F434176

General Info

Members Datasets Scaffolds Average Seq Length
398 227 370 85

Family's Representative Sequence

Representative Sequence 3300053098|Ga0500650_0013318|Ga0500650_0013318_940_1209
Length 89
Sequence LELLVPTIVVEVMPKAVLLDPQGKAVTGALHRLGNTTISEVRIGKRFELTVDEVTDELLAEVRAYADDMFSNSVIEDVVSIEVVESAAV

Samples

Sample ID Description Type Environment
1 2643221546 Microbacterium sp. Root53 Isolate Unclassified
2 2643221566 Microbacterium sp. Root166 Isolate Unclassified
3 2643221572 Leifsonia sp. Root60 Isolate Unclassified
4 2643221575 Microbacterium sp. Root61 Isolate Unclassified
5 2643221597 Microbacterium sp. Root180 Isolate Unclassified
6 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
7 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
8 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
9 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
10 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
11 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
12 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
13 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
14 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
15 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
16 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
17 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
18 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
19 2919395869 Microbacterium resistens 2980 Isolate Unclassified
20 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
21 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
22 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
23 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
24 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
25 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
26 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
27 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
28 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
29 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
30 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
31 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
32 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
33 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
34 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
35 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
36 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
144 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
145 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
146 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
147 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
148 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
149 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
150 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
151 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
152 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
153 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
198 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
216 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
217 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
218 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
219 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
220 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
221 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
222 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
223 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
224 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
225 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
226 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
227 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.21
Metatranscriptomes 0.75
Isolates 7.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.58
Nodule 0
Rhizoplane 11.06
Rhizosphere 55.78
Stem 0
Stem Tuber 0
Unclassified 16.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10051490 3300001979 Bacteria 1178
2 JGI25164J39214_1001748 3300002772 Bacteria 4306
3 JGI25165J46597_1001642 3300003214 Bacteria 10402
4 Ga0006562J51391_1188945 3300003578 Bacteria 4565
5 Ga0006562J51391_1188946 3300003578 Bacteria 4430
6 Ga0055539_1000069 3300003752 Bacteria 134064
7 Ga0055533_1000037 3300003756 Bacteria 255573
8 Ga0055525_1000308 3300003759 Bacteria 39902
9 Ga0055542_1000048 3300003762 Bacteria 195800
10 Ga0055529_1000057 3300003763 Bacteria 195807
11 Ga0055541_1003380 3300003841 Bacteria 3013
12 Ga0070658_10017455 3300005327 Bacteria 5742
13 Ga0070658_10282338 3300005327 Bacteria 1413
14 Ga0070670_100667766 3300005331 Bacteria 933
15 Ga0068869_100764504 3300005334 Bacteria 828
16 Ga0070666_10272675 3300005335 Bacteria 1201
17 Ga0070682_100569861 3300005337 Bacteria 889
18 Ga0070682_100657641 3300005337 Bacteria 835
19 Ga0070682_101061841 3300005337 Bacteria 676
20 Ga0070682_101697022 3300005337 Bacteria 549
21 Ga0068868_100429097 3300005338 Bacteria 1146
22 Ga0070660_100042788 3300005339 Bacteria 3458
23 Ga0070659_100001648 3300005366 Bacteria 16091
24 Ga0070659_101226140 3300005366 Bacteria 664
25 Ga0070667_100011846 3300005367 Bacteria 7211
26 Ga0070710_10813927 3300005437 Bacteria 668
27 Ga0070663_100661998 3300005455 Bacteria 884
28 Ga0070663_101302329 3300005455 Bacteria 641
29 Ga0070685_10009839 3300005466 Bacteria 4958
30 Ga0070684_100961437 3300005535 Bacteria 801
31 Ga0070684_101266097 3300005535 Bacteria 694
32 Ga0068853_100039432 3300005539 Bacteria 4028
33 Ga0068853_101816419 3300005539 Bacteria 591
34 Ga0070672_100520952 3300005543 Bacteria 1030
35 Ga0070665_100051468 3300005548 Bacteria 4130
36 Ga0068855_100012913 3300005563 Bacteria 10078
37 Ga0068855_100151154 3300005563 Bacteria 2640
38 Ga0068857_100001313 3300005577 Bacteria 19546
39 Ga0068857_100560065 3300005577 Bacteria 1077
40 Ga0068857_101113730 3300005577 Bacteria 763
41 Ga0068854_100126772 3300005578 Bacteria 1945
42 Ga0068856_100214190 3300005614 Bacteria 1941
43 Ga0068856_100632889 3300005614 Bacteria 1090
44 Ga0068856_100674751 3300005614 Bacteria 1054
45 Ga0068852_100020666 3300005616 Bacteria 5237
46 Ga0068852_100183645 3300005616 Bacteria 1968
47 Ga0068864_101004103 3300005618 Bacteria 828
48 Ga0068851_10000030 3300005834 Bacteria 114502
49 Ga0068863_100087658 3300005841 Bacteria 2950
50 Ga0068863_100340702 3300005841 Bacteria 1458
51 Ga0068863_100745348 3300005841 Bacteria 975
52 Ga0075365_10000832 3300006038 Bacteria 12765
53 Ga0075365_10012508 3300006038 Bacteria 5044
54 Ga0075368_10057237 3300006042 Bacteria 1556
55 Ga0075363_100017091 3300006048 Bacteria 3591
56 Ga0075364_10035456 3300006051 Bacteria 3224
57 Ga0075364_10060692 3300006051 Bacteria 2479
58 Ga0075364_10720487 3300006051 Bacteria 681
59 Ga0075364_11132238 3300006051 Bacteria 531
60 Ga0070716_100571149 3300006173 Bacteria 846
61 Ga0075367_10041326 3300006178 Bacteria 2695
62 Ga0075367_10367964 3300006178 Bacteria 908
63 Ga0075369_10012262 3300006186 Bacteria 3386
64 Ga0075369_10559709 3300006186 Bacteria 546
65 Ga0075370_10010152 3300006353 Bacteria 4909
66 Ga0105244_10035779 3300009036 Bacteria 2606
67 Ga0105240_12104512 3300009093 Bacteria 586
68 Ga0111539_10545510 3300009094 Bacteria 1351
69 Ga0105247_10065767 3300009101 Bacteria 2256
70 Ga0105247_10673393 3300009101 Bacteria 776
71 Ga0105243_10010736 3300009148 Bacteria 6938
72 Ga0105243_10249676 3300009148 Bacteria 1583
73 Ga0105241_10001584 3300009174 Bacteria 17411
74 Ga0105241_10696371 3300009174 Bacteria 927
75 Ga0105237_10000724 3300009545 Bacteria 45653
76 Ga0105237_10032536 3300009545 Bacteria 5279
77 Ga0105237_10552338 3300009545 Bacteria 1158
78 Ga0105237_10602535 3300009545 Bacteria 1106
79 Ga0105238_10014754 3300009551 Bacteria 7902
80 Ga0105238_10514835 3300009551 Bacteria 1199
81 Ga0105238_12741427 3300009551 Bacteria 529
82 Ga0105239_10387675 3300010375 Bacteria 1580
83 Ga0105239_11783907 3300010375 Bacteria 713
84 Ga0105239_13183921 3300010375 Bacteria 534
85 Ga0105246_10891238 3300011119 Bacteria 797
86 Ga0157371_10040540 3300013102 Bacteria 3325
87 Ga0157370_10827193 3300013104 Bacteria 842
88 Ga0157370_11424717 3300013104 Bacteria 623
89 Ga0157369_10030956 3300013105 Bacteria 5897
90 Ga0171462_1005 3300013250 Bacteria 598379
91 Ga0157374_10059350 3300013296 Bacteria 3577
92 Ga0157374_10624056 3300013296 Bacteria 1089
93 Ga0163162_10013891 3300013306 Bacteria 7865
94 Ga0163162_10501023 3300013306 Bacteria 1345
95 Ga0163162_10720197 3300013306 Bacteria 1118
96 Ga0163162_12110452 3300013306 Bacteria 646
97 Ga0157372_10014843 3300013307 Bacteria 8341
98 Ga0157372_10693486 3300013307 Bacteria 1185
99 Ga0157372_11293760 3300013307 Bacteria 841
100 Ga0157372_12941280 3300013307 Bacteria 545
101 Ga0157375_10289402 3300013308 Bacteria 1801
102 Ga0157375_10605463 3300013308 Bacteria 1255
103 Ga0163163_10190561 3300014325 Bacteria 2099
104 Ga0157380_10333903 3300014326 Bacteria 1411
105 Ga0157379_10028212 3300014968 Bacteria 4997
106 Ga0157376_10332860 3300014969 Bacteria 1447
107 Ga0157376_10806751 3300014969 Bacteria 951
108 Ga0163161_10641184 3300017792 Bacteria 879
109 Ga0206354_10299183 3300020081 Bacteria 1001
110 Ga0209566_100283 3300025225 Bacteria 46914
111 Ga0209674_100001 3300025226 Bacteria 4013750
112 Ga0209563_100001 3300025230 Bacteria 4013775
113 Ga0209563_101620 3300025230 Bacteria 5817
114 Ga0207427_100028 3300025231 Bacteria 388949
115 Ga0209437_100557 3300025233 Bacteria 24763
116 Ga0209677_100001 3300025253 Bacteria 4013787
117 Ga0209148_1000744 3300025254 Bacteria 25149
118 Ga0209233_1000001 3300025261 Bacteria 2992747
119 Ga0207656_10000001 3300025321 Bacteria 1323684
120 Ga0207655_1017285 3300025728 Bacteria 3898
121 Ga0207647_10072665 3300025904 Bacteria 2074
122 Ga0207705_10144958 3300025909 Bacteria 1776
123 Ga0207705_10197476 3300025909 Bacteria 1523
124 Ga0207705_11010891 3300025909 Bacteria 642
125 Ga0207654_10000001 3300025911 Bacteria 1816198
126 Ga0207695_10001789 3300025913 Bacteria 33914
127 Ga0207695_10018544 3300025913 Bacteria 8041
128 Ga0207671_10000001 3300025914 Bacteria 1318881
129 Ga0207671_10076986 3300025914 Bacteria 2496
130 Ga0207671_10138672 3300025914 Bacteria 1872
131 Ga0207657_10001206 3300025919 Bacteria 27523
132 Ga0207649_10852924 3300025920 Bacteria 713
133 Ga0207694_10004764 3300025924 Bacteria 10550
134 Ga0207694_10392801 3300025924 Bacteria 1153
135 Ga0207694_10650348 3300025924 Bacteria 888
136 Ga0207690_10001234 3300025932 Bacteria 16156
137 Ga0207709_10008409 3300025935 Bacteria 5708
138 Ga0207709_10536183 3300025935 Bacteria 918
139 Ga0207665_10435552 3300025939 Bacteria 1004
140 Ga0207691_10069349 3300025940 Bacteria 3185
141 Ga0207711_10006178 3300025941 Bacteria 10122
142 Ga0207689_10554984 3300025942 Bacteria 965
143 Ga0207667_10005520 3300025949 Bacteria 15431
144 Ga0207667_10013652 3300025949 Bacteria 9284
145 Ga0207667_10102152 3300025949 Bacteria 2958
146 Ga0207667_10128065 3300025949 Bacteria 2615
147 Ga0207667_10995982 3300025949 Bacteria 826
148 Ga0207668_11295985 3300025972 Bacteria 656
149 Ga0207640_10270998 3300025981 Bacteria 1328
150 Ga0207658_10172429 3300025986 Bacteria 1783
151 Ga0207677_10159093 3300026023 Bacteria 1753
152 Ga0207677_10712434 3300026023 Bacteria 891
153 Ga0207639_10028340 3300026041 Bacteria 4088
154 Ga0207639_11287824 3300026041 Bacteria 686
155 Ga0207678_10993256 3300026067 Bacteria 743
156 Ga0207702_10070763 3300026078 Bacteria 3001
157 Ga0207702_10312404 3300026078 Bacteria 1495
158 Ga0207702_11007795 3300026078 Bacteria 826
159 Ga0207641_10447189 3300026088 Bacteria 1248
160 Ga0207641_11148135 3300026088 Bacteria 776
161 Ga0207641_11419252 3300026088 Bacteria 695
162 Ga0207676_10290576 3300026095 Bacteria 1488
163 Ga0207674_10014478 3300026116 Bacteria 8709
164 Ga0207674_10194950 3300026116 Bacteria 1975
165 Ga0207674_10517991 3300026116 Bacteria 1152
166 Ga0207674_11272451 3300026116 Bacteria 705
167 Ga0207675_102401349 3300026118 Bacteria 539
168 Ga0207683_10474070 3300026121 Bacteria 1155
169 Ga0207683_10548415 3300026121 Bacteria 1069
170 Ga0207698_10013631 3300026142 Bacteria 5372
171 Ga0207698_10013948 3300026142 Bacteria 5323
172 Ga0207698_10084417 3300026142 Bacteria 2574
173 Ga0209813_10094093 3300027866 Bacteria 1010
174 Ga0268266_10460192 3300028379 Bacteria 1210
175 Ga0307513_10066088 3300031456 Bacteria 3802
176 Ga0307413_10144723 3300031824 Bacteria 1648
177 Ga0307413_10191854 3300031824 Bacteria 1468
178 Ga0307413_10298182 3300031824 Bacteria 1221
179 Ga0307410_10189039 3300031852 Bacteria 1565
180 Ga0307410_11757675 3300031852 Bacteria 550
181 Ga0307406_10013091 3300031901 Bacteria 4744
182 Ga0307406_10479176 3300031901 Bacteria 1004
183 Ga0307406_11106332 3300031901 Bacteria 684
184 Ga0307406_11921990 3300031901 Bacteria 528
185 Ga0307407_10333994 3300031903 Bacteria 1068
186 Ga0307407_11645916 3300031903 Bacteria 510
187 Ga0307412_10115242 3300031911 Bacteria 1926
188 Ga0307412_10507606 3300031911 Bacteria 1005
189 Ga0307409_100134924 3300031995 Bacteria 2116
190 Ga0307409_100636766 3300031995 Bacteria 1058
191 Ga0307409_101725243 3300031995 Bacteria 655
192 Ga0307416_100110907 3300032002 Bacteria 2417
193 Ga0307416_101182210 3300032002 Bacteria 870
194 Ga0307416_102435753 3300032002 Bacteria 622
195 Ga0307414_10307988 3300032004 Bacteria 1343
196 Ga0307414_10531102 3300032004 Bacteria 1046
197 Ga0307414_11018565 3300032004 Bacteria 763
198 Ga0307414_11084476 3300032004 Bacteria 739
199 Ga0307415_100087591 3300032126 Bacteria 2244
200 Ga0307415_100748245 3300032126 Bacteria 887
201 Ga0307415_100937841 3300032126 Bacteria 800
202 Ga0439465_0208224 3300041413 Bacteria 714
203 Ga0451789_0173346 3300041443 Bacteria 1704
204 Ga0451791_1235505 3300041451 Bacteria 1125
205 Ga0451793_0862503 3300041452 Bacteria 691
206 Ga0451793_1523369 3300041452 Bacteria 621
207 Ga0451797_0569745 3300041453 Bacteria 767
208 Ga0451797_1423590 3300041453 Bacteria 588
209 Ga0451833_0787947 3300041491 Bacteria 699
210 Ga0451833_1183190 3300041491 Bacteria 507
211 Ga0451837_1483773 3300041494 Bacteria 2110
212 Ga0451839_1337943 3300041496 Bacteria 673
213 Ga0451841_0882483 3300041498 Bacteria 739
214 Ga0451841_1070166 3300041498 Bacteria 1153
215 Ga0451847_0250487 3300041503 Bacteria 803
216 Ga0451851_0867469 3300041507 Bacteria 546
217 Ga0451853_2122226 3300041512 Bacteria 837
218 Ga0451853_2694252 3300041512 Bacteria 1073
219 Ga0451853_3530297 3300041512 Bacteria 840
220 Ga0450905_054789 3300042142 Bacteria 657
221 Ga0466972_0031817 3300044658 Bacteria 2593
222 Ga0466972_0382203 3300044658 Bacteria 659
223 Ga0466978_0583162 3300044671 Bacteria 555
224 Ga0466964_0797747 3300044706 Bacteria 533
225 Ga0466968_0018426 3300044735 Bacteria 2800
226 Ga0466970_0000846 3300044765 Bacteria 14735
227 Ga0466970_0041771 3300044765 Bacteria 2437
228 Ga0466970_0052394 3300044765 Bacteria 2178
229 Ga0466970_0060043 3300044765 Bacteria 2036
230 Ga0466957_0102797 3300044842 Bacteria 1803
231 Ga0466957_1200342 3300044842 Bacteria 549
232 Ga0466960_0133749 3300044901 Bacteria 1311
233 Ga0466959_0085010 3300045049 Bacteria 2277
234 Ga0466958_0086079 3300045836 Bacteria 1939
235 Ga0466967_0888310 3300045976 Bacteria 886
236 Ga0495638_0428517 3300046460 Bacteria 680
237 Ga0495650_0000130 3300046471 Bacteria 175669
238 Ga0495650_0170647 3300046471 Bacteria 770
239 Ga0495620_0119183 3300046515 Bacteria 1041
240 Ga0495628_0453530 3300046516 Bacteria 931
241 Ga0495654_0222165 3300046530 Bacteria 798
242 Ga0495598_0190074 3300046537 Bacteria 737
243 Ga0495645_0028254 3300046543 Bacteria 4076
244 Ga0495645_0066249 3300046543 Bacteria 2611
245 Ga0495675_0580446 3300047444 Bacteria 637
246 Ga0495686_0208100 3300047472 Bacteria 1119
247 Ga0495615_0080849 3300048090 Bacteria 891
248 Ga0496100_0003662 3300048903 Bacteria 8040
249 Ga0496100_0281847 3300048903 Bacteria 1239
250 Ga0496100_0978386 3300048903 Bacteria 665
251 Ga0496101_0028131 3300048904 Bacteria 3922
252 Ga0496101_0279097 3300048904 Bacteria 1305
253 Ga0496102_0241940 3300048905 Bacteria 1701
254 Ga0496102_0433748 3300048905 Bacteria 1233
255 Ga0496103_0333142 3300048906 Bacteria 976
256 Ga0496103_0783493 3300048906 Bacteria 602
257 Ga0496104_0019961 3300048907 Bacteria 6137
258 Ga0496104_0028751 3300048907 Bacteria 5152
259 Ga0496104_0226604 3300048907 Bacteria 1781
260 Ga0496104_0326442 3300048907 Bacteria 1447
261 Ga0496105_0062018 3300048908 Bacteria 3085
262 Ga0496105_0065811 3300048908 Bacteria 2991
263 Ga0496105_0404744 3300048908 Bacteria 1083
264 Ga0496106_1001727 3300048909 Bacteria 657
265 Ga0496107_0097904 3300048910 Bacteria 2148
266 Ga0496107_0146030 3300048910 Bacteria 1749
267 Ga0496108_0095200 3300048911 Bacteria 2535
268 Ga0496108_0933000 3300048911 Bacteria 744
269 Ga0496109_0065231 3300048912 Bacteria 3333
270 Ga0496109_0068062 3300048912 Bacteria 3263
271 Ga0496110_0186227 3300048913 Bacteria 1885
272 Ga0496110_0306187 3300048913 Bacteria 1447
273 Ga0496111_0005180 3300048914 Bacteria 8311
274 Ga0496112_0183013 3300048915 Bacteria 2059
275 Ga0496112_0391108 3300048915 Bacteria 1331
276 Ga0496113_0011004 3300048916 Bacteria 6012
277 Ga0496113_0243042 3300048916 Bacteria 1436
278 Ga0496114_0007662 3300048917 Bacteria 8536
279 Ga0496114_0027555 3300048917 Bacteria 4655
280 Ga0496114_0029376 3300048917 Bacteria 4518
281 Ga0496114_0060197 3300048917 Bacteria 3173
282 Ga0496114_0297298 3300048917 Bacteria 1425
283 Ga0496115_0004574 3300048918 Bacteria 10017
284 Ga0496115_0467967 3300048918 Bacteria 1016
285 Ga0496115_0527490 3300048918 Bacteria 946
286 Ga0496117_0034454 3300048920 Bacteria 3814
287 Ga0496117_0086765 3300048920 Bacteria 2032
288 Ga0496117_0135874 3300048920 Bacteria 1481
289 Ga0496117_0299255 3300048920 Bacteria 852
290 Ga0496117_0381356 3300048920 Bacteria 718
291 Ga0496118_0032807 3300048921 Bacteria 4270
292 Ga0496118_0049328 3300048921 Bacteria 3243
293 Ga0496118_0201121 3300048921 Bacteria 1180
294 Ga0496118_0241308 3300048921 Bacteria 1034
295 Ga0496118_0259388 3300048921 Bacteria 982
296 Ga0496118_0301023 3300048921 Bacteria 880
297 Ga0496118_0362377 3300048921 Bacteria 768
298 Ga0496118_0479431 3300048921 Bacteria 624
299 Ga0496119_0001781 3300048922 Bacteria 25111
300 Ga0496119_0003276 3300048922 Bacteria 16927
301 Ga0496119_0077063 3300048922 Bacteria 1932
302 Ga0496119_0131968 3300048922 Bacteria 1360
303 Ga0496120_0001628 3300048923 Bacteria 26017
304 Ga0496120_0016600 3300048923 Bacteria 4808
305 Ga0496120_0049116 3300048923 Bacteria 2423
306 Ga0496120_0061794 3300048923 Bacteria 2089
307 Ga0496120_0327745 3300048923 Bacteria 694
308 Ga0496121_0153623 3300048924 Bacteria 1691
309 Ga0496122_0011687 3300048925 Bacteria 8849
310 Ga0496123_0080165 3300048926 Bacteria 1991
311 Ga0496124_0134258 3300048927 Bacteria 1962
312 Ga0496125_0000085 3300048928 Bacteria 218570
313 Ga0496125_0178662 3300048928 Bacteria 1417
314 Ga0496125_0462166 3300048928 Bacteria 724
315 Ga0496126_0088071 3300048929 Bacteria 2736
316 Ga0496126_0102971 3300048929 Bacteria 2495
317 Ga0496126_0301134 3300048929 Bacteria 1323
318 Ga0496126_0400620 3300048929 Bacteria 1113
319 Ga0496126_0549644 3300048929 Bacteria 916
320 Ga0496126_0885565 3300048929 Bacteria 678
321 Ga0496126_0999369 3300048929 Bacteria 628
322 Ga0501032_0618486 3300049569 Bacteria 689
323 Ga0501034_0028672 3300049571 Bacteria 5664
324 Ga0501034_1079528 3300049571 Bacteria 684
325 Ga0501034_1641910 3300049571 Bacteria 515
326 Ga0501036_0701956 3300049572 Bacteria 836
327 Ga0501037_0508931 3300049573 Bacteria 816
328 Ga0501037_0522311 3300049573 Bacteria 803
329 Ga0501038_0005173 3300049574 Bacteria 12136
330 Ga0501038_0268357 3300049574 Bacteria 1346
331 Ga0501068_0703677 3300049584 Bacteria 661
332 Ga0501070_0001562 3300049586 Bacteria 20355
333 Ga0501070_0527246 3300049586 Bacteria 947
334 Ga0501081_1379419 3300049743 Bacteria 535
335 Ga0501044_1363158 3300049823 Bacteria 575
336 nmdc:mga03n38_48159_c1 3300050490 Bacteria 1890
337 nmdc:mga00v17_13837_c1 3300050491 Bacteria 4488
338 nmdc:mga00v17_180927_c1 3300050491 Bacteria 1360
339 nmdc:mga00v17_23810_c1 3300050491 Bacteria 3545
340 nmdc:mga00v17_46929_c1 3300050491 Bacteria 2615
341 nmdc:mga00v17_75670_c1 3300050491 Bacteria 2094
342 nmdc:mga0yw44_283069_c1 3300050492 Bacteria 1108
343 nmdc:mga0yw44_456908_c1 3300050492 Bacteria 866
344 nmdc:mga0yw44_929322_c1 3300050492 Bacteria 590
345 nmdc:mga06z11_106462_c1 3300050494 Bacteria 1546
346 nmdc:mga06z11_7825_c1 3300050494 Bacteria 4421
347 nmdc:mga04h51_81705_c1 3300050495 Bacteria 1148
348 nmdc:mga0sz30_15405_c1 3300050516 Bacteria 1257
349 nmdc:mga0sz30_33583_c1 3300050516 Bacteria 2133
350 nmdc:mga0sz30_469337_c1 3300050516 Bacteria 565
351 Ga0500635_0002023 3300053080 Bacteria 4953
352 Ga0500650_0013318 3300053098 Bacteria 3446
353 Ga0500562_052828 3300053108 Bacteria 1088
354 Ga0500559_0000460 3300053136 Bacteria 28961
355 Ga0500573_0000005 3300053140 Bacteria 315762
356 Ga0500573_0004687 3300053140 Bacteria 7236
357 Ga0500573_0008676 3300053140 Bacteria 5607
358 Ga0500573_0026270 3300053140 Bacteria 3347
359 Ga0500573_0060164 3300053140 Bacteria 2176
360 Ga0500573_0093208 3300053140 Bacteria 1699
361 Ga0500573_0226714 3300053140 Bacteria 976
362 Ga0500573_0287555 3300053140 Bacteria 828
363 Ga0500573_0461770 3300053140 Bacteria 584
364 Ga0500577_0010492 3300053142 Bacteria 2730
365 Ga0500577_0043854 3300053142 Bacteria 1646
366 Ga0500577_0089080 3300053142 Bacteria 1244
367 Ga0500577_0149620 3300053142 Bacteria 989
368 Ga0500590_038110 3300053148 Bacteria 2481
369 Ga0500620_038825 3300053155 Bacteria 1552
370 Ga0500645_011152 3300053730 Bacteria 2946

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003578 Ga0006562J51391_1188945 Ga0006562J51391_11889455 73
2 3300003578 Ga0006562J51391_1188946 Ga0006562J51391_11889462 73
3 3300006051 Ga0075364_10060692 Ga0075364_100606922 73
4 3300009036 Ga0105244_10035779 Ga0105244_100357795 73
5 3300009148 Ga0105243_10010736 Ga0105243_100107367 73
6 3300025728 Ga0207655_1017285 Ga0207655_10172852 73
7 3300025935 Ga0207709_10008409 Ga0207709_100084097 73
8 3300048928 Ga0496125_0000085 Ga0496125_0000085_207015_207260 73
9 3300049584 Ga0501068_0703677 Ga0501068_0703677_19_264 73
10 3300050491 nmdc:mga00v17_23810_c1 nmdc:mga00v17_23810_c1_1312_1557 73
11 3300050491 nmdc:mga00v17_75670_c1 nmdc:mga00v17_75670_c1_1365_1610 73
12 3300053136 Ga0500559_0000460 Ga0500559_0000460_25000_25221 73
13 3300053140 Ga0500573_0008676 Ga0500573_0008676_2184_2429 73
14 3300053140 Ga0500573_0093208 Ga0500573_0093208_1352_1597 73
15 3300053142 Ga0500577_0043854 Ga0500577_0043854_1240_1485 73
16 3300005331 Ga0070670_100667766 Ga0070670_1006677661 74
17 3300005337 Ga0070682_101061841 Ga0070682_1010618412 74
18 3300005437 Ga0070710_10813927 Ga0070710_108139272 74
19 3300005455 Ga0070663_100661998 Ga0070663_1006619982 74
20 3300005535 Ga0070684_100961437 Ga0070684_1009614372 74
21 3300005548 Ga0070665_100051468 Ga0070665_1000514685 74
22 3300005614 Ga0068856_100674751 Ga0068856_1006747512 74
23 3300006038 Ga0075365_10000832 Ga0075365_100008328 74
24 3300006038 Ga0075365_10012508 Ga0075365_100125082 74
25 3300006042 Ga0075368_10057237 Ga0075368_100572372 74
26 3300006048 Ga0075363_100017091 Ga0075363_1000170912 74
27 3300006051 Ga0075364_10035456 Ga0075364_100354563 74
28 3300006051 Ga0075364_11132238 Ga0075364_111322381 74
29 3300006178 Ga0075367_10041326 Ga0075367_100413262 74
30 3300006178 Ga0075367_10367964 Ga0075367_103679642 74
31 3300006186 Ga0075369_10012262 Ga0075369_100122622 74
32 3300006186 Ga0075369_10559709 Ga0075369_105597092 74
33 3300006353 Ga0075370_10010152 Ga0075370_100101525 74
34 3300009148 Ga0105243_10249676 Ga0105243_102496762 74
35 3300009545 Ga0105237_10552338 Ga0105237_105523381 74
36 3300013102 Ga0157371_10040540 Ga0157371_100405403 74
37 3300013105 Ga0157369_10030956 Ga0157369_100309563 74
38 3300013250 Ga0171462_1005 Ga0171462_1005367 74
39 3300013306 Ga0163162_10013891 Ga0163162_100138916 74
40 3300013306 Ga0163162_12110452 Ga0163162_121104522 74
41 3300013307 Ga0157372_10014843 Ga0157372_100148434 74
42 3300013307 Ga0157372_12941280 Ga0157372_129412801 74
43 3300013308 Ga0157375_10289402 Ga0157375_102894021 74
44 3300013308 Ga0157375_10605463 Ga0157375_106054632 74
45 3300014326 Ga0157380_10333903 Ga0157380_103339032 74
46 3300017792 Ga0163161_10641184 Ga0163161_106411841 74
47 3300020081 Ga0206354_10299183 Ga0206354_102991832 74
48 3300025914 Ga0207671_10138672 Ga0207671_101386721 74
49 3300025920 Ga0207649_10852924 Ga0207649_108529241 74
50 3300025935 Ga0207709_10536183 Ga0207709_105361832 74
51 3300025972 Ga0207668_11295985 Ga0207668_112959851 74
52 3300026067 Ga0207678_10993256 Ga0207678_109932561 74
53 3300026121 Ga0207683_10474070 Ga0207683_104740702 74
54 3300027866 Ga0209813_10094093 Ga0209813_100940932 74
55 3300028379 Ga0268266_10460192 Ga0268266_104601922 74
56 3300031824 Ga0307413_10144723 Ga0307413_101447232 74
57 3300031824 Ga0307413_10191854 Ga0307413_101918542 74
58 3300031824 Ga0307413_10298182 Ga0307413_102981822 74
59 3300031852 Ga0307410_10189039 Ga0307410_101890391 74
60 3300031852 Ga0307410_11757675 Ga0307410_117576752 74
61 3300031901 Ga0307406_10013091 Ga0307406_100130912 74
62 3300031901 Ga0307406_10479176 Ga0307406_104791762 74
63 3300031901 Ga0307406_11106332 Ga0307406_111063321 74
64 3300031901 Ga0307406_11921990 Ga0307406_119219902 74
65 3300031903 Ga0307407_10333994 Ga0307407_103339942 74
66 3300031903 Ga0307407_11645916 Ga0307407_116459162 74
67 3300031911 Ga0307412_10115242 Ga0307412_101152422 74
68 3300031911 Ga0307412_10507606 Ga0307412_105076061 74
69 3300031995 Ga0307409_100134924 Ga0307409_1001349243 74
70 3300031995 Ga0307409_100636766 Ga0307409_1006367661 74
71 3300031995 Ga0307409_101725243 Ga0307409_1017252431 74
72 3300032002 Ga0307416_100110907 Ga0307416_1001109072 74
73 3300032002 Ga0307416_101182210 Ga0307416_1011822102 74
74 3300032002 Ga0307416_102435753 Ga0307416_1024357531 74
75 3300032004 Ga0307414_10307988 Ga0307414_103079882 74
76 3300032004 Ga0307414_10531102 Ga0307414_105311022 74
77 3300032004 Ga0307414_11084476 Ga0307414_110844762 74
78 3300032126 Ga0307415_100087591 Ga0307415_1000875912 74
79 3300032126 Ga0307415_100748245 Ga0307415_1007482452 74
80 3300032126 Ga0307415_100937841 Ga0307415_1009378412 74
81 3300041413 Ga0439465_0208224 Ga0439465_0208224_219_467 74
82 3300041443 Ga0451789_0173346 Ga0451789_0173346_491_739 74
83 3300041452 Ga0451793_0862503 Ga0451793_0862503_177_425 74
84 3300041452 Ga0451793_1523369 Ga0451793_1523369_136_384 74
85 3300041496 Ga0451839_1337943 Ga0451839_1337943_179_427 74
86 3300041503 Ga0451847_0250487 Ga0451847_0250487_503_751 74
87 3300041507 Ga0451851_0867469 Ga0451851_0867469_130_378 74
88 3300041512 Ga0451853_2694252 Ga0451853_2694252_134_382 74
89 3300041512 Ga0451853_3530297 Ga0451853_3530297_443_691 74
90 3300042142 Ga0450905_054789 Ga0450905_054789_16_264 74
91 3300044658 Ga0466972_0031817 Ga0466972_0031817_122_370 74
92 3300044671 Ga0466978_0583162 Ga0466978_0583162_208_456 74
93 3300044706 Ga0466964_0797747 Ga0466964_0797747_220_468 74
94 3300044735 Ga0466968_0018426 Ga0466968_0018426_1156_1404 74
95 3300044765 Ga0466970_0000846 Ga0466970_0000846_7578_7826 74
96 3300044765 Ga0466970_0052394 Ga0466970_0052394_851_1099 74
97 3300044842 Ga0466957_1200342 Ga0466957_1200342_198_446 74
98 3300044901 Ga0466960_0133749 Ga0466960_0133749_171_419 74
99 3300045836 Ga0466958_0086079 Ga0466958_0086079_779_1027 74
100 3300045976 Ga0466967_0888310 Ga0466967_0888310_544_792 74
101 3300046460 Ga0495638_0428517 Ga0495638_0428517_364_612 74
102 3300046471 Ga0495650_0170647 Ga0495650_0170647_188_436 74
103 3300046515 Ga0495620_0119183 Ga0495620_0119183_80_328 74
104 3300046530 Ga0495654_0222165 Ga0495654_0222165_178_426 74
105 3300046537 Ga0495598_0190074 Ga0495598_0190074_127_375 74
106 3300046543 Ga0495645_0028254 Ga0495645_0028254_116_364 74
107 3300046543 Ga0495645_0066249 Ga0495645_0066249_150_398 74
108 3300047444 Ga0495675_0580446 Ga0495675_0580446_177_425 74
109 3300047472 Ga0495686_0208100 Ga0495686_0208100_730_978 74
110 3300048090 Ga0495615_0080849 Ga0495615_0080849_336_584 74
111 3300048903 Ga0496100_0003662 Ga0496100_0003662_5671_5919 74
112 3300048903 Ga0496100_0281847 Ga0496100_0281847_32_280 74
113 3300048904 Ga0496101_0279097 Ga0496101_0279097_902_1150 74
114 3300048905 Ga0496102_0433748 Ga0496102_0433748_191_439 74
115 3300048906 Ga0496103_0333142 Ga0496103_0333142_563_811 74
116 3300048907 Ga0496104_0028751 Ga0496104_0028751_2948_3196 74
117 3300048907 Ga0496104_0226604 Ga0496104_0226604_426_674 74
118 3300048907 Ga0496104_0326442 Ga0496104_0326442_215_463 74
119 3300048908 Ga0496105_0062018 Ga0496105_0062018_2137_2385 74
120 3300048908 Ga0496105_0404744 Ga0496105_0404744_517_765 74
121 3300048910 Ga0496107_0097904 Ga0496107_0097904_1772_2020 74
122 3300048911 Ga0496108_0095200 Ga0496108_0095200_918_1166 74
123 3300048911 Ga0496108_0933000 Ga0496108_0933000_102_350 74
124 3300048912 Ga0496109_0065231 Ga0496109_0065231_1951_2199 74
125 3300048912 Ga0496109_0068062 Ga0496109_0068062_2199_2447 74
126 3300048913 Ga0496110_0186227 Ga0496110_0186227_560_808 74
127 3300048913 Ga0496110_0306187 Ga0496110_0306187_202_450 74
128 3300048914 Ga0496111_0005180 Ga0496111_0005180_2450_2698 74
129 3300048915 Ga0496112_0183013 Ga0496112_0183013_846_1094 74
130 3300048915 Ga0496112_0391108 Ga0496112_0391108_1011_1259 74
131 3300048916 Ga0496113_0011004 Ga0496113_0011004_3259_3507 74
132 3300048916 Ga0496113_0243042 Ga0496113_0243042_1120_1368 74
133 3300048917 Ga0496114_0007662 Ga0496114_0007662_8131_8379 74
134 3300048917 Ga0496114_0027555 Ga0496114_0027555_2171_2419 74
135 3300048917 Ga0496114_0029376 Ga0496114_0029376_2333_2581 74
136 3300048917 Ga0496114_0297298 Ga0496114_0297298_176_424 74
137 3300048918 Ga0496115_0004574 Ga0496115_0004574_8369_8617 74
138 3300048918 Ga0496115_0467967 Ga0496115_0467967_363_611 74
139 3300048918 Ga0496115_0527490 Ga0496115_0527490_669_917 74
140 3300048920 Ga0496117_0135874 Ga0496117_0135874_131_379 74
141 3300048920 Ga0496117_0381356 Ga0496117_0381356_426_674 74
142 3300048921 Ga0496118_0049328 Ga0496118_0049328_1840_2088 74
143 3300048921 Ga0496118_0479431 Ga0496118_0479431_36_284 74
144 3300048922 Ga0496119_0003276 Ga0496119_0003276_2317_2565 74
145 3300048922 Ga0496119_0131968 Ga0496119_0131968_190_438 74
146 3300048923 Ga0496120_0327745 Ga0496120_0327745_37_285 74
147 3300048925 Ga0496122_0011687 Ga0496122_0011687_1871_2119 74
148 3300048926 Ga0496123_0080165 Ga0496123_0080165_1125_1373 74
149 3300048927 Ga0496124_0134258 Ga0496124_0134258_1509_1757 74
150 3300048928 Ga0496125_0178662 Ga0496125_0178662_467_715 74
151 3300048929 Ga0496126_0301134 Ga0496126_0301134_423_671 74
152 3300048929 Ga0496126_0885565 Ga0496126_0885565_325_573 74
153 3300049569 Ga0501032_0618486 Ga0501032_0618486_150_398 74
154 3300049571 Ga0501034_0028672 Ga0501034_0028672_501_749 74
155 3300049571 Ga0501034_1079528 Ga0501034_1079528_314_562 74
156 3300049572 Ga0501036_0701956 Ga0501036_0701956_536_784 74
157 3300049573 Ga0501037_0508931 Ga0501037_0508931_548_796 74
158 3300049573 Ga0501037_0522311 Ga0501037_0522311_120_368 74
159 3300049574 Ga0501038_0005173 Ga0501038_0005173_3149_3397 74
160 3300049574 Ga0501038_0268357 Ga0501038_0268357_119_367 74
161 3300049586 Ga0501070_0001562 Ga0501070_0001562_11200_11448 74
162 3300049586 Ga0501070_0527246 Ga0501070_0527246_615_863 74
163 3300049743 Ga0501081_1379419 Ga0501081_1379419_162_410 74
164 3300049823 Ga0501044_1363158 Ga0501044_1363158_153_401 74
165 3300050490 nmdc:mga03n38_48159_c1 nmdc:mga03n38_48159_c1_729_977 74
166 3300050491 nmdc:mga00v17_13837_c1 nmdc:mga00v17_13837_c1_4070_4318 74
167 3300050491 nmdc:mga00v17_46929_c1 nmdc:mga00v17_46929_c1_472_720 74
168 3300050492 nmdc:mga0yw44_456908_c1 nmdc:mga0yw44_456908_c1_497_745 74
169 3300050492 nmdc:mga0yw44_929322_c1 nmdc:mga0yw44_929322_c1_138_386 74
170 3300050494 nmdc:mga06z11_106462_c1 nmdc:mga06z11_106462_c1_127_375 74
171 3300050494 nmdc:mga06z11_7825_c1 nmdc:mga06z11_7825_c1_2428_2676 74
172 3300050495 nmdc:mga04h51_81705_c1 nmdc:mga04h51_81705_c1_563_811 74
173 3300050516 nmdc:mga0sz30_15405_c1 nmdc:mga0sz30_15405_c1_914_1162 74
174 3300050516 nmdc:mga0sz30_33583_c1 nmdc:mga0sz30_33583_c1_660_908 74
175 3300053108 Ga0500562_052828 Ga0500562_052828_405_653 74
176 3300053140 Ga0500573_0226714 Ga0500573_0226714_308_556 74
177 3300053140 Ga0500573_0287555 Ga0500573_0287555_366_614 74
178 iso_pu_bacteria 2643221566 2643847445 74
179 iso_pu_bacteria 2643221575 2643887448 74
180 iso_pu_bacteria 2643221597 2643997439 74
181 iso_pu_bacteria 2773857763 2774401188 74
182 iso_pu_bacteria 2808606306 2808629535 74
183 iso_pu_bacteria 2808606447 2809225679 74
184 iso_pu_bacteria 2811994872 2812325300 74
185 iso_pu_bacteria 2821268502 2821271961 74
186 iso_pu_bacteria 2833709550 2833712984 74
187 iso_pu_bacteria 2852632344 2852635462 74
188 iso_pu_bacteria 2857723135 2857726888 74
189 iso_pu_bacteria 2906799679 2906803503 74
190 iso_pu_bacteria 2919395869 2919396945 74
191 iso_pu_bacteria 2946033335 2946035305 74
192 iso_pu_bacteria 8004212874 8004215252 74
193 iso_pu_bacteria 8045830549 8045833342 74
194 iso_pu_bacteria 2939660829 2939661629 75
195 3300009094 Ga0111539_10545510 Ga0111539_105455102 76
196 3300013104 Ga0157370_11424717 Ga0157370_114247172 76
197 3300013306 Ga0163162_10501023 Ga0163162_105010231 76
198 3300013307 Ga0157372_11293760 Ga0157372_112937601 76
199 3300025924 Ga0207694_10392801 Ga0207694_103928012 76
200 3300026118 Ga0207675_102401349 Ga0207675_1024013492 76
201 3300041491 Ga0451833_0787947 Ga0451833_0787947_242_487 76
202 3300053098 Ga0500650_0013318 Ga0500650_0013318_940_1209 76
203 3300053140 Ga0500573_0000005 Ga0500573_0000005_251925_252158 76
204 3300053140 Ga0500573_0026270 Ga0500573_0026270_405_662 76
205 3300053142 Ga0500577_0010492 Ga0500577_0010492_2001_2270 76
206 3300053142 Ga0500577_0149620 Ga0500577_0149620_294_563 76
207 iso_pu_bacteria 2643221572 2643876892 76
208 iso_pu_bacteria 2643221669 2644383947 76
209 iso_pu_bacteria 2893684298 2893685488 76
210 iso_pu_bacteria 2895660088 2895663021 76
211 iso_pu_bacteria 2966921586 2966923734 76
212 3300001979 JGI24740J21852_10051490 JGI24740J21852_100514902 77
213 3300002772 JGI25164J39214_1001748 JGI25164J39214_10017485 77
214 3300003214 JGI25165J46597_1001642 JGI25165J46597_10016423 77
215 3300003752 Ga0055539_1000069 Ga0055539_100006923 77
216 3300003756 Ga0055533_1000037 Ga0055533_100003724 77
217 3300003759 Ga0055525_1000308 Ga0055525_100030823 77
218 3300003762 Ga0055542_1000048 Ga0055542_100004847 77
219 3300003763 Ga0055529_1000057 Ga0055529_1000057134 77
220 3300003841 Ga0055541_1003380 Ga0055541_10033802 77
221 3300005327 Ga0070658_10017455 Ga0070658_100174554 77
222 3300005327 Ga0070658_10282338 Ga0070658_102823383 77
223 3300005334 Ga0068869_100764504 Ga0068869_1007645042 77
224 3300005335 Ga0070666_10272675 Ga0070666_102726753 77
225 3300005337 Ga0070682_100569861 Ga0070682_1005698611 77
226 3300005337 Ga0070682_100657641 Ga0070682_1006576412 77
227 3300005337 Ga0070682_101697022 Ga0070682_1016970221 77
228 3300005338 Ga0068868_100429097 Ga0068868_1004290972 77
229 3300005339 Ga0070660_100042788 Ga0070660_1000427882 77
230 3300005366 Ga0070659_100001648 Ga0070659_1000016484 77
231 3300005366 Ga0070659_101226140 Ga0070659_1012261402 77
232 3300005367 Ga0070667_100011846 Ga0070667_1000118468 77
233 3300005455 Ga0070663_101302329 Ga0070663_1013023291 77
234 3300005466 Ga0070685_10009839 Ga0070685_100098395 77
235 3300005535 Ga0070684_101266097 Ga0070684_1012660972 77
236 3300005539 Ga0068853_100039432 Ga0068853_1000394325 77
237 3300005539 Ga0068853_101816419 Ga0068853_1018164192 77
238 3300005543 Ga0070672_100520952 Ga0070672_1005209522 77
239 3300005563 Ga0068855_100012913 Ga0068855_1000129139 77
240 3300005563 Ga0068855_100151154 Ga0068855_1001511544 77
241 3300005577 Ga0068857_100001313 Ga0068857_1000013134 77
242 3300005577 Ga0068857_100560065 Ga0068857_1005600652 77
243 3300005577 Ga0068857_101113730 Ga0068857_1011137302 77
244 3300005578 Ga0068854_100126772 Ga0068854_1001267723 77
245 3300005614 Ga0068856_100214190 Ga0068856_1002141904 77
246 3300005614 Ga0068856_100632889 Ga0068856_1006328893 77
247 3300005616 Ga0068852_100020666 Ga0068852_1000206662 77
248 3300005616 Ga0068852_100183645 Ga0068852_1001836452 77
249 3300005618 Ga0068864_101004103 Ga0068864_1010041031 77
250 3300005834 Ga0068851_10000030 Ga0068851_1000003058 77
251 3300005841 Ga0068863_100087658 Ga0068863_1000876582 77
252 3300005841 Ga0068863_100340702 Ga0068863_1003407023 77
253 3300005841 Ga0068863_100745348 Ga0068863_1007453482 77
254 3300006051 Ga0075364_10720487 Ga0075364_107204872 77
255 3300006173 Ga0070716_100571149 Ga0070716_1005711492 77
256 3300009093 Ga0105240_12104512 Ga0105240_121045121 77
257 3300009101 Ga0105247_10065767 Ga0105247_100657674 77
258 3300009101 Ga0105247_10673393 Ga0105247_106733932 77
259 3300009174 Ga0105241_10001584 Ga0105241_1000158419 77
260 3300009174 Ga0105241_10696371 Ga0105241_106963712 77
261 3300009545 Ga0105237_10000724 Ga0105237_1000072418 77
262 3300009545 Ga0105237_10032536 Ga0105237_100325364 77
263 3300009545 Ga0105237_10602535 Ga0105237_106025352 77
264 3300009551 Ga0105238_10014754 Ga0105238_100147545 77
265 3300009551 Ga0105238_10514835 Ga0105238_105148352 77
266 3300009551 Ga0105238_12741427 Ga0105238_127414272 77
267 3300010375 Ga0105239_10387675 Ga0105239_103876753 77
268 3300010375 Ga0105239_11783907 Ga0105239_117839072 77
269 3300010375 Ga0105239_13183921 Ga0105239_131839211 77
270 3300011119 Ga0105246_10891238 Ga0105246_108912382 77
271 3300013104 Ga0157370_10827193 Ga0157370_108271932 77
272 3300013296 Ga0157374_10059350 Ga0157374_100593503 77
273 3300013296 Ga0157374_10624056 Ga0157374_106240562 77
274 3300013306 Ga0163162_10720197 Ga0163162_107201972 77
275 3300013307 Ga0157372_10693486 Ga0157372_106934862 77
276 3300014325 Ga0163163_10190561 Ga0163163_101905612 77
277 3300014968 Ga0157379_10028212 Ga0157379_100282124 77
278 3300014969 Ga0157376_10332860 Ga0157376_103328601 77
279 3300014969 Ga0157376_10806751 Ga0157376_108067512 77
280 3300025225 Ga0209566_100283 Ga0209566_10028324 77
281 3300025226 Ga0209674_100001 Ga0209674_1000012173 77
282 3300025230 Ga0209563_100001 Ga0209563_1000012173 77
283 3300025230 Ga0209563_101620 Ga0209563_1016202 77
284 3300025231 Ga0207427_100028 Ga0207427_100028160 77
285 3300025233 Ga0209437_100557 Ga0209437_10055725 77
286 3300025253 Ga0209677_100001 Ga0209677_1000012173 77
287 3300025254 Ga0209148_1000744 Ga0209148_100074416 77
288 3300025261 Ga0209233_1000001 Ga0209233_1000001658 77
289 3300025321 Ga0207656_10000001 Ga0207656_100000011065 77
290 3300025904 Ga0207647_10072665 Ga0207647_100726653 77
291 3300025909 Ga0207705_10144958 Ga0207705_101449582 77
292 3300025909 Ga0207705_10197476 Ga0207705_101974762 77
293 3300025909 Ga0207705_11010891 Ga0207705_110108912 77
294 3300025911 Ga0207654_10000001 Ga0207654_10000001380 77
295 3300025913 Ga0207695_10001789 Ga0207695_100017899 77
296 3300025913 Ga0207695_10018544 Ga0207695_100185447 77
297 3300025914 Ga0207671_10000001 Ga0207671_100000011064 77
298 3300025914 Ga0207671_10076986 Ga0207671_100769862 77
299 3300025919 Ga0207657_10001206 Ga0207657_1000120624 77
300 3300025924 Ga0207694_10004764 Ga0207694_100047649 77
301 3300025924 Ga0207694_10650348 Ga0207694_106503482 77
302 3300025932 Ga0207690_10001234 Ga0207690_1000123415 77
303 3300025939 Ga0207665_10435552 Ga0207665_104355522 77
304 3300025940 Ga0207691_10069349 Ga0207691_100693496 77
305 3300025941 Ga0207711_10006178 Ga0207711_1000617813 77
306 3300025942 Ga0207689_10554984 Ga0207689_105549842 77
307 3300025949 Ga0207667_10005520 Ga0207667_100055202 77
308 3300025949 Ga0207667_10013652 Ga0207667_100136525 77
309 3300025949 Ga0207667_10102152 Ga0207667_101021522 77
310 3300025949 Ga0207667_10128065 Ga0207667_101280654 77
311 3300025949 Ga0207667_10995982 Ga0207667_109959821 77
312 3300025981 Ga0207640_10270998 Ga0207640_102709982 77
313 3300025986 Ga0207658_10172429 Ga0207658_101724292 77
314 3300026023 Ga0207677_10159093 Ga0207677_101590933 77
315 3300026023 Ga0207677_10712434 Ga0207677_107124342 77
316 3300026041 Ga0207639_10028340 Ga0207639_100283405 77
317 3300026041 Ga0207639_11287824 Ga0207639_112878242 77
318 3300026078 Ga0207702_10070763 Ga0207702_100707634 77
319 3300026078 Ga0207702_10312404 Ga0207702_103124043 77
320 3300026078 Ga0207702_11007795 Ga0207702_110077952 77
321 3300026088 Ga0207641_10447189 Ga0207641_104471892 77
322 3300026088 Ga0207641_11148135 Ga0207641_111481352 77
323 3300026088 Ga0207641_11419252 Ga0207641_114192522 77
324 3300026095 Ga0207676_10290576 Ga0207676_102905762 77
325 3300026116 Ga0207674_10014478 Ga0207674_100144782 77
326 3300026116 Ga0207674_10194950 Ga0207674_101949502 77
327 3300026116 Ga0207674_10517991 Ga0207674_105179912 77
328 3300026116 Ga0207674_11272451 Ga0207674_112724512 77
329 3300026121 Ga0207683_10548415 Ga0207683_105484152 77
330 3300026142 Ga0207698_10013631 Ga0207698_100136318 77
331 3300026142 Ga0207698_10013948 Ga0207698_100139488 77
332 3300026142 Ga0207698_10084417 Ga0207698_100844174 77
333 3300031456 Ga0307513_10066088 Ga0307513_100660884 77
334 3300032004 Ga0307414_11018565 Ga0307414_110185652 77
335 3300041451 Ga0451791_1235505 Ga0451791_1235505_613_849 77
336 3300041453 Ga0451797_0569745 Ga0451797_0569745_122_358 77
337 3300041453 Ga0451797_1423590 Ga0451797_1423590_119_355 77
338 3300041491 Ga0451833_1183190 Ga0451833_1183190_69_305 77
339 3300041494 Ga0451837_1483773 Ga0451837_1483773_1744_1980 77
340 3300041498 Ga0451841_0882483 Ga0451841_0882483_30_308 77
341 3300041498 Ga0451841_1070166 Ga0451841_1070166_746_982 77
342 3300041512 Ga0451853_2122226 Ga0451853_2122226_129_416 77
343 3300044658 Ga0466972_0382203 Ga0466972_0382203_167_427 77
344 3300044765 Ga0466970_0041771 Ga0466970_0041771_1594_1854 77
345 3300044765 Ga0466970_0060043 Ga0466970_0060043_1095_1355 77
346 3300044842 Ga0466957_0102797 Ga0466957_0102797_1516_1776 77
347 3300045049 Ga0466959_0085010 Ga0466959_0085010_43_303 77
348 3300046471 Ga0495650_0000130 Ga0495650_0000130_147052_147312 77
349 3300046516 Ga0495628_0453530 Ga0495628_0453530_528_794 77
350 3300048903 Ga0496100_0978386 Ga0496100_0978386_161_445 77
351 3300048904 Ga0496101_0028131 Ga0496101_0028131_2247_2531 77
352 3300048905 Ga0496102_0241940 Ga0496102_0241940_126_410 77
353 3300048906 Ga0496103_0783493 Ga0496103_0783493_10_297 77
354 3300048907 Ga0496104_0019961 Ga0496104_0019961_3257_3541 77
355 3300048908 Ga0496105_0065811 Ga0496105_0065811_1014_1298 77
356 3300048909 Ga0496106_1001727 Ga0496106_1001727_231_515 77
357 3300048910 Ga0496107_0146030 Ga0496107_0146030_1260_1544 77
358 3300048917 Ga0496114_0060197 Ga0496114_0060197_1145_1429 77
359 3300048920 Ga0496117_0034454 Ga0496117_0034454_1765_2052 77
360 3300048920 Ga0496117_0086765 Ga0496117_0086765_597_833 77
361 3300048920 Ga0496117_0299255 Ga0496117_0299255_447_731 77
362 3300048921 Ga0496118_0032807 Ga0496118_0032807_1837_2124 77
363 3300048921 Ga0496118_0201121 Ga0496118_0201121_575_853 77
364 3300048921 Ga0496118_0241308 Ga0496118_0241308_292_528 77
365 3300048921 Ga0496118_0259388 Ga0496118_0259388_553_834 77
366 3300048921 Ga0496118_0301023 Ga0496118_0301023_306_590 77
367 3300048921 Ga0496118_0362377 Ga0496118_0362377_70_357 77
368 3300048922 Ga0496119_0001781 Ga0496119_0001781_19425_19712 77
369 3300048922 Ga0496119_0077063 Ga0496119_0077063_240_524 77
370 3300048923 Ga0496120_0001628 Ga0496120_0001628_5476_5763 77
371 3300048923 Ga0496120_0016600 Ga0496120_0016600_4222_4503 77
372 3300048923 Ga0496120_0049116 Ga0496120_0049116_1637_1909 77
373 3300048923 Ga0496120_0061794 Ga0496120_0061794_670_954 77
374 3300048924 Ga0496121_0153623 Ga0496121_0153623_465_749 77
375 3300048928 Ga0496125_0462166 Ga0496125_0462166_362_643 77
376 3300048929 Ga0496126_0088071 Ga0496126_0088071_1656_1937 77
377 3300048929 Ga0496126_0102971 Ga0496126_0102971_2028_2306 77
378 3300048929 Ga0496126_0400620 Ga0496126_0400620_161_397 77
379 3300048929 Ga0496126_0549644 Ga0496126_0549644_553_837 77
380 3300048929 Ga0496126_0999369 Ga0496126_0999369_88_324 77
381 3300049571 Ga0501034_1641910 Ga0501034_1641910_11_274 77
382 3300050491 nmdc:mga00v17_180927_c1 nmdc:mga00v17_180927_c1_389_655 77
383 3300050492 nmdc:mga0yw44_283069_c1 nmdc:mga0yw44_283069_c1_172_444 77
384 3300050516 nmdc:mga0sz30_469337_c1 nmdc:mga0sz30_469337_c1_71_364 77
385 3300053080 Ga0500635_0002023 Ga0500635_0002023_3725_3997 77
386 3300053140 Ga0500573_0004687 Ga0500573_0004687_6918_7178 77
387 3300053140 Ga0500573_0060164 Ga0500573_0060164_1345_1629 77
388 3300053140 Ga0500573_0461770 Ga0500573_0461770_54_299 77
389 3300053142 Ga0500577_0089080 Ga0500577_0089080_346_630 77
390 3300053148 Ga0500590_038110 Ga0500590_038110_416_682 77
391 3300053155 Ga0500620_038825 Ga0500620_038825_641_907 77
392 3300053730 Ga0500645_011152 Ga0500645_011152_1229_1522 77
393 iso_pu_bacteria 2643221546 2643751934 77
394 iso_pu_bacteria 2852643534 2852644127 77
395 iso_pu_bacteria 2928121344 2928121734 77
396 iso_pu_bacteria 2935409751 2935413306 77
397 iso_pu_bacteria 2939657138 2939660587 77
398 iso_pu_bacteria 2966924647 2966927544 77

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02700

PurS

Phosphoribosylformylglycinamidine (FGAM) synthase

7

83

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p5m-assembly1.cif.gz_A c-terminal domain hexamer of ahrc bound with l-arginine 0.5506 10 54
3v4g-assembly1.cif.gz_A 1.60 angstrom resolution crystal structure of an arginine repressor from vibrio vulnificus cmcp6 0.5188 11 54
6wjp-assembly1.cif.gz_A-2 crystal structure of arginine repressor p115q mutant from the pathogenic bacterium corynebacterium pseudotuberculosis bound to arginine 0.4957 11 53
5jvo-assembly1.cif.gz_A crystal structure of the arginine repressor from the pathogenic bacterium corynebacterium pseudotuberculosis 0.495 11 53
6mrr-assembly1.cif.gz_A de novo designed protein foldit1 0.4931 12 55
ID Description Score Start End Superfamily
af_Q58447_1_72_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.5591 1 54 3.30.300.20
2p5mA00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.5506 10 54 3.30.1360.40
4lowB00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.5276 12 54 3.30.1360.20
af_Q17651_2_369_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.5218 10 39 1.10.510.10
3v4gA02 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.519 11 54 3.30.1360.40
ID Description Score Start End GO Terms
AF-A0A2N0QPI7-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) 0.7825 8 72 GO:0004639
GO:0004642
GO:0005524
GO:0006189
AF-A0A2N0QPI7-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) 0.6616 8 72 GO:0004639
GO:0004642
GO:0005524
GO:0006189
AF-A0A2E0MPN2-F1-model_v4 deleted 0.5735 16 67
AF-A0A1I2LI13-F1-model_v4 Chromosome partitioning protein, ParB family 0.5422 1 57 GO:0003677
GO:0005694
GO:0007059
GO:0045881
AF-A0A4D4K7V4-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS 0.5384 16 77 GO:0004642
GO:0005524
GO:0005737
GO:0009152

Feature Viewer

pLDDT pTM Quality
84.42 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map