F434144

General Info

Members Datasets Scaffolds Average Seq Length
398 246 398 321

Family's Representative Sequence

Representative Sequence 3300047321|Ga0495676_0000400|Ga0495676_0000400_11227_12276
Length 349
Sequence MSSGPPPRTCSVSEPVATAELIEDRGEAAVSSDFFRSRPFLDAEAVTHTLRIDIGDAELLAPVLVREIPLPPSRNIDPEETYRPIEPLFDAVSPYAYPGLVPPPSERISPRYAGTTAFEMDPAEIDFSATGLVSLFLRHRLGPAPLTGTTERTAVQIADPALPPKSRPSDRRQIRKNLEAGYAVTLVPGPQTTPAQRAGFLDVYEQTMRRTDAAEHYFFGASYFDRALEAAGTWLALATAPDRSLAAASFAATSDGFLHYYLSGSADSHLRDSPMKNIVARLIELSAELNLPLNLGSGISPGDPLEEFKRGFANRQEPWQTSELICNPEKYALLSADHPRGGFFPAYRA

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
122 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
123 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
124 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
128 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
239 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
243 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
244 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
245 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.76
Nodule 0
Rhizoplane 9.05
Rhizosphere 84.17
Stem 0
Stem Tuber 0
Unclassified 4.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000405 3300001977 Bacteria 6405
2 JGI24740J21852_10015307 3300001979 Bacteria 2805
3 JGI24748J21848_1000153 3300002074 Bacteria 10692
4 JGI24034J26672_10000074 3300002239 Bacteria 24671
5 JGI25404J52841_10001611 3300003659 Bacteria 4027
6 Ga0070683_100000190 3300005329 Bacteria 41133
7 Ga0070683_100026488 3300005329 Bacteria 5222
8 Ga0070683_100044735 3300005329 Bacteria 4084
9 Ga0070690_100132560 3300005330 Bacteria 1684
10 Ga0070670_100038748 3300005331 Bacteria 4098
11 Ga0070677_10000048 3300005333 Bacteria 37331
12 Ga0070666_10085952 3300005335 Bacteria 2155
13 Ga0070682_100000016 3300005337 Bacteria 239799
14 Ga0068868_100000451 3300005338 Bacteria 27446
15 Ga0068868_100005673 3300005338 Bacteria 8788
16 Ga0070660_100181885 3300005339 Bacteria 1701
17 Ga0070691_10000006 3300005341 Bacteria 66177
18 Ga0070661_100000217 3300005344 Bacteria 47669
19 Ga0070668_100004533 3300005347 Bacteria 10308
20 Ga0070675_100000429 3300005354 Bacteria 28542
21 Ga0070674_100000033 3300005356 Bacteria 63982
22 Ga0070674_100000241 3300005356 Bacteria 27097
23 Ga0070673_100061197 3300005364 Bacteria 2986
24 Ga0070688_100000225 3300005365 Bacteria 29663
25 Ga0070688_100000468 3300005365 Bacteria 20469
26 Ga0070688_100014171 3300005365 Bacteria 4514
27 Ga0070659_100005667 3300005366 Bacteria 8978
28 Ga0070667_100036060 3300005367 Bacteria 4145
29 Ga0070667_100040624 3300005367 Bacteria 3901
30 Ga0070667_100186694 3300005367 Bacteria 1835
31 Ga0070667_100366095 3300005367 Unclassified 1307
32 Ga0070714_100008433 3300005435 Bacteria 8048
33 Ga0070713_100023846 3300005436 Bacteria 4756
34 Ga0070711_100008682 3300005439 Bacteria 6232
35 Ga0070711_100108847 3300005439 Bacteria 2031
36 Ga0070663_100000641 3300005455 Bacteria 18754
37 Ga0070663_100207363 3300005455 Unclassified 1533
38 Ga0070678_100035596 3300005456 Bacteria 3478
39 Ga0070662_100000008 3300005457 Bacteria 168754
40 Ga0070681_10003882 3300005458 Bacteria 14072
41 Ga0068867_100000179 3300005459 Bacteria 41694
42 Ga0070685_10000124 3300005466 Bacteria 49061
43 Ga0070685_10116617 3300005466 Bacteria 1653
44 Ga0070679_100000823 3300005530 Bacteria 26958
45 Ga0070679_100001824 3300005530 Bacteria 19214
46 Ga0070684_100072078 3300005535 Bacteria 3040
47 Ga0068853_100001640 3300005539 Bacteria 16358
48 Ga0070672_100000039 3300005543 Bacteria 57491
49 Ga0070686_100188946 3300005544 Bacteria 1469
50 Ga0070693_100000793 3300005547 Bacteria 13960
51 Ga0070665_100000120 3300005548 Bacteria 148340
52 Ga0070665_100000725 3300005548 Bacteria 43927
53 Ga0070665_100123267 3300005548 Bacteria 2594
54 Ga0070665_100152684 3300005548 Bacteria 2312
55 Ga0070665_100208389 3300005548 Bacteria 1955
56 Ga0070664_100068607 3300005564 Bacteria 3032
57 Ga0070664_100093239 3300005564 Bacteria 2609
58 Ga0068854_100001877 3300005578 Bacteria 12812
59 Ga0068856_100000403 3300005614 Bacteria 47397
60 Ga0068856_100012776 3300005614 Bacteria 8130
61 Ga0068852_100000013 3300005616 Bacteria 139537
62 Ga0068864_100000044 3300005618 Bacteria 157919
63 Ga0068866_10000002 3300005718 Bacteria 394090
64 Ga0068851_10001155 3300005834 Bacteria 11453
65 Ga0068851_10001306 3300005834 Bacteria 10862
66 Ga0068863_100000080 3300005841 Bacteria 106670
67 Ga0068863_100065201 3300005841 Bacteria 3446
68 Ga0068858_100000035 3300005842 Bacteria 140466
69 Ga0068858_100000042 3300005842 Bacteria 132482
70 Ga0068858_100438445 3300005842 Bacteria 1258
71 Ga0068860_100005398 3300005843 Bacteria 12971
72 Ga0068860_100084749 3300005843 Bacteria 3014
73 Ga0068862_100003975 3300005844 Bacteria 12550
74 Ga0081455_10002828 3300005937 Bacteria 20434
75 Ga0075365_10019940 3300006038 Bacteria 4148
76 Ga0075363_100040803 3300006048 Bacteria 2447
77 Ga0075364_10031845 3300006051 Bacteria 3387
78 Ga0075364_10273073 3300006051 Bacteria 1150
79 Ga0070715_10000015 3300006163 Bacteria 152816
80 Ga0070712_100001773 3300006175 Bacteria 13212
81 Ga0075433_10000031 3300006852 Bacteria 55735
82 Ga0068865_100000020 3300006881 Bacteria 104487
83 Ga0105240_10378925 3300009093 Unclassified 1598
84 Ga0105245_10000045 3300009098 Bacteria 134057
85 Ga0105245_10000150 3300009098 Bacteria 66121
86 Ga0105245_10000327 3300009098 Bacteria 44888
87 Ga0105247_10000712 3300009101 Bacteria 25919
88 Ga0105247_10079489 3300009101 Bacteria 2064
89 Ga0105241_10219283 3300009174 Bacteria 1598
90 Ga0105242_10000120 3300009176 Bacteria 57802
91 Ga0105242_10002594 3300009176 Bacteria 14161
92 Ga0105242_10071243 3300009176 Bacteria 2884
93 Ga0105242_10116213 3300009176 Bacteria 2288
94 Ga0105248_10000803 3300009177 Bacteria 35169
95 Ga0105248_10098732 3300009177 Bacteria 3290
96 Ga0105238_10000240 3300009551 Bacteria 61138
97 Ga0105249_10000095 3300009553 Bacteria 121300
98 Ga0105249_10003887 3300009553 Bacteria 12906
99 Ga0105239_10084325 3300010375 Bacteria 3499
100 Ga0105239_10240039 3300010375 Bacteria 2034
101 Ga0157370_10007442 3300013104 Bacteria 11902
102 Ga0157369_10000037 3300013105 Bacteria 190395
103 Ga0157374_10000668 3300013296 Bacteria 30198
104 Ga0157374_10048215 3300013296 Bacteria 3953
105 Ga0157375_10000723 3300013308 Bacteria 29095
106 Ga0157375_10070732 3300013308 Bacteria 3500
107 Ga0163163_10160997 3300014325 Bacteria 2290
108 Ga0157380_10000024 3300014326 Bacteria 110947
109 Ga0157380_10000202 3300014326 Bacteria 35113
110 Ga0157380_10206717 3300014326 Unclassified 1746
111 Ga0157380_10428522 3300014326 Bacteria 1264
112 Ga0157379_10014627 3300014968 Bacteria 6881
113 Ga0163161_10262495 3300017792 Bacteria 1349
114 Ga0207656_10000727 3300025321 Bacteria 10775
115 Ga0207656_10036913 3300025321 Unclassified 2053
116 Ga0207682_10000168 3300025893 Bacteria 30073
117 Ga0207642_10000001 3300025899 Bacteria 714030
118 Ga0207642_10000003 3300025899 Bacteria 650651
119 Ga0207642_10014164 3300025899 Bacteria 2934
120 Ga0207710_10000103 3300025900 Bacteria 109033
121 Ga0207710_10018459 3300025900 Bacteria 2967
122 Ga0207680_10028112 3300025903 Bacteria 3142
123 Ga0207680_10299918 3300025903 Bacteria 1120
124 Ga0207685_10000001 3300025905 Bacteria 604473
125 Ga0207707_10005314 3300025912 Bacteria 11251
126 Ga0207693_10004681 3300025915 Bacteria 11526
127 Ga0207663_10049926 3300025916 Bacteria 2598
128 Ga0207663_10331258 3300025916 Bacteria 1147
129 Ga0207649_10001043 3300025920 Bacteria 17022
130 Ga0207652_10001669 3300025921 Bacteria 19432
131 Ga0207694_10000067 3300025924 Bacteria 128108
132 Ga0207694_10080216 3300025924 Bacteria 2561
133 Ga0207650_10028940 3300025925 Bacteria 3978
134 Ga0207687_10000021 3300025927 Bacteria 226396
135 Ga0207687_10000023 3300025927 Bacteria 217098
136 Ga0207687_10000099 3300025927 Bacteria 63345
137 Ga0207700_10000009 3300025928 Bacteria 314953
138 Ga0207700_10538298 3300025928 Unclassified 1036
139 Ga0207690_10004598 3300025932 Bacteria 8159
140 Ga0207706_10000016 3300025933 Bacteria 170697
141 Ga0207686_10000176 3300025934 Bacteria 49131
142 Ga0207686_10000544 3300025934 Bacteria 24398
143 Ga0207686_10060684 3300025934 Bacteria 2395
144 Ga0207686_10136247 3300025934 Unclassified 1691
145 Ga0207709_10005335 3300025935 Bacteria 7311
146 Ga0207669_10000014 3300025937 Bacteria 129145
147 Ga0207669_10000137 3300025937 Bacteria 35016
148 Ga0207704_10000004 3300025938 Bacteria 239295
149 Ga0207691_10000199 3300025940 Bacteria 57652
150 Ga0207711_10000019 3300025941 Bacteria 412779
151 Ga0207661_10000339 3300025944 Bacteria 29875
152 Ga0207661_10017970 3300025944 Bacteria 5247
153 Ga0207661_10032158 3300025944 Bacteria 4062
154 Ga0207679_10049377 3300025945 Bacteria 3070
155 Ga0207679_10111900 3300025945 Bacteria 2157
156 Ga0207667_10109267 3300025949 Bacteria 2852
157 Ga0207651_10040926 3300025960 Bacteria 3071
158 Ga0207712_10000003 3300025961 Bacteria 615314
159 Ga0207668_10010976 3300025972 Bacteria 5492
160 Ga0207640_10000122 3300025981 Bacteria 59302
161 Ga0207658_10005758 3300025986 Bacteria 8476
162 Ga0207658_10023009 3300025986 Bacteria 4344
163 Ga0207658_10353965 3300025986 Unclassified 1279
164 Ga0207677_10000376 3300026023 Bacteria 30827
165 Ga0207677_10001003 3300026023 Bacteria 15596
166 Ga0207703_10000060 3300026035 Bacteria 134334
167 Ga0207703_10000067 3300026035 Bacteria 125623
168 Ga0207703_10083415 3300026035 Bacteria 2670
169 Ga0207703_10109761 3300026035 Bacteria 2352
170 Ga0207639_10001333 3300026041 Bacteria 16674
171 Ga0207678_10001410 3300026067 Bacteria 22098
172 Ga0207708_10053790 3300026075 Bacteria 3068
173 Ga0207702_10000027 3300026078 Bacteria 183792
174 Ga0207702_10002040 3300026078 Bacteria 19552
175 Ga0207641_10017737 3300026088 Bacteria 5831
176 Ga0207641_10043456 3300026088 Bacteria 3774
177 Ga0207648_10000228 3300026089 Bacteria 60032
178 Ga0207676_10000043 3300026095 Bacteria 161948
179 Ga0207675_100236330 3300026118 Bacteria 1764
180 Ga0207683_10055449 3300026121 Bacteria 3475
181 Ga0207698_10000002 3300026142 Bacteria 404991
182 Ga0268266_10000023 3300028379 Bacteria 501899
183 Ga0268266_10000324 3300028379 Bacteria 75115
184 Ga0268266_10001184 3300028379 Bacteria 32167
185 Ga0268266_10068496 3300028379 Bacteria 3073
186 Ga0268266_10082124 3300028379 Bacteria 2810
187 Ga0268266_10108225 3300028379 Bacteria 2459
188 Ga0268266_10199527 3300028379 Bacteria 1830
189 Ga0268265_10008188 3300028380 Bacteria 7061
190 Ga0268264_10005149 3300028381 Bacteria 11080
191 Ga0268264_10075637 3300028381 Bacteria 2863
192 Ga0268264_10429951 3300028381 Unclassified 1275
193 Ga0265337_1000013 3300028556 Bacteria 82926
194 Ga0265326_10000012 3300028558 Bacteria 175352
195 Ga0265319_1000421 3300028563 Bacteria 30464
196 Ga0265322_10000003 3300028654 Bacteria 468671
197 Ga0265338_10002111 3300028800 Bacteria 30659
198 Ga0265332_10020728 3300031238 Bacteria 2904
199 Ga0265328_10000700 3300031239 Bacteria 15518
200 Ga0265320_10000001 3300031240 Bacteria 847191
201 Ga0265325_10002586 3300031241 Bacteria 12140
202 Ga0265329_10005962 3300031242 Bacteria 4877
203 Ga0265339_10062855 3300031249 Unclassified 1995
204 Ga0265331_10001257 3300031250 Bacteria 19008
205 Ga0265327_10000003 3300031251 Bacteria 852750
206 Ga0265316_10073539 3300031344 Bacteria 2632
207 Ga0265314_10000044 3300031711 Bacteria 207337
208 Ga0316574_0028527 3300035398 Unclassified 3367
209 Ga0373937_0010103 3300036401 Bacteria 8231
210 Ga0316584_0121691 3300036712 Bacteria 1950
211 Ga0451853_2601553 3300041512 Bacteria 1894
212 Ga0451853_3177988 3300041512 Unclassified 1840
213 Ga0466963_0000710 3300044694 Bacteria 16256
214 Ga0466967_0000004 3300045976 Bacteria 155664
215 Ga0495592_0001063 3300046454 Bacteria 19010
216 Ga0495603_0000095 3300046455 Bacteria 40632
217 Ga0495603_0001218 3300046455 Bacteria 15011
218 Ga0495629_0000682 3300046459 Bacteria 27492
219 Ga0495629_0001002 3300046459 Bacteria 22663
220 Ga0495629_0028100 3300046459 Bacteria 3994
221 Ga0495641_0000187 3300046461 Bacteria 47961
222 Ga0495641_0013772 3300046461 Bacteria 4418
223 Ga0495653_0035641 3300046463 Bacteria 3924
224 Ga0495653_0075953 3300046463 Bacteria 2499
225 Ga0495582_0000005 3300046473 Bacteria 156170
226 Ga0495662_0000022 3300046476 Bacteria 54342
227 Ga0495594_0000004 3300046499 Bacteria 195881
228 Ga0495608_0000001 3300046511 Bacteria 411278
229 Ga0495608_0000702 3300046511 Bacteria 23274
230 Ga0495618_0000068 3300046514 Bacteria 74614
231 Ga0495620_0005333 3300046515 Bacteria 7193
232 Ga0495628_0021689 3300046516 Bacteria 5280
233 Ga0495628_0134017 3300046516 Unclassified 1894
234 Ga0495630_0000037 3300046517 Bacteria 114404
235 Ga0495630_0001004 3300046517 Bacteria 19578
236 Ga0495630_0153555 3300046517 Unclassified 1752
237 Ga0495644_0000600 3300046523 Bacteria 15119
238 Ga0495652_0006039 3300046529 Bacteria 11327
239 Ga0495652_0081240 3300046529 Bacteria 2674
240 Ga0495640_0012284 3300046533 Bacteria 6550
241 Ga0495586_0001124 3300046535 Bacteria 15053
242 Ga0495587_0038069 3300046536 Bacteria 2885
243 Ga0495621_0007695 3300046539 Bacteria 3199
244 Ga0495645_0006912 3300046543 Bacteria 7883
245 Ga0495645_0013323 3300046543 Bacteria 5811
246 Ga0495622_0000016 3300046557 Bacteria 177089
247 Ga0495633_0014022 3300046558 Bacteria 4202
248 Ga0495667_0000015 3300046559 Bacteria 200377
249 Ga0495667_0046643 3300046559 Bacteria 2865
250 Ga0495668_0023328 3300046616 Bacteria 3531
251 Ga0495634_0000592 3300046642 Bacteria 35197
252 Ga0495634_0000910 3300046642 Bacteria 28215
253 Ga0495634_0011662 3300046642 Bacteria 6393
254 Ga0495625_0000020 3300046660 Bacteria 290440
255 Ga0495657_0000002 3300046675 Bacteria 411958
256 Ga0495599_0057875 3300046678 Bacteria 2425
257 Ga0495647_0000037 3300046681 Bacteria 42482
258 Ga0495647_0005678 3300046681 Bacteria 4099
259 Ga0495658_0000019 3300046683 Bacteria 91606
260 Ga0495613_0000185 3300046689 Bacteria 60963
261 Ga0495613_0000257 3300046689 Bacteria 50000
262 Ga0495624_0000013 3300046690 Bacteria 115278
263 Ga0495624_0007342 3300046690 Bacteria 7738
264 Ga0495600_0001883 3300046809 Bacteria 11775
265 Ga0495604_0000033 3300047317 Bacteria 134810
266 Ga0495604_0032469 3300047317 Bacteria 4137
267 Ga0495674_0000007 3300047319 Bacteria 336257
268 Ga0495676_0000091 3300047321 Bacteria 66575
269 Ga0495676_0000400 3300047321 Bacteria 35076
270 Ga0495676_0063345 3300047321 Bacteria 2882
271 Ga0495680_0000023 3300047322 Bacteria 116444
272 Ga0495680_0001062 3300047322 Bacteria 30410
273 Ga0495680_0002013 3300047322 Bacteria 21325
274 Ga0495675_0039612 3300047444 Bacteria 3001
275 Ga0495684_0091697 3300047471 Unclassified 2302
276 Ga0495686_0041131 3300047472 Bacteria 2944
277 Ga0495602_0000010 3300048088 Bacteria 212121
278 Ga0495602_0001999 3300048088 Bacteria 20491
279 Ga0495602_0052115 3300048088 Bacteria 3638
280 Ga0495602_0066345 3300048088 Bacteria 3110
281 Ga0495614_0020870 3300048089 Bacteria 2831
282 Ga0496100_0000008 3300048903 Bacteria 231974
283 Ga0496101_0000016 3300048904 Bacteria 240753
284 Ga0496102_0000054 3300048905 Bacteria 175565
285 Ga0496102_0008829 3300048905 Bacteria 8645
286 Ga0496102_0073447 3300048905 Bacteria 3143
287 Ga0496103_0000079 3300048906 Bacteria 110624
288 Ga0496103_0012116 3300048906 Bacteria 5122
289 Ga0496104_0000003 3300048907 Bacteria 669219
290 Ga0496104_0000063 3300048907 Bacteria 116618
291 Ga0496104_0001015 3300048907 Bacteria 24067
292 Ga0496104_0042581 3300048907 Bacteria 4262
293 Ga0496105_0000041 3300048908 Bacteria 116618
294 Ga0496105_0000138 3300048908 Bacteria 48896
295 Ga0496106_0000013 3300048909 Bacteria 202263
296 Ga0496106_0000085 3300048909 Bacteria 74004
297 Ga0496107_0000009 3300048910 Bacteria 231682
298 Ga0496108_0000002 3300048911 Bacteria 700890
299 Ga0496108_0000024 3300048911 Bacteria 183389
300 Ga0496108_0004351 3300048911 Bacteria 11388
301 Ga0496109_0000001 3300048912 Bacteria 700852
302 Ga0496109_0000033 3300048912 Bacteria 160496
303 Ga0496109_0000237 3300048912 Bacteria 53743
304 Ga0496109_0000299 3300048912 Bacteria 46702
305 Ga0496109_0051666 3300048912 Bacteria 3744
306 Ga0496109_0505026 3300048912 Bacteria 1141
307 Ga0496110_0000623 3300048913 Bacteria 24276
308 Ga0496110_0030719 3300048913 Bacteria 4632
309 Ga0496111_0000004 3300048914 Bacteria 116115
310 Ga0496111_0060263 3300048914 Bacteria 2751
311 Ga0496111_0134303 3300048914 Bacteria 1832
312 Ga0496112_0000002 3300048915 Bacteria 782039
313 Ga0496114_0000010 3300048917 Bacteria 363396
314 Ga0496114_0100948 3300048917 Unclassified 2463
315 Ga0496114_0223240 3300048917 Bacteria 1654
316 Ga0496115_0000074 3300048918 Bacteria 90267
317 Ga0496115_0000850 3300048918 Bacteria 22181
318 Ga0496117_0002396 3300048920 Bacteria 23836
319 Ga0496117_0066044 3300048920 Bacteria 2456
320 Ga0496118_0001663 3300048921 Bacteria 32640
321 Ga0496118_0110916 3300048921 Bacteria 1821
322 Ga0496119_0007318 3300048922 Bacteria 9988
323 Ga0496119_0058474 3300048922 Bacteria 2323
324 Ga0496120_0012622 3300048923 Bacteria 5735
325 Ga0496121_0015158 3300048924 Bacteria 8106
326 Ga0496121_0140818 3300048924 Bacteria 1790
327 Ga0496124_0120528 3300048927 Bacteria 2097
328 Ga0496124_0193034 3300048927 Bacteria 1556
329 Ga0496125_0026708 3300048928 Bacteria 5250
330 Ga0496125_0203146 3300048928 Bacteria 1295
331 Ga0496126_0227219 3300048929 Bacteria 1565
332 Ga0501031_0000251 3300049568 Bacteria 30080
333 Ga0501032_0011731 3300049569 Bacteria 6282
334 Ga0501033_0001728 3300049570 Bacteria 19108
335 Ga0501034_0001057 3300049571 Bacteria 39077
336 Ga0501034_0002306 3300049571 Bacteria 23347
337 Ga0501034_0028939 3300049571 Bacteria 5635
338 Ga0501034_0253968 3300049571 Bacteria 1702
339 Ga0501036_0000413 3300049572 Bacteria 30169
340 Ga0501037_0001212 3300049573 Bacteria 19075
341 Ga0501038_0001433 3300049574 Bacteria 21875
342 Ga0501040_0059385 3300049576 Bacteria 2627
343 Ga0501042_0050740 3300049578 Bacteria 2959
344 Ga0501042_0079923 3300049578 Bacteria 2343
345 Ga0501043_0001710 3300049579 Bacteria 19005
346 Ga0501043_0219039 3300049579 Bacteria 1473
347 Ga0501046_0002042 3300049580 Bacteria 19179
348 Ga0501047_0002582 3300049581 Bacteria 17235
349 Ga0501047_0032521 3300049581 Bacteria 5036
350 Ga0501047_0112299 3300049581 Bacteria 2607
351 Ga0501047_0188129 3300049581 Bacteria 1929
352 Ga0501048_0000406 3300049582 Bacteria 29993
353 Ga0501068_0095818 3300049584 Bacteria 1835
354 Ga0501069_0015868 3300049585 Bacteria 4038
355 Ga0501070_0000079 3300049586 Bacteria 82054
356 Ga0501070_0171934 3300049586 Unclassified 1784
357 Ga0501070_0414675 3300049586 Unclassified 1088
358 Ga0501071_0012633 3300049587 Bacteria 5736
359 Ga0501071_0093518 3300049587 Bacteria 2211
360 Ga0501072_0152867 3300049588 Bacteria 1840
361 Ga0501073_0085895 3300049589 Bacteria 2188
362 Ga0501074_0082422 3300049590 Bacteria 2306
363 Ga0501074_0087841 3300049590 Bacteria 2226
364 Ga0501075_0000855 3300049591 Bacteria 19203
365 Ga0501079_0005145 3300049741 Bacteria 9724
366 Ga0501079_0015322 3300049741 Bacteria 5848
367 Ga0501080_0034327 3300049742 Bacteria 4734
368 Ga0501080_0092475 3300049742 Bacteria 2809
369 Ga0501080_0297045 3300049742 Bacteria 1466
370 Ga0501083_0000966 3300049744 Bacteria 19025
371 Ga0501083_0006940 3300049744 Bacteria 8036
372 Ga0501083_0192002 3300049744 Bacteria 1333
373 Ga0501035_0000059 3300049822 Bacteria 134506
374 Ga0501044_0000417 3300049823 Bacteria 52579
375 Ga0501044_0069036 3300049823 Bacteria 3599
376 Ga0501045_0120203 3300049824 Bacteria 1950
377 nmdc:mga03n38_28209_c1 3300050490 Bacteria 2337
378 nmdc:mga0yw44_13135_c1 3300050492 Bacteria 4348
379 nmdc:mga0yw44_141761_c1 3300050492 Unclassified 1562
380 nmdc:mga0a205_758_c1 3300050515 Bacteria 26047
381 nmdc:mga0a205_9_c1 3300050515 Bacteria 55726
382 Ga0495601_0000012 3300053077 Bacteria 227853
383 Ga0495601_0023045 3300053077 Bacteria 3825
384 Ga0495612_0000843 3300053078 Bacteria 12451
385 Ga0495655_0000003 3300053083 Bacteria 303053
386 Ga0495595_0000001 3300053084 Bacteria 495226
387 Ga0495595_0000109 3300053084 Bacteria 37617
388 Ga0495619_0000020 3300053085 Bacteria 201556
389 Ga0495619_0000024 3300053085 Bacteria 180821
390 Ga0495619_0000192 3300053085 Bacteria 45153
391 Ga0495619_0000909 3300053085 Bacteria 19385
392 Ga0495619_0003820 3300053085 Bacteria 9695
393 Ga0495619_0033526 3300053085 Bacteria 3335
394 Ga0500641_0008785 3300053096 Bacteria 3616
395 Ga0500595_028569 3300053119 Bacteria 1901
396 Ga0500614_003634 3300053123 Bacteria 3310
397 Ga0500628_000002 3300053129 Bacteria 357687
398 Ga0530510_0154803 3300061734 Unclassified 1694

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0121691 Ga0316584_0121691_489_1271 256
2 3300050492 nmdc:mga0yw44_141761_c1 nmdc:mga0yw44_141761_c1_495_1289 259
3 3300048913 Ga0496110_0000623 Ga0496110_0000623_3515_4435 279
4 3300048914 Ga0496111_0000004 Ga0496111_0000004_24546_25466 279
5 3300006051 Ga0075364_10031845 Ga0075364_100318452 285
6 3300049581 Ga0501047_0112299 Ga0501047_0112299_1259_2212 286
7 3300049587 Ga0501071_0012633 Ga0501071_0012633_3682_4635 286
8 3300049590 Ga0501074_0087841 Ga0501074_0087841_794_1747 286
9 3300049744 Ga0501083_0006940 Ga0501083_0006940_3273_4235 288
10 3300049823 Ga0501044_0069036 Ga0501044_0069036_2349_3311 288
11 3300049581 Ga0501047_0188129 Ga0501047_0188129_238_1203 291
12 3300050492 nmdc:mga0yw44_13135_c1 nmdc:mga0yw44_13135_c1_564_1532 291
13 3300005331 Ga0070670_100038748 Ga0070670_1000387484 293
14 3300025925 Ga0207650_10028940 Ga0207650_100289404 293
15 3300049579 Ga0501043_0219039 Ga0501043_0219039_230_1183 293
16 3300049741 Ga0501079_0005145 Ga0501079_0005145_386_1339 293
17 3300049742 Ga0501080_0034327 Ga0501080_0034327_3273_4226 293
18 3300005335 Ga0070666_10085952 Ga0070666_100859522 294
19 3300005367 Ga0070667_100040624 Ga0070667_1000406242 294
20 3300005548 Ga0070665_100208389 Ga0070665_1002083892 294
21 3300025903 Ga0207680_10028112 Ga0207680_100281122 294
22 3300025986 Ga0207658_10005758 Ga0207658_100057583 294
23 3300028379 Ga0268266_10000324 Ga0268266_1000032410 294
24 3300036401 Ga0373937_0010103 Ga0373937_0010103_2338_3315 294
25 3300048911 Ga0496108_0000024 Ga0496108_0000024_63996_64919 294
26 3300048912 Ga0496109_0000033 Ga0496109_0000033_41103_42026 294
27 3300048929 Ga0496126_0227219 Ga0496126_0227219_533_1492 294
28 3300048928 Ga0496125_0203146 Ga0496125_0203146_68_1033 295
29 3300046660 Ga0495625_0000020 Ga0495625_0000020_222100_223098 297
30 3300005341 Ga0070691_10000006 Ga0070691_1000000621 298
31 3300005365 Ga0070688_100000468 Ga0070688_10000046812 298
32 3300009101 Ga0105247_10079489 Ga0105247_100794892 298
33 3300005614 Ga0068856_100000403 Ga0068856_10000040319 299
34 3300006038 Ga0075365_10019940 Ga0075365_100199408 299
35 3300006048 Ga0075363_100040803 Ga0075363_1000408032 299
36 3300006051 Ga0075364_10273073 Ga0075364_102730732 299
37 3300014326 Ga0157380_10206717 Ga0157380_102067172 299
38 3300026078 Ga0207702_10000027 Ga0207702_10000027172 299
39 3300050490 nmdc:mga03n38_28209_c1 nmdc:mga03n38_28209_c1_254_1222 299
40 3300048911 Ga0496108_0000002 Ga0496108_0000002_224608_225591 300
41 3300048912 Ga0496109_0000001 Ga0496109_0000001_224570_225553 300
42 3300005329 Ga0070683_100044735 Ga0070683_1000447352 301
43 3300005564 Ga0070664_100068607 Ga0070664_1000686074 301
44 3300010375 Ga0105239_10084325 Ga0105239_100843252 301
45 3300025944 Ga0207661_10032158 Ga0207661_100321584 301
46 3300025945 Ga0207679_10111900 Ga0207679_101119003 301
47 3300046515 Ga0495620_0005333 Ga0495620_0005333_2002_2973 301
48 3300046533 Ga0495640_0012284 Ga0495640_0012284_2794_3753 301
49 3300046642 Ga0495634_0000910 Ga0495634_0000910_20948_21940 301
50 3300047319 Ga0495674_0000007 Ga0495674_0000007_9584_10543 301
51 3300048905 Ga0496102_0073447 Ga0496102_0073447_1642_2595 301
52 3300048906 Ga0496103_0012116 Ga0496103_0012116_2574_3527 301
53 3300035398 Ga0316574_0028527 Ga0316574_0028527_976_1914 302
54 3300047472 Ga0495686_0041131 Ga0495686_0041131_1048_2013 302
55 3300009174 Ga0105241_10219283 Ga0105241_102192832 303
56 3300028563 Ga0265319_1000421 Ga0265319_100042120 303
57 3300028800 Ga0265338_10002111 Ga0265338_100021119 303
58 3300031241 Ga0265325_10002586 Ga0265325_100025867 303
59 3300046517 Ga0495630_0153555 Ga0495630_0153555_783_1736 303
60 3300046689 Ga0495613_0000185 Ga0495613_0000185_22828_23748 303
61 3300053077 Ga0495601_0000012 Ga0495601_0000012_117362_118282 303
62 3300005366 Ga0070659_100005667 Ga0070659_1000056678 304
63 3300005436 Ga0070713_100023846 Ga0070713_1000238465 304
64 3300013104 Ga0157370_10007442 Ga0157370_1000744211 304
65 3300014325 Ga0163163_10160997 Ga0163163_101609972 304
66 3300025928 Ga0207700_10538298 Ga0207700_105382982 304
67 3300025932 Ga0207690_10004598 Ga0207690_100045984 304
68 3300049571 Ga0501034_0253968 Ga0501034_0253968_244_1197 304
69 3300049586 Ga0501070_0171934 Ga0501070_0171934_724_1659 304
70 3300049586 Ga0501070_0414675 Ga0501070_0414675_38_973 304
71 3300049744 Ga0501083_0192002 Ga0501083_0192002_208_1140 304
72 3300005330 Ga0070690_100132560 Ga0070690_1001325602 305
73 3300005337 Ga0070682_100000016 Ga0070682_100000016222 305
74 3300005365 Ga0070688_100000225 Ga0070688_10000022512 305
75 3300005455 Ga0070663_100000641 Ga0070663_1000006412 305
76 3300005456 Ga0070678_100035596 Ga0070678_1000355964 305
77 3300005457 Ga0070662_100000008 Ga0070662_100000008101 305
78 3300005466 Ga0070685_10000124 Ga0070685_1000012412 305
79 3300005530 Ga0070679_100001824 Ga0070679_1000018246 305
80 3300005544 Ga0070686_100188946 Ga0070686_1001889462 305
81 3300005578 Ga0068854_100001877 Ga0068854_1000018774 305
82 3300005834 Ga0068851_10001306 Ga0068851_100013064 305
83 3300013308 Ga0157375_10070732 Ga0157375_100707322 305
84 3300025321 Ga0207656_10000727 Ga0207656_100007278 305
85 3300025903 Ga0207680_10299918 Ga0207680_102999181 305
86 3300025921 Ga0207652_10001669 Ga0207652_100016699 305
87 3300025933 Ga0207706_10000016 Ga0207706_1000001673 305
88 3300025981 Ga0207640_10000122 Ga0207640_1000012235 305
89 3300026067 Ga0207678_10001410 Ga0207678_100014106 305
90 3300026121 Ga0207683_10055449 Ga0207683_100554492 305
91 3300048913 Ga0496110_0030719 Ga0496110_0030719_2134_3063 305
92 3300048914 Ga0496111_0134303 Ga0496111_0134303_122_1051 305
93 3300048920 Ga0496117_0066044 Ga0496117_0066044_374_1369 305
94 3300048921 Ga0496118_0110916 Ga0496118_0110916_787_1782 305
95 3300048922 Ga0496119_0058474 Ga0496119_0058474_518_1513 305
96 3300048924 Ga0496121_0015158 Ga0496121_0015158_6011_6973 305
97 3300048924 Ga0496121_0140818 Ga0496121_0140818_525_1520 305
98 3300048927 Ga0496124_0120528 Ga0496124_0120528_743_1702 305
99 3300048927 Ga0496124_0193034 Ga0496124_0193034_39_968 305
100 3300053085 Ga0495619_0000020 Ga0495619_0000020_176011_177000 305
101 3300001979 JGI24740J21852_10015307 JGI24740J21852_100153074 306
102 3300005338 Ga0068868_100005673 Ga0068868_1000056735 306
103 3300005367 Ga0070667_100366095 Ga0070667_1003660952 306
104 3300005459 Ga0068867_100000179 Ga0068867_10000017945 306
105 3300005548 Ga0070665_100000725 Ga0070665_10000072510 306
106 3300006881 Ga0068865_100000020 Ga0068865_100000020105 306
107 3300009098 Ga0105245_10000327 Ga0105245_1000032713 306
108 3300009177 Ga0105248_10000803 Ga0105248_1000080321 306
109 3300010375 Ga0105239_10240039 Ga0105239_102400392 306
110 3300014326 Ga0157380_10428522 Ga0157380_104285222 306
111 3300025900 Ga0207710_10018459 Ga0207710_100184594 306
112 3300025924 Ga0207694_10080216 Ga0207694_100802162 306
113 3300025927 Ga0207687_10000021 Ga0207687_1000002113 306
114 3300025938 Ga0207704_10000004 Ga0207704_1000000489 306
115 3300025941 Ga0207711_10000019 Ga0207711_1000001921 306
116 3300025949 Ga0207667_10109267 Ga0207667_101092673 306
117 3300025986 Ga0207658_10353965 Ga0207658_103539652 306
118 3300026023 Ga0207677_10001003 Ga0207677_1000100312 306
119 3300026089 Ga0207648_10000228 Ga0207648_1000022844 306
120 3300028379 Ga0268266_10001184 Ga0268266_1000118431 306
121 3300028556 Ga0265337_1000013 Ga0265337_100001363 306
122 3300028558 Ga0265326_10000012 Ga0265326_10000012106 306
123 3300028654 Ga0265322_10000003 Ga0265322_10000003393 306
124 3300031238 Ga0265332_10020728 Ga0265332_100207284 306
125 3300031239 Ga0265328_10000700 Ga0265328_1000070012 306
126 3300031240 Ga0265320_10000001 Ga0265320_10000001393 306
127 3300031242 Ga0265329_10005962 Ga0265329_100059626 306
128 3300031249 Ga0265339_10062855 Ga0265339_100628552 306
129 3300031250 Ga0265331_10001257 Ga0265331_1000125716 306
130 3300031251 Ga0265327_10000003 Ga0265327_10000003393 306
131 3300031344 Ga0265316_10073539 Ga0265316_100735393 306
132 3300031711 Ga0265314_10000044 Ga0265314_1000004474 306
133 3300046559 Ga0495667_0000015 Ga0495667_0000015_102087_103064 306
134 3300047322 Ga0495680_0001062 Ga0495680_0001062_24899_25876 306
135 3300048088 Ga0495602_0001999 Ga0495602_0001999_2262_3239 306
136 3300048905 Ga0496102_0008829 Ga0496102_0008829_2115_3089 306
137 3300048907 Ga0496104_0042581 Ga0496104_0042581_2247_3209 306
138 3300048917 Ga0496114_0100948 Ga0496114_0100948_704_1639 306
139 3300048920 Ga0496117_0002396 Ga0496117_0002396_5127_6101 306
140 3300048921 Ga0496118_0001663 Ga0496118_0001663_27004_27978 306
141 3300048923 Ga0496120_0012622 Ga0496120_0012622_1588_2604 306
142 3300048928 Ga0496125_0026708 Ga0496125_0026708_3871_4833 306
143 3300049587 Ga0501071_0093518 Ga0501071_0093518_42_971 306
144 3300049742 Ga0501080_0297045 Ga0501080_0297045_307_1263 306
145 3300053119 Ga0500595_028569 Ga0500595_028569_296_1270 306
146 3300005329 Ga0070683_100000190 Ga0070683_10000019011 307
147 3300005548 Ga0070665_100152684 Ga0070665_1001526842 307
148 3300005614 Ga0068856_100012776 Ga0068856_10001277610 307
149 3300005616 Ga0068852_100000013 Ga0068852_100000013118 307
150 3300005618 Ga0068864_100000044 Ga0068864_100000044119 307
151 3300006175 Ga0070712_100001773 Ga0070712_1000017734 307
152 3300006852 Ga0075433_10000031 Ga0075433_100000313 307
153 3300009093 Ga0105240_10378925 Ga0105240_103789252 307
154 3300009098 Ga0105245_10000045 Ga0105245_1000004518 307
155 3300013105 Ga0157369_10000037 Ga0157369_1000003723 307
156 3300014326 Ga0157380_10000024 Ga0157380_10000024104 307
157 3300025915 Ga0207693_10004681 Ga0207693_100046814 307
158 3300025927 Ga0207687_10000023 Ga0207687_1000002318 307
159 3300025935 Ga0207709_10005335 Ga0207709_100053357 307
160 3300025944 Ga0207661_10000339 Ga0207661_1000033911 307
161 3300026078 Ga0207702_10002040 Ga0207702_1000204012 307
162 3300026095 Ga0207676_10000043 Ga0207676_10000043118 307
163 3300026142 Ga0207698_10000002 Ga0207698_10000002245 307
164 3300028379 Ga0268266_10082124 Ga0268266_100821242 307
165 3300028379 Ga0268266_10108225 Ga0268266_101082253 307
166 3300046455 Ga0495603_0000095 Ga0495603_0000095_21_977 307
167 3300046461 Ga0495641_0000187 Ga0495641_0000187_33013_33948 307
168 3300046536 Ga0495587_0038069 Ga0495587_0038069_491_1426 307
169 3300047321 Ga0495676_0000400 Ga0495676_0000400_11227_12276 307
170 3300048903 Ga0496100_0000008 Ga0496100_0000008_110770_111786 307
171 3300048904 Ga0496101_0000016 Ga0496101_0000016_119552_120568 307
172 3300048909 Ga0496106_0000085 Ga0496106_0000085_35370_36386 307
173 3300048910 Ga0496107_0000009 Ga0496107_0000009_110484_111500 307
174 3300048912 Ga0496109_0000237 Ga0496109_0000237_24922_25908 307
175 3300048912 Ga0496109_0000299 Ga0496109_0000299_7723_8715 307
176 3300049568 Ga0501031_0000251 Ga0501031_0000251_13335_14300 307
177 3300049569 Ga0501032_0011731 Ga0501032_0011731_4227_5192 307
178 3300049570 Ga0501033_0001728 Ga0501033_0001728_4790_5755 307
179 3300049571 Ga0501034_0001057 Ga0501034_0001057_32126_33091 307
180 3300049572 Ga0501036_0000413 Ga0501036_0000413_13356_14321 307
181 3300049573 Ga0501037_0001212 Ga0501037_0001212_4749_5714 307
182 3300049574 Ga0501038_0001433 Ga0501038_0001433_4879_5844 307
183 3300049576 Ga0501040_0059385 Ga0501040_0059385_667_1632 307
184 3300049578 Ga0501042_0050740 Ga0501042_0050740_1858_2823 307
185 3300049579 Ga0501043_0001710 Ga0501043_0001710_13313_14278 307
186 3300049580 Ga0501046_0002042 Ga0501046_0002042_13397_14362 307
187 3300049581 Ga0501047_0002582 Ga0501047_0002582_5188_6153 307
188 3300049582 Ga0501048_0000406 Ga0501048_0000406_13383_14348 307
189 3300049585 Ga0501069_0015868 Ga0501069_0015868_80_1045 307
190 3300049586 Ga0501070_0000079 Ga0501070_0000079_67405_68370 307
191 3300049588 Ga0501072_0152867 Ga0501072_0152867_779_1744 307
192 3300049589 Ga0501073_0085895 Ga0501073_0085895_439_1404 307
193 3300049590 Ga0501074_0082422 Ga0501074_0082422_916_1881 307
194 3300049741 Ga0501079_0015322 Ga0501079_0015322_4728_5693 307
195 3300049742 Ga0501080_0092475 Ga0501080_0092475_213_1178 307
196 3300049744 Ga0501083_0000966 Ga0501083_0000966_4938_5903 307
197 3300049822 Ga0501035_0000059 Ga0501035_0000059_78248_79213 307
198 3300049823 Ga0501044_0000417 Ga0501044_0000417_38291_39256 307
199 3300049824 Ga0501045_0120203 Ga0501045_0120203_171_1136 307
200 3300050515 nmdc:mga0a205_9_c1 nmdc:mga0a205_9_c1_872_1822 307
201 3300053123 Ga0500614_003634 Ga0500614_003634_1789_2724 307
202 3300005344 Ga0070661_100000217 Ga0070661_10000021726 308
203 3300025920 Ga0207649_10001043 Ga0207649_1000104311 308
204 3300028381 Ga0268264_10429951 Ga0268264_104299512 308
205 3300047317 Ga0495604_0032469 Ga0495604_0032469_860_1792 308
206 3300048088 Ga0495602_0000010 Ga0495602_0000010_116349_117335 308
207 3300048905 Ga0496102_0000054 Ga0496102_0000054_60745_61680 308
208 3300048906 Ga0496103_0000079 Ga0496103_0000079_48958_49893 308
209 3300048907 Ga0496104_0000063 Ga0496104_0000063_15051_16004 308
210 3300048908 Ga0496105_0000041 Ga0496105_0000041_100615_101568 308
211 3300048918 Ga0496115_0000074 Ga0496115_0000074_80447_81412 308
212 3300048922 Ga0496119_0007318 Ga0496119_0007318_655_1608 308
213 3300053085 Ga0495619_0000192 Ga0495619_0000192_8416_9363 308
214 3300053085 Ga0495619_0033526 Ga0495619_0033526_1758_2690 308
215 3300005455 Ga0070663_100207363 Ga0070663_1002073632 309
216 3300005543 Ga0070672_100000039 Ga0070672_10000003936 309
217 3300005834 Ga0068851_10001155 Ga0068851_1000115513 309
218 3300009177 Ga0105248_10098732 Ga0105248_100987323 309
219 3300025321 Ga0207656_10036913 Ga0207656_100369132 309
220 3300025940 Ga0207691_10000199 Ga0207691_1000019936 309
221 3300028379 Ga0268266_10199527 Ga0268266_101995272 309
222 3300046459 Ga0495629_0001002 Ga0495629_0001002_3306_4304 309
223 3300046642 Ga0495634_0000592 Ga0495634_0000592_26319_27290 309
224 3300047321 Ga0495676_0063345 Ga0495676_0063345_751_1734 309
225 3300048915 Ga0496112_0000002 Ga0496112_0000002_663312_664289 309
226 3300005354 Ga0070675_100000429 Ga0070675_1000004294 310
227 3300005435 Ga0070714_100008433 Ga0070714_1000084334 310
228 3300005937 Ga0081455_10002828 Ga0081455_100028286 310
229 3300009176 Ga0105242_10002594 Ga0105242_100025943 310
230 3300025928 Ga0207700_10000009 Ga0207700_10000009150 310
231 3300025934 Ga0207686_10000544 Ga0207686_1000054418 310
232 3300026035 Ga0207703_10083415 Ga0207703_100834151 310
233 3300045976 Ga0466967_0000004 Ga0466967_0000004_24786_25790 310
234 3300046499 Ga0495594_0000004 Ga0495594_0000004_52480_53448 310
235 3300046517 Ga0495630_0000037 Ga0495630_0000037_82706_83710 310
236 3300046543 Ga0495645_0006912 Ga0495645_0006912_4762_5718 310
237 3300046690 Ga0495624_0007342 Ga0495624_0007342_2224_3228 310
238 3300048088 Ga0495602_0066345 Ga0495602_0066345_955_1908 310
239 3300048917 Ga0496114_0223240 Ga0496114_0223240_362_1315 310
240 3300049571 Ga0501034_0002306 Ga0501034_0002306_1486_2469 310
241 3300049571 Ga0501034_0028939 Ga0501034_0028939_688_1683 310
242 3300049581 Ga0501047_0032521 Ga0501047_0032521_734_1717 310
243 3300053083 Ga0495655_0000003 Ga0495655_0000003_66742_67734 310
244 3300053129 Ga0500628_000002 Ga0500628_000002_66742_67734 310
245 3300003659 JGI25404J52841_10001611 JGI25404J52841_100016111 311
246 3300005329 Ga0070683_100026488 Ga0070683_1000264883 311
247 3300005347 Ga0070668_100004533 Ga0070668_1000045336 311
248 3300005367 Ga0070667_100036060 Ga0070667_1000360605 311
249 3300005367 Ga0070667_100186694 Ga0070667_1001866942 311
250 3300005535 Ga0070684_100072078 Ga0070684_1000720782 311
251 3300005548 Ga0070665_100123267 Ga0070665_1001232672 311
252 3300005841 Ga0068863_100065201 Ga0068863_1000652011 311
253 3300005842 Ga0068858_100438445 Ga0068858_1004384452 311
254 3300005843 Ga0068860_100084749 Ga0068860_1000847493 311
255 3300005844 Ga0068862_100003975 Ga0068862_1000039755 311
256 3300009098 Ga0105245_10000150 Ga0105245_1000015028 311
257 3300009101 Ga0105247_10000712 Ga0105247_1000071221 311
258 3300009176 Ga0105242_10000120 Ga0105242_1000012050 311
259 3300009553 Ga0105249_10003887 Ga0105249_1000388714 311
260 3300017792 Ga0163161_10262495 Ga0163161_102624952 311
261 3300025900 Ga0207710_10000103 Ga0207710_100001035 311
262 3300025927 Ga0207687_10000099 Ga0207687_1000009927 311
263 3300025934 Ga0207686_10000176 Ga0207686_1000017649 311
264 3300025944 Ga0207661_10017970 Ga0207661_100179703 311
265 3300025972 Ga0207668_10010976 Ga0207668_100109764 311
266 3300025986 Ga0207658_10023009 Ga0207658_100230094 311
267 3300026035 Ga0207703_10109761 Ga0207703_101097612 311
268 3300026088 Ga0207641_10043456 Ga0207641_100434564 311
269 3300028379 Ga0268266_10068496 Ga0268266_100684963 311
270 3300028380 Ga0268265_10008188 Ga0268265_100081883 311
271 3300028381 Ga0268264_10075637 Ga0268264_100756374 311
272 3300041512 Ga0451853_3177988 Ga0451853_3177988_771_1769 311
273 3300046459 Ga0495629_0000682 Ga0495629_0000682_24430_25377 311
274 3300047444 Ga0495675_0039612 Ga0495675_0039612_1421_2401 311
275 3300049584 Ga0501068_0095818 Ga0501068_0095818_106_1077 311
276 3300053096 Ga0500641_0008785 Ga0500641_0008785_2479_3489 311
277 3300025899 Ga0207642_10014164 Ga0207642_100141642 312
278 3300046455 Ga0495603_0001218 Ga0495603_0001218_469_1428 312
279 3300046557 Ga0495622_0000016 Ga0495622_0000016_18117_19091 312
280 3300048089 Ga0495614_0020870 Ga0495614_0020870_266_1261 312
281 3300048917 Ga0496114_0000010 Ga0496114_0000010_142956_143939 312
282 3300048918 Ga0496115_0000850 Ga0496115_0000850_595_1578 312
283 3300046514 Ga0495618_0000068 Ga0495618_0000068_51012_51989 313
284 3300046516 Ga0495628_0134017 Ga0495628_0134017_585_1532 313
285 3300046529 Ga0495652_0006039 Ga0495652_0006039_7226_8173 313
286 3300046539 Ga0495621_0007695 Ga0495621_0007695_1494_2438 313
287 3300046543 Ga0495645_0013323 Ga0495645_0013323_1199_2146 313
288 3300046809 Ga0495600_0001883 Ga0495600_0001883_3526_4503 313
289 3300047322 Ga0495680_0002013 Ga0495680_0002013_6204_7154 313
290 3300061734 Ga0530510_0154803 Ga0530510_0154803_412_1401 313
291 3300002074 JGI24748J21848_1000153 JGI24748J21848_10001539 314
292 3300002239 JGI24034J26672_10000074 JGI24034J26672_1000007416 314
293 3300005333 Ga0070677_10000048 Ga0070677_1000004818 314
294 3300005439 Ga0070711_100108847 Ga0070711_1001088471 314
295 3300025893 Ga0207682_10000168 Ga0207682_1000016815 314
296 3300025916 Ga0207663_10331258 Ga0207663_103312581 314
297 3300046529 Ga0495652_0081240 Ga0495652_0081240_711_1655 314
298 3300046642 Ga0495634_0011662 Ga0495634_0011662_5159_6142 314
299 3300046689 Ga0495613_0000257 Ga0495613_0000257_20320_21315 314
300 3300047322 Ga0495680_0000023 Ga0495680_0000023_49125_50120 314
301 3300048088 Ga0495602_0052115 Ga0495602_0052115_2314_3267 314
302 3300048907 Ga0496104_0000003 Ga0496104_0000003_136975_137958 314
303 3300005365 Ga0070688_100014171 Ga0070688_1000141715 315
304 3300005466 Ga0070685_10116617 Ga0070685_101166172 315
305 3300005548 Ga0070665_100000120 Ga0070665_10000012017 315
306 3300005842 Ga0068858_100000035 Ga0068858_10000003515 315
307 3300009553 Ga0105249_10000095 Ga0105249_100000959 315
308 3300014968 Ga0157379_10014627 Ga0157379_100146275 315
309 3300025961 Ga0207712_10000003 Ga0207712_10000003503 315
310 3300026035 Ga0207703_10000067 Ga0207703_1000006748 315
311 3300028379 Ga0268266_10000023 Ga0268266_10000023377 315
312 3300041512 Ga0451853_2601553 Ga0451853_2601553_85_1071 315
313 3300046511 Ga0495608_0000001 Ga0495608_0000001_159813_160802 315
314 3300046675 Ga0495657_0000002 Ga0495657_0000002_160493_161482 315
315 3300053084 Ga0495595_0000001 Ga0495595_0000001_250477_251466 315
316 3300005356 Ga0070674_100000241 Ga0070674_10000024122 316
317 3300009176 Ga0105242_10116213 Ga0105242_101162133 316
318 3300025934 Ga0207686_10060684 Ga0207686_100606842 316
319 3300025937 Ga0207669_10000014 Ga0207669_10000014111 316
320 3300048912 Ga0496109_0051666 Ga0496109_0051666_1397_2359 316
321 3300048914 Ga0496111_0060263 Ga0496111_0060263_1742_2704 316
322 3300053078 Ga0495612_0000843 Ga0495612_0000843_1342_2307 316
323 3300005539 Ga0068853_100001640 Ga0068853_1000016407 317
324 3300026041 Ga0207639_10001333 Ga0207639_1000133313 317
325 3300026118 Ga0207675_100236330 Ga0207675_1002363302 317
326 3300046678 Ga0495599_0057875 Ga0495599_0057875_592_1563 317
327 3300005338 Ga0068868_100000451 Ga0068868_10000045113 318
328 3300005530 Ga0070679_100000823 Ga0070679_10000082319 318
329 3300026023 Ga0207677_10000376 Ga0207677_1000037613 318
330 3300005364 Ga0070673_100061197 Ga0070673_1000611972 319
331 3300005843 Ga0068860_100005398 Ga0068860_10000539813 319
332 3300006163 Ga0070715_10000015 Ga0070715_1000001587 319
333 3300025905 Ga0207685_10000001 Ga0207685_10000001339 319
334 3300025960 Ga0207651_10040926 Ga0207651_100409262 319
335 3300028381 Ga0268264_10005149 Ga0268264_100051494 319
336 3300026075 Ga0207708_10053790 Ga0207708_100537903 320
337 3300048911 Ga0496108_0004351 Ga0496108_0004351_576_1544 320
338 3300048912 Ga0496109_0505026 Ga0496109_0505026_68_1036 320
339 3300053085 Ga0495619_0003820 Ga0495619_0003820_3362_4345 320
340 3300005439 Ga0070711_100008682 Ga0070711_1000086826 321
341 3300005458 Ga0070681_10003882 Ga0070681_100038827 321
342 3300005841 Ga0068863_100000080 Ga0068863_1000000805 321
343 3300025912 Ga0207707_10005314 Ga0207707_100053144 321
344 3300025916 Ga0207663_10049926 Ga0207663_100499263 321
345 3300026088 Ga0207641_10017737 Ga0207641_100177374 321
346 3300005356 Ga0070674_100000033 Ga0070674_10000003327 322
347 3300005564 Ga0070664_100093239 Ga0070664_1000932393 322
348 3300005718 Ga0068866_10000002 Ga0068866_1000000281 322
349 3300025899 Ga0207642_10000001 Ga0207642_10000001527 322
350 3300025899 Ga0207642_10000003 Ga0207642_10000003527 322
351 3300025937 Ga0207669_10000137 Ga0207669_1000013727 322
352 3300025945 Ga0207679_10049377 Ga0207679_100493774 322
353 3300046463 Ga0495653_0035641 Ga0495653_0035641_93_1070 322
354 3300046511 Ga0495608_0000702 Ga0495608_0000702_20355_21332 322
355 3300046516 Ga0495628_0021689 Ga0495628_0021689_1327_2304 322
356 3300046517 Ga0495630_0001004 Ga0495630_0001004_6251_7228 322
357 3300046681 Ga0495647_0000037 Ga0495647_0000037_35352_36350 322
358 3300047471 Ga0495684_0091697 Ga0495684_0091697_1115_2095 322
359 3300049578 Ga0501042_0079923 Ga0501042_0079923_103_1077 322
360 3300053084 Ga0495595_0000109 Ga0495595_0000109_8384_9361 322
361 3300053085 Ga0495619_0000909 Ga0495619_0000909_13517_14497 322
362 3300005339 Ga0070660_100181885 Ga0070660_1001818852 323
363 3300005547 Ga0070693_100000793 Ga0070693_10000079312 323
364 3300009551 Ga0105238_10000240 Ga0105238_1000024039 323
365 3300013296 Ga0157374_10000668 Ga0157374_1000066810 323
366 3300014326 Ga0157380_10000202 Ga0157380_1000020219 323
367 3300025924 Ga0207694_10000067 Ga0207694_10000067103 323
368 3300044694 Ga0466963_0000710 Ga0466963_0000710_12798_13784 323
369 3300046459 Ga0495629_0028100 Ga0495629_0028100_2448_3419 323
370 3300046461 Ga0495641_0013772 Ga0495641_0013772_2198_3175 323
371 3300046463 Ga0495653_0075953 Ga0495653_0075953_419_1405 323
372 3300046473 Ga0495582_0000005 Ga0495582_0000005_124471_125448 323
373 3300046476 Ga0495662_0000022 Ga0495662_0000022_33798_34817 323
374 3300046523 Ga0495644_0000600 Ga0495644_0000600_10577_11551 323
375 3300046535 Ga0495586_0001124 Ga0495586_0001124_6989_7963 323
376 3300046558 Ga0495633_0014022 Ga0495633_0014022_1662_2645 323
377 3300046616 Ga0495668_0023328 Ga0495668_0023328_681_1661 323
378 3300046681 Ga0495647_0005678 Ga0495647_0005678_411_1418 323
379 3300046683 Ga0495658_0000019 Ga0495658_0000019_30733_31710 323
380 3300046690 Ga0495624_0000013 Ga0495624_0000013_103722_104693 323
381 3300047321 Ga0495676_0000091 Ga0495676_0000091_2458_3459 323
382 3300048909 Ga0496106_0000013 Ga0496106_0000013_200040_201020 323
383 3300049591 Ga0501075_0000855 Ga0501075_0000855_5977_6948 323
384 3300053077 Ga0495601_0023045 Ga0495601_0023045_2628_3599 323
385 3300053085 Ga0495619_0000024 Ga0495619_0000024_5141_6124 323
386 3300013308 Ga0157375_10000723 Ga0157375_1000072315 324
387 3300009176 Ga0105242_10071243 Ga0105242_100712433 325
388 3300025934 Ga0207686_10136247 Ga0207686_101362472 325
389 3300046454 Ga0495592_0001063 Ga0495592_0001063_6238_7224 325
390 3300046559 Ga0495667_0046643 Ga0495667_0046643_562_1578 325
391 3300047317 Ga0495604_0000033 Ga0495604_0000033_40237_41253 325
392 3300005842 Ga0068858_100000042 Ga0068858_100000042121 326
393 3300013296 Ga0157374_10048215 Ga0157374_100482154 326
394 3300026035 Ga0207703_10000060 Ga0207703_1000006015 326
395 3300048907 Ga0496104_0001015 Ga0496104_0001015_20978_21979 327
396 3300048908 Ga0496105_0000138 Ga0496105_0000138_6261_7262 327
397 3300050515 nmdc:mga0a205_758_c1 nmdc:mga0a205_758_c1_18946_19971 327
398 3300001977 JGI24746J21847_1000405 JGI24746J21847_10004052 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13480

Acetyltransf_6

Acetyltransferase (GNAT) domain

164

310

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nsq-assembly1.cif.gz_A crystal structure of pcaf 0.8044 166 275
5trm-assembly1.cif.gz_J crystal structure of human gcn5 histone acetyltransferase domain 0.7942 166 275
5trm-assembly1.cif.gz_H crystal structure of human gcn5 histone acetyltransferase domain 0.7761 166 275
3fyn-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of cole harbour salt marsh: integron cassette protein hfx_cass3 0.769 168 277
1cm0-assembly1.cif.gz_B crystal structure of the pcaf/coenzyme-a complex 0.7667 166 275
ID Description Score Start End Superfamily
af_A0A1D6G8A0_124_211_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8499 216 277 3.40.630.30
1p4nA02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8387 151 296 3.40.630.30
af_Q2FZ34_165_379_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8243 151 275 3.40.630.30
af_Q2FYR1_179_367_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8103 154 275 3.40.630.30
af_P9WQ85_157_310_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8063 153 285 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A537YT91-F1-model_v4 GNAT family N-acetyltransferase 0.9729 1 333 GO:0016740
AF-A0A7V9HNY8-F1-model_v4 GNAT family N-acetyltransferase 0.9691 8 334 GO:0016740
AF-A0A838V9A3-F1-model_v4 GNAT family N-acetyltransferase 0.9637 104 333 GO:0016740
AF-A0A7V9HNY8-F1-model_v4 GNAT family N-acetyltransferase 0.9599 8 334 GO:0016740
AF-A0A838V9A3-F1-model_v4 GNAT family N-acetyltransferase 0.9597 104 333 GO:0016740

Feature Viewer

pLDDT pTM Quality
89.59 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map