N1U2Y6-F1-model_v4 Thioredoxin domain-containing protein 0.7617 18 205 GO:0005886
GO:0015035
GO:0017004
GO:0045454
AF-A0A2H5WRG9-F1-model_v4 Thiol:disulfide interchange protein DsbD (EC 1.8.1.8) 0.7558 18 198 GO:0005886
GO:0017004
GO:0045454
GO:0047134
AF-A0A7K4C433-F1-model_v4 deleted 0.7515 17 202
AF-A0A545B8E6-F1-model_v4 Protein-disulfide reductase DsbD (EC 1.8.1.8) 0.7514 17 203 GO:0005886
GO:0017004
GO:0045454
GO:0047134

Feature Viewer

pLDDT pTM Quality
61.55 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map