F434144
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 398 | 246 | 398 | 321 |
Family's Representative Sequence
| Representative Sequence | 3300047321|Ga0495676_0000400|Ga0495676_0000400_11227_12276 |
| Length | 349 |
| Sequence | MSSGPPPRTCSVSEPVATAELIEDRGEAAVSSDFFRSRPFLDAEAVTHTLRIDIGDAELLAPVLVREIPLPPSRNIDPEETYRPIEPLFDAVSPYAYPGLVPPPSERISPRYAGTTAFEMDPAEIDFSATGLVSLFLRHRLGPAPLTGTTERTAVQIADPALPPKSRPSDRRQIRKNLEAGYAVTLVPGPQTTPAQRAGFLDVYEQTMRRTDAAEHYFFGASYFDRALEAAGTWLALATAPDRSLAAASFAATSDGFLHYYLSGSADSHLRDSPMKNIVARLIELSAELNLPLNLGSGISPGDPLEEFKRGFANRQEPWQTSELICNPEKYALLSADHPRGGFFPAYRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 52 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 53 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 122 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 123 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 124 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 125 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 128 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 129 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 130 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 131 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 133 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 134 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 135 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 136 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 137 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 139 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 140 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 141 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 142 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 187 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 188 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 189 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 190 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 191 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 192 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 195 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 196 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 197 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 198 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 199 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 200 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 201 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 202 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 203 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 204 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 205 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 206 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 207 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 235 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 236 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 243 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 244 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 245 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 246 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.76 |
| Nodule | 0 |
| Rhizoplane | 9.05 |
| Rhizosphere | 84.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000405 | 3300001977 | Bacteria | 6405 |
| 2 | JGI24740J21852_10015307 | 3300001979 | Bacteria | 2805 |
| 3 | JGI24748J21848_1000153 | 3300002074 | Bacteria | 10692 |
| 4 | JGI24034J26672_10000074 | 3300002239 | Bacteria | 24671 |
| 5 | JGI25404J52841_10001611 | 3300003659 | Bacteria | 4027 |
| 6 | Ga0070683_100000190 | 3300005329 | Bacteria | 41133 |
| 7 | Ga0070683_100026488 | 3300005329 | Bacteria | 5222 |
| 8 | Ga0070683_100044735 | 3300005329 | Bacteria | 4084 |
| 9 | Ga0070690_100132560 | 3300005330 | Bacteria | 1684 |
| 10 | Ga0070670_100038748 | 3300005331 | Bacteria | 4098 |
| 11 | Ga0070677_10000048 | 3300005333 | Bacteria | 37331 |
| 12 | Ga0070666_10085952 | 3300005335 | Bacteria | 2155 |
| 13 | Ga0070682_100000016 | 3300005337 | Bacteria | 239799 |
| 14 | Ga0068868_100000451 | 3300005338 | Bacteria | 27446 |
| 15 | Ga0068868_100005673 | 3300005338 | Bacteria | 8788 |
| 16 | Ga0070660_100181885 | 3300005339 | Bacteria | 1701 |
| 17 | Ga0070691_10000006 | 3300005341 | Bacteria | 66177 |
| 18 | Ga0070661_100000217 | 3300005344 | Bacteria | 47669 |
| 19 | Ga0070668_100004533 | 3300005347 | Bacteria | 10308 |
| 20 | Ga0070675_100000429 | 3300005354 | Bacteria | 28542 |
| 21 | Ga0070674_100000033 | 3300005356 | Bacteria | 63982 |
| 22 | Ga0070674_100000241 | 3300005356 | Bacteria | 27097 |
| 23 | Ga0070673_100061197 | 3300005364 | Bacteria | 2986 |
| 24 | Ga0070688_100000225 | 3300005365 | Bacteria | 29663 |
| 25 | Ga0070688_100000468 | 3300005365 | Bacteria | 20469 |
| 26 | Ga0070688_100014171 | 3300005365 | Bacteria | 4514 |
| 27 | Ga0070659_100005667 | 3300005366 | Bacteria | 8978 |
| 28 | Ga0070667_100036060 | 3300005367 | Bacteria | 4145 |
| 29 | Ga0070667_100040624 | 3300005367 | Bacteria | 3901 |
| 30 | Ga0070667_100186694 | 3300005367 | Bacteria | 1835 |
| 31 | Ga0070667_100366095 | 3300005367 | Unclassified | 1307 |
| 32 | Ga0070714_100008433 | 3300005435 | Bacteria | 8048 |
| 33 | Ga0070713_100023846 | 3300005436 | Bacteria | 4756 |
| 34 | Ga0070711_100008682 | 3300005439 | Bacteria | 6232 |
| 35 | Ga0070711_100108847 | 3300005439 | Bacteria | 2031 |
| 36 | Ga0070663_100000641 | 3300005455 | Bacteria | 18754 |
| 37 | Ga0070663_100207363 | 3300005455 | Unclassified | 1533 |
| 38 | Ga0070678_100035596 | 3300005456 | Bacteria | 3478 |
| 39 | Ga0070662_100000008 | 3300005457 | Bacteria | 168754 |
| 40 | Ga0070681_10003882 | 3300005458 | Bacteria | 14072 |
| 41 | Ga0068867_100000179 | 3300005459 | Bacteria | 41694 |
| 42 | Ga0070685_10000124 | 3300005466 | Bacteria | 49061 |
| 43 | Ga0070685_10116617 | 3300005466 | Bacteria | 1653 |
| 44 | Ga0070679_100000823 | 3300005530 | Bacteria | 26958 |
| 45 | Ga0070679_100001824 | 3300005530 | Bacteria | 19214 |
| 46 | Ga0070684_100072078 | 3300005535 | Bacteria | 3040 |
| 47 | Ga0068853_100001640 | 3300005539 | Bacteria | 16358 |
| 48 | Ga0070672_100000039 | 3300005543 | Bacteria | 57491 |
| 49 | Ga0070686_100188946 | 3300005544 | Bacteria | 1469 |
| 50 | Ga0070693_100000793 | 3300005547 | Bacteria | 13960 |
| 51 | Ga0070665_100000120 | 3300005548 | Bacteria | 148340 |
| 52 | Ga0070665_100000725 | 3300005548 | Bacteria | 43927 |
| 53 | Ga0070665_100123267 | 3300005548 | Bacteria | 2594 |
| 54 | Ga0070665_100152684 | 3300005548 | Bacteria | 2312 |
| 55 | Ga0070665_100208389 | 3300005548 | Bacteria | 1955 |
| 56 | Ga0070664_100068607 | 3300005564 | Bacteria | 3032 |
| 57 | Ga0070664_100093239 | 3300005564 | Bacteria | 2609 |
| 58 | Ga0068854_100001877 | 3300005578 | Bacteria | 12812 |
| 59 | Ga0068856_100000403 | 3300005614 | Bacteria | 47397 |
| 60 | Ga0068856_100012776 | 3300005614 | Bacteria | 8130 |
| 61 | Ga0068852_100000013 | 3300005616 | Bacteria | 139537 |
| 62 | Ga0068864_100000044 | 3300005618 | Bacteria | 157919 |
| 63 | Ga0068866_10000002 | 3300005718 | Bacteria | 394090 |
| 64 | Ga0068851_10001155 | 3300005834 | Bacteria | 11453 |
| 65 | Ga0068851_10001306 | 3300005834 | Bacteria | 10862 |
| 66 | Ga0068863_100000080 | 3300005841 | Bacteria | 106670 |
| 67 | Ga0068863_100065201 | 3300005841 | Bacteria | 3446 |
| 68 | Ga0068858_100000035 | 3300005842 | Bacteria | 140466 |
| 69 | Ga0068858_100000042 | 3300005842 | Bacteria | 132482 |
| 70 | Ga0068858_100438445 | 3300005842 | Bacteria | 1258 |
| 71 | Ga0068860_100005398 | 3300005843 | Bacteria | 12971 |
| 72 | Ga0068860_100084749 | 3300005843 | Bacteria | 3014 |
| 73 | Ga0068862_100003975 | 3300005844 | Bacteria | 12550 |
| 74 | Ga0081455_10002828 | 3300005937 | Bacteria | 20434 |
| 75 | Ga0075365_10019940 | 3300006038 | Bacteria | 4148 |
| 76 | Ga0075363_100040803 | 3300006048 | Bacteria | 2447 |
| 77 | Ga0075364_10031845 | 3300006051 | Bacteria | 3387 |
| 78 | Ga0075364_10273073 | 3300006051 | Bacteria | 1150 |
| 79 | Ga0070715_10000015 | 3300006163 | Bacteria | 152816 |
| 80 | Ga0070712_100001773 | 3300006175 | Bacteria | 13212 |
| 81 | Ga0075433_10000031 | 3300006852 | Bacteria | 55735 |
| 82 | Ga0068865_100000020 | 3300006881 | Bacteria | 104487 |
| 83 | Ga0105240_10378925 | 3300009093 | Unclassified | 1598 |
| 84 | Ga0105245_10000045 | 3300009098 | Bacteria | 134057 |
| 85 | Ga0105245_10000150 | 3300009098 | Bacteria | 66121 |
| 86 | Ga0105245_10000327 | 3300009098 | Bacteria | 44888 |
| 87 | Ga0105247_10000712 | 3300009101 | Bacteria | 25919 |
| 88 | Ga0105247_10079489 | 3300009101 | Bacteria | 2064 |
| 89 | Ga0105241_10219283 | 3300009174 | Bacteria | 1598 |
| 90 | Ga0105242_10000120 | 3300009176 | Bacteria | 57802 |
| 91 | Ga0105242_10002594 | 3300009176 | Bacteria | 14161 |
| 92 | Ga0105242_10071243 | 3300009176 | Bacteria | 2884 |
| 93 | Ga0105242_10116213 | 3300009176 | Bacteria | 2288 |
| 94 | Ga0105248_10000803 | 3300009177 | Bacteria | 35169 |
| 95 | Ga0105248_10098732 | 3300009177 | Bacteria | 3290 |
| 96 | Ga0105238_10000240 | 3300009551 | Bacteria | 61138 |
| 97 | Ga0105249_10000095 | 3300009553 | Bacteria | 121300 |
| 98 | Ga0105249_10003887 | 3300009553 | Bacteria | 12906 |
| 99 | Ga0105239_10084325 | 3300010375 | Bacteria | 3499 |
| 100 | Ga0105239_10240039 | 3300010375 | Bacteria | 2034 |
| 101 | Ga0157370_10007442 | 3300013104 | Bacteria | 11902 |
| 102 | Ga0157369_10000037 | 3300013105 | Bacteria | 190395 |
| 103 | Ga0157374_10000668 | 3300013296 | Bacteria | 30198 |
| 104 | Ga0157374_10048215 | 3300013296 | Bacteria | 3953 |
| 105 | Ga0157375_10000723 | 3300013308 | Bacteria | 29095 |
| 106 | Ga0157375_10070732 | 3300013308 | Bacteria | 3500 |
| 107 | Ga0163163_10160997 | 3300014325 | Bacteria | 2290 |
| 108 | Ga0157380_10000024 | 3300014326 | Bacteria | 110947 |
| 109 | Ga0157380_10000202 | 3300014326 | Bacteria | 35113 |
| 110 | Ga0157380_10206717 | 3300014326 | Unclassified | 1746 |
| 111 | Ga0157380_10428522 | 3300014326 | Bacteria | 1264 |
| 112 | Ga0157379_10014627 | 3300014968 | Bacteria | 6881 |
| 113 | Ga0163161_10262495 | 3300017792 | Bacteria | 1349 |
| 114 | Ga0207656_10000727 | 3300025321 | Bacteria | 10775 |
| 115 | Ga0207656_10036913 | 3300025321 | Unclassified | 2053 |
| 116 | Ga0207682_10000168 | 3300025893 | Bacteria | 30073 |
| 117 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 118 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 119 | Ga0207642_10014164 | 3300025899 | Bacteria | 2934 |
| 120 | Ga0207710_10000103 | 3300025900 | Bacteria | 109033 |
| 121 | Ga0207710_10018459 | 3300025900 | Bacteria | 2967 |
| 122 | Ga0207680_10028112 | 3300025903 | Bacteria | 3142 |
| 123 | Ga0207680_10299918 | 3300025903 | Bacteria | 1120 |
| 124 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 125 | Ga0207707_10005314 | 3300025912 | Bacteria | 11251 |
| 126 | Ga0207693_10004681 | 3300025915 | Bacteria | 11526 |
| 127 | Ga0207663_10049926 | 3300025916 | Bacteria | 2598 |
| 128 | Ga0207663_10331258 | 3300025916 | Bacteria | 1147 |
| 129 | Ga0207649_10001043 | 3300025920 | Bacteria | 17022 |
| 130 | Ga0207652_10001669 | 3300025921 | Bacteria | 19432 |
| 131 | Ga0207694_10000067 | 3300025924 | Bacteria | 128108 |
| 132 | Ga0207694_10080216 | 3300025924 | Bacteria | 2561 |
| 133 | Ga0207650_10028940 | 3300025925 | Bacteria | 3978 |
| 134 | Ga0207687_10000021 | 3300025927 | Bacteria | 226396 |
| 135 | Ga0207687_10000023 | 3300025927 | Bacteria | 217098 |
| 136 | Ga0207687_10000099 | 3300025927 | Bacteria | 63345 |
| 137 | Ga0207700_10000009 | 3300025928 | Bacteria | 314953 |
| 138 | Ga0207700_10538298 | 3300025928 | Unclassified | 1036 |
| 139 | Ga0207690_10004598 | 3300025932 | Bacteria | 8159 |
| 140 | Ga0207706_10000016 | 3300025933 | Bacteria | 170697 |
| 141 | Ga0207686_10000176 | 3300025934 | Bacteria | 49131 |
| 142 | Ga0207686_10000544 | 3300025934 | Bacteria | 24398 |
| 143 | Ga0207686_10060684 | 3300025934 | Bacteria | 2395 |
| 144 | Ga0207686_10136247 | 3300025934 | Unclassified | 1691 |
| 145 | Ga0207709_10005335 | 3300025935 | Bacteria | 7311 |
| 146 | Ga0207669_10000014 | 3300025937 | Bacteria | 129145 |
| 147 | Ga0207669_10000137 | 3300025937 | Bacteria | 35016 |
| 148 | Ga0207704_10000004 | 3300025938 | Bacteria | 239295 |
| 149 | Ga0207691_10000199 | 3300025940 | Bacteria | 57652 |
| 150 | Ga0207711_10000019 | 3300025941 | Bacteria | 412779 |
| 151 | Ga0207661_10000339 | 3300025944 | Bacteria | 29875 |
| 152 | Ga0207661_10017970 | 3300025944 | Bacteria | 5247 |
| 153 | Ga0207661_10032158 | 3300025944 | Bacteria | 4062 |
| 154 | Ga0207679_10049377 | 3300025945 | Bacteria | 3070 |
| 155 | Ga0207679_10111900 | 3300025945 | Bacteria | 2157 |
| 156 | Ga0207667_10109267 | 3300025949 | Bacteria | 2852 |
| 157 | Ga0207651_10040926 | 3300025960 | Bacteria | 3071 |
| 158 | Ga0207712_10000003 | 3300025961 | Bacteria | 615314 |
| 159 | Ga0207668_10010976 | 3300025972 | Bacteria | 5492 |
| 160 | Ga0207640_10000122 | 3300025981 | Bacteria | 59302 |
| 161 | Ga0207658_10005758 | 3300025986 | Bacteria | 8476 |
| 162 | Ga0207658_10023009 | 3300025986 | Bacteria | 4344 |
| 163 | Ga0207658_10353965 | 3300025986 | Unclassified | 1279 |
| 164 | Ga0207677_10000376 | 3300026023 | Bacteria | 30827 |
| 165 | Ga0207677_10001003 | 3300026023 | Bacteria | 15596 |
| 166 | Ga0207703_10000060 | 3300026035 | Bacteria | 134334 |
| 167 | Ga0207703_10000067 | 3300026035 | Bacteria | 125623 |
| 168 | Ga0207703_10083415 | 3300026035 | Bacteria | 2670 |
| 169 | Ga0207703_10109761 | 3300026035 | Bacteria | 2352 |
| 170 | Ga0207639_10001333 | 3300026041 | Bacteria | 16674 |
| 171 | Ga0207678_10001410 | 3300026067 | Bacteria | 22098 |
| 172 | Ga0207708_10053790 | 3300026075 | Bacteria | 3068 |
| 173 | Ga0207702_10000027 | 3300026078 | Bacteria | 183792 |
| 174 | Ga0207702_10002040 | 3300026078 | Bacteria | 19552 |
| 175 | Ga0207641_10017737 | 3300026088 | Bacteria | 5831 |
| 176 | Ga0207641_10043456 | 3300026088 | Bacteria | 3774 |
| 177 | Ga0207648_10000228 | 3300026089 | Bacteria | 60032 |
| 178 | Ga0207676_10000043 | 3300026095 | Bacteria | 161948 |
| 179 | Ga0207675_100236330 | 3300026118 | Bacteria | 1764 |
| 180 | Ga0207683_10055449 | 3300026121 | Bacteria | 3475 |
| 181 | Ga0207698_10000002 | 3300026142 | Bacteria | 404991 |
| 182 | Ga0268266_10000023 | 3300028379 | Bacteria | 501899 |
| 183 | Ga0268266_10000324 | 3300028379 | Bacteria | 75115 |
| 184 | Ga0268266_10001184 | 3300028379 | Bacteria | 32167 |
| 185 | Ga0268266_10068496 | 3300028379 | Bacteria | 3073 |
| 186 | Ga0268266_10082124 | 3300028379 | Bacteria | 2810 |
| 187 | Ga0268266_10108225 | 3300028379 | Bacteria | 2459 |
| 188 | Ga0268266_10199527 | 3300028379 | Bacteria | 1830 |
| 189 | Ga0268265_10008188 | 3300028380 | Bacteria | 7061 |
| 190 | Ga0268264_10005149 | 3300028381 | Bacteria | 11080 |
| 191 | Ga0268264_10075637 | 3300028381 | Bacteria | 2863 |
| 192 | Ga0268264_10429951 | 3300028381 | Unclassified | 1275 |
| 193 | Ga0265337_1000013 | 3300028556 | Bacteria | 82926 |
| 194 | Ga0265326_10000012 | 3300028558 | Bacteria | 175352 |
| 195 | Ga0265319_1000421 | 3300028563 | Bacteria | 30464 |
| 196 | Ga0265322_10000003 | 3300028654 | Bacteria | 468671 |
| 197 | Ga0265338_10002111 | 3300028800 | Bacteria | 30659 |
| 198 | Ga0265332_10020728 | 3300031238 | Bacteria | 2904 |
| 199 | Ga0265328_10000700 | 3300031239 | Bacteria | 15518 |
| 200 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 201 | Ga0265325_10002586 | 3300031241 | Bacteria | 12140 |
| 202 | Ga0265329_10005962 | 3300031242 | Bacteria | 4877 |
| 203 | Ga0265339_10062855 | 3300031249 | Unclassified | 1995 |
| 204 | Ga0265331_10001257 | 3300031250 | Bacteria | 19008 |
| 205 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 206 | Ga0265316_10073539 | 3300031344 | Bacteria | 2632 |
| 207 | Ga0265314_10000044 | 3300031711 | Bacteria | 207337 |
| 208 | Ga0316574_0028527 | 3300035398 | Unclassified | 3367 |
| 209 | Ga0373937_0010103 | 3300036401 | Bacteria | 8231 |
| 210 | Ga0316584_0121691 | 3300036712 | Bacteria | 1950 |
| 211 | Ga0451853_2601553 | 3300041512 | Bacteria | 1894 |
| 212 | Ga0451853_3177988 | 3300041512 | Unclassified | 1840 |
| 213 | Ga0466963_0000710 | 3300044694 | Bacteria | 16256 |
| 214 | Ga0466967_0000004 | 3300045976 | Bacteria | 155664 |
| 215 | Ga0495592_0001063 | 3300046454 | Bacteria | 19010 |
| 216 | Ga0495603_0000095 | 3300046455 | Bacteria | 40632 |
| 217 | Ga0495603_0001218 | 3300046455 | Bacteria | 15011 |
| 218 | Ga0495629_0000682 | 3300046459 | Bacteria | 27492 |
| 219 | Ga0495629_0001002 | 3300046459 | Bacteria | 22663 |
| 220 | Ga0495629_0028100 | 3300046459 | Bacteria | 3994 |
| 221 | Ga0495641_0000187 | 3300046461 | Bacteria | 47961 |
| 222 | Ga0495641_0013772 | 3300046461 | Bacteria | 4418 |
| 223 | Ga0495653_0035641 | 3300046463 | Bacteria | 3924 |
| 224 | Ga0495653_0075953 | 3300046463 | Bacteria | 2499 |
| 225 | Ga0495582_0000005 | 3300046473 | Bacteria | 156170 |
| 226 | Ga0495662_0000022 | 3300046476 | Bacteria | 54342 |
| 227 | Ga0495594_0000004 | 3300046499 | Bacteria | 195881 |
| 228 | Ga0495608_0000001 | 3300046511 | Bacteria | 411278 |
| 229 | Ga0495608_0000702 | 3300046511 | Bacteria | 23274 |
| 230 | Ga0495618_0000068 | 3300046514 | Bacteria | 74614 |
| 231 | Ga0495620_0005333 | 3300046515 | Bacteria | 7193 |
| 232 | Ga0495628_0021689 | 3300046516 | Bacteria | 5280 |
| 233 | Ga0495628_0134017 | 3300046516 | Unclassified | 1894 |
| 234 | Ga0495630_0000037 | 3300046517 | Bacteria | 114404 |
| 235 | Ga0495630_0001004 | 3300046517 | Bacteria | 19578 |
| 236 | Ga0495630_0153555 | 3300046517 | Unclassified | 1752 |
| 237 | Ga0495644_0000600 | 3300046523 | Bacteria | 15119 |
| 238 | Ga0495652_0006039 | 3300046529 | Bacteria | 11327 |
| 239 | Ga0495652_0081240 | 3300046529 | Bacteria | 2674 |
| 240 | Ga0495640_0012284 | 3300046533 | Bacteria | 6550 |
| 241 | Ga0495586_0001124 | 3300046535 | Bacteria | 15053 |
| 242 | Ga0495587_0038069 | 3300046536 | Bacteria | 2885 |
| 243 | Ga0495621_0007695 | 3300046539 | Bacteria | 3199 |
| 244 | Ga0495645_0006912 | 3300046543 | Bacteria | 7883 |
| 245 | Ga0495645_0013323 | 3300046543 | Bacteria | 5811 |
| 246 | Ga0495622_0000016 | 3300046557 | Bacteria | 177089 |
| 247 | Ga0495633_0014022 | 3300046558 | Bacteria | 4202 |
| 248 | Ga0495667_0000015 | 3300046559 | Bacteria | 200377 |
| 249 | Ga0495667_0046643 | 3300046559 | Bacteria | 2865 |
| 250 | Ga0495668_0023328 | 3300046616 | Bacteria | 3531 |
| 251 | Ga0495634_0000592 | 3300046642 | Bacteria | 35197 |
| 252 | Ga0495634_0000910 | 3300046642 | Bacteria | 28215 |
| 253 | Ga0495634_0011662 | 3300046642 | Bacteria | 6393 |
| 254 | Ga0495625_0000020 | 3300046660 | Bacteria | 290440 |
| 255 | Ga0495657_0000002 | 3300046675 | Bacteria | 411958 |
| 256 | Ga0495599_0057875 | 3300046678 | Bacteria | 2425 |
| 257 | Ga0495647_0000037 | 3300046681 | Bacteria | 42482 |
| 258 | Ga0495647_0005678 | 3300046681 | Bacteria | 4099 |
| 259 | Ga0495658_0000019 | 3300046683 | Bacteria | 91606 |
| 260 | Ga0495613_0000185 | 3300046689 | Bacteria | 60963 |
| 261 | Ga0495613_0000257 | 3300046689 | Bacteria | 50000 |
| 262 | Ga0495624_0000013 | 3300046690 | Bacteria | 115278 |
| 263 | Ga0495624_0007342 | 3300046690 | Bacteria | 7738 |
| 264 | Ga0495600_0001883 | 3300046809 | Bacteria | 11775 |
| 265 | Ga0495604_0000033 | 3300047317 | Bacteria | 134810 |
| 266 | Ga0495604_0032469 | 3300047317 | Bacteria | 4137 |
| 267 | Ga0495674_0000007 | 3300047319 | Bacteria | 336257 |
| 268 | Ga0495676_0000091 | 3300047321 | Bacteria | 66575 |
| 269 | Ga0495676_0000400 | 3300047321 | Bacteria | 35076 |
| 270 | Ga0495676_0063345 | 3300047321 | Bacteria | 2882 |
| 271 | Ga0495680_0000023 | 3300047322 | Bacteria | 116444 |
| 272 | Ga0495680_0001062 | 3300047322 | Bacteria | 30410 |
| 273 | Ga0495680_0002013 | 3300047322 | Bacteria | 21325 |
| 274 | Ga0495675_0039612 | 3300047444 | Bacteria | 3001 |
| 275 | Ga0495684_0091697 | 3300047471 | Unclassified | 2302 |
| 276 | Ga0495686_0041131 | 3300047472 | Bacteria | 2944 |
| 277 | Ga0495602_0000010 | 3300048088 | Bacteria | 212121 |
| 278 | Ga0495602_0001999 | 3300048088 | Bacteria | 20491 |
| 279 | Ga0495602_0052115 | 3300048088 | Bacteria | 3638 |
| 280 | Ga0495602_0066345 | 3300048088 | Bacteria | 3110 |
| 281 | Ga0495614_0020870 | 3300048089 | Bacteria | 2831 |
| 282 | Ga0496100_0000008 | 3300048903 | Bacteria | 231974 |
| 283 | Ga0496101_0000016 | 3300048904 | Bacteria | 240753 |
| 284 | Ga0496102_0000054 | 3300048905 | Bacteria | 175565 |
| 285 | Ga0496102_0008829 | 3300048905 | Bacteria | 8645 |
| 286 | Ga0496102_0073447 | 3300048905 | Bacteria | 3143 |
| 287 | Ga0496103_0000079 | 3300048906 | Bacteria | 110624 |
| 288 | Ga0496103_0012116 | 3300048906 | Bacteria | 5122 |
| 289 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 290 | Ga0496104_0000063 | 3300048907 | Bacteria | 116618 |
| 291 | Ga0496104_0001015 | 3300048907 | Bacteria | 24067 |
| 292 | Ga0496104_0042581 | 3300048907 | Bacteria | 4262 |
| 293 | Ga0496105_0000041 | 3300048908 | Bacteria | 116618 |
| 294 | Ga0496105_0000138 | 3300048908 | Bacteria | 48896 |
| 295 | Ga0496106_0000013 | 3300048909 | Bacteria | 202263 |
| 296 | Ga0496106_0000085 | 3300048909 | Bacteria | 74004 |
| 297 | Ga0496107_0000009 | 3300048910 | Bacteria | 231682 |
| 298 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 299 | Ga0496108_0000024 | 3300048911 | Bacteria | 183389 |
| 300 | Ga0496108_0004351 | 3300048911 | Bacteria | 11388 |
| 301 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 302 | Ga0496109_0000033 | 3300048912 | Bacteria | 160496 |
| 303 | Ga0496109_0000237 | 3300048912 | Bacteria | 53743 |
| 304 | Ga0496109_0000299 | 3300048912 | Bacteria | 46702 |
| 305 | Ga0496109_0051666 | 3300048912 | Bacteria | 3744 |
| 306 | Ga0496109_0505026 | 3300048912 | Bacteria | 1141 |
| 307 | Ga0496110_0000623 | 3300048913 | Bacteria | 24276 |
| 308 | Ga0496110_0030719 | 3300048913 | Bacteria | 4632 |
| 309 | Ga0496111_0000004 | 3300048914 | Bacteria | 116115 |
| 310 | Ga0496111_0060263 | 3300048914 | Bacteria | 2751 |
| 311 | Ga0496111_0134303 | 3300048914 | Bacteria | 1832 |
| 312 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 313 | Ga0496114_0000010 | 3300048917 | Bacteria | 363396 |
| 314 | Ga0496114_0100948 | 3300048917 | Unclassified | 2463 |
| 315 | Ga0496114_0223240 | 3300048917 | Bacteria | 1654 |
| 316 | Ga0496115_0000074 | 3300048918 | Bacteria | 90267 |
| 317 | Ga0496115_0000850 | 3300048918 | Bacteria | 22181 |
| 318 | Ga0496117_0002396 | 3300048920 | Bacteria | 23836 |
| 319 | Ga0496117_0066044 | 3300048920 | Bacteria | 2456 |
| 320 | Ga0496118_0001663 | 3300048921 | Bacteria | 32640 |
| 321 | Ga0496118_0110916 | 3300048921 | Bacteria | 1821 |
| 322 | Ga0496119_0007318 | 3300048922 | Bacteria | 9988 |
| 323 | Ga0496119_0058474 | 3300048922 | Bacteria | 2323 |
| 324 | Ga0496120_0012622 | 3300048923 | Bacteria | 5735 |
| 325 | Ga0496121_0015158 | 3300048924 | Bacteria | 8106 |
| 326 | Ga0496121_0140818 | 3300048924 | Bacteria | 1790 |
| 327 | Ga0496124_0120528 | 3300048927 | Bacteria | 2097 |
| 328 | Ga0496124_0193034 | 3300048927 | Bacteria | 1556 |
| 329 | Ga0496125_0026708 | 3300048928 | Bacteria | 5250 |
| 330 | Ga0496125_0203146 | 3300048928 | Bacteria | 1295 |
| 331 | Ga0496126_0227219 | 3300048929 | Bacteria | 1565 |
| 332 | Ga0501031_0000251 | 3300049568 | Bacteria | 30080 |
| 333 | Ga0501032_0011731 | 3300049569 | Bacteria | 6282 |
| 334 | Ga0501033_0001728 | 3300049570 | Bacteria | 19108 |
| 335 | Ga0501034_0001057 | 3300049571 | Bacteria | 39077 |
| 336 | Ga0501034_0002306 | 3300049571 | Bacteria | 23347 |
| 337 | Ga0501034_0028939 | 3300049571 | Bacteria | 5635 |
| 338 | Ga0501034_0253968 | 3300049571 | Bacteria | 1702 |
| 339 | Ga0501036_0000413 | 3300049572 | Bacteria | 30169 |
| 340 | Ga0501037_0001212 | 3300049573 | Bacteria | 19075 |
| 341 | Ga0501038_0001433 | 3300049574 | Bacteria | 21875 |
| 342 | Ga0501040_0059385 | 3300049576 | Bacteria | 2627 |
| 343 | Ga0501042_0050740 | 3300049578 | Bacteria | 2959 |
| 344 | Ga0501042_0079923 | 3300049578 | Bacteria | 2343 |
| 345 | Ga0501043_0001710 | 3300049579 | Bacteria | 19005 |
| 346 | Ga0501043_0219039 | 3300049579 | Bacteria | 1473 |
| 347 | Ga0501046_0002042 | 3300049580 | Bacteria | 19179 |
| 348 | Ga0501047_0002582 | 3300049581 | Bacteria | 17235 |
| 349 | Ga0501047_0032521 | 3300049581 | Bacteria | 5036 |
| 350 | Ga0501047_0112299 | 3300049581 | Bacteria | 2607 |
| 351 | Ga0501047_0188129 | 3300049581 | Bacteria | 1929 |
| 352 | Ga0501048_0000406 | 3300049582 | Bacteria | 29993 |
| 353 | Ga0501068_0095818 | 3300049584 | Bacteria | 1835 |
| 354 | Ga0501069_0015868 | 3300049585 | Bacteria | 4038 |
| 355 | Ga0501070_0000079 | 3300049586 | Bacteria | 82054 |
| 356 | Ga0501070_0171934 | 3300049586 | Unclassified | 1784 |
| 357 | Ga0501070_0414675 | 3300049586 | Unclassified | 1088 |
| 358 | Ga0501071_0012633 | 3300049587 | Bacteria | 5736 |
| 359 | Ga0501071_0093518 | 3300049587 | Bacteria | 2211 |
| 360 | Ga0501072_0152867 | 3300049588 | Bacteria | 1840 |
| 361 | Ga0501073_0085895 | 3300049589 | Bacteria | 2188 |
| 362 | Ga0501074_0082422 | 3300049590 | Bacteria | 2306 |
| 363 | Ga0501074_0087841 | 3300049590 | Bacteria | 2226 |
| 364 | Ga0501075_0000855 | 3300049591 | Bacteria | 19203 |
| 365 | Ga0501079_0005145 | 3300049741 | Bacteria | 9724 |
| 366 | Ga0501079_0015322 | 3300049741 | Bacteria | 5848 |
| 367 | Ga0501080_0034327 | 3300049742 | Bacteria | 4734 |
| 368 | Ga0501080_0092475 | 3300049742 | Bacteria | 2809 |
| 369 | Ga0501080_0297045 | 3300049742 | Bacteria | 1466 |
| 370 | Ga0501083_0000966 | 3300049744 | Bacteria | 19025 |
| 371 | Ga0501083_0006940 | 3300049744 | Bacteria | 8036 |
| 372 | Ga0501083_0192002 | 3300049744 | Bacteria | 1333 |
| 373 | Ga0501035_0000059 | 3300049822 | Bacteria | 134506 |
| 374 | Ga0501044_0000417 | 3300049823 | Bacteria | 52579 |
| 375 | Ga0501044_0069036 | 3300049823 | Bacteria | 3599 |
| 376 | Ga0501045_0120203 | 3300049824 | Bacteria | 1950 |
| 377 | nmdc:mga03n38_28209_c1 | 3300050490 | Bacteria | 2337 |
| 378 | nmdc:mga0yw44_13135_c1 | 3300050492 | Bacteria | 4348 |
| 379 | nmdc:mga0yw44_141761_c1 | 3300050492 | Unclassified | 1562 |
| 380 | nmdc:mga0a205_758_c1 | 3300050515 | Bacteria | 26047 |
| 381 | nmdc:mga0a205_9_c1 | 3300050515 | Bacteria | 55726 |
| 382 | Ga0495601_0000012 | 3300053077 | Bacteria | 227853 |
| 383 | Ga0495601_0023045 | 3300053077 | Bacteria | 3825 |
| 384 | Ga0495612_0000843 | 3300053078 | Bacteria | 12451 |
| 385 | Ga0495655_0000003 | 3300053083 | Bacteria | 303053 |
| 386 | Ga0495595_0000001 | 3300053084 | Bacteria | 495226 |
| 387 | Ga0495595_0000109 | 3300053084 | Bacteria | 37617 |
| 388 | Ga0495619_0000020 | 3300053085 | Bacteria | 201556 |
| 389 | Ga0495619_0000024 | 3300053085 | Bacteria | 180821 |
| 390 | Ga0495619_0000192 | 3300053085 | Bacteria | 45153 |
| 391 | Ga0495619_0000909 | 3300053085 | Bacteria | 19385 |
| 392 | Ga0495619_0003820 | 3300053085 | Bacteria | 9695 |
| 393 | Ga0495619_0033526 | 3300053085 | Bacteria | 3335 |
| 394 | Ga0500641_0008785 | 3300053096 | Bacteria | 3616 |
| 395 | Ga0500595_028569 | 3300053119 | Bacteria | 1901 |
| 396 | Ga0500614_003634 | 3300053123 | Bacteria | 3310 |
| 397 | Ga0500628_000002 | 3300053129 | Bacteria | 357687 |
| 398 | Ga0530510_0154803 | 3300061734 | Unclassified | 1694 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036712 | Ga0316584_0121691 | Ga0316584_0121691_489_1271 | 256 |
| 2 | 3300050492 | nmdc:mga0yw44_141761_c1 | nmdc:mga0yw44_141761_c1_495_1289 | 259 |
| 3 | 3300048913 | Ga0496110_0000623 | Ga0496110_0000623_3515_4435 | 279 |
| 4 | 3300048914 | Ga0496111_0000004 | Ga0496111_0000004_24546_25466 | 279 |
| 5 | 3300006051 | Ga0075364_10031845 | Ga0075364_100318452 | 285 |
| 6 | 3300049581 | Ga0501047_0112299 | Ga0501047_0112299_1259_2212 | 286 |
| 7 | 3300049587 | Ga0501071_0012633 | Ga0501071_0012633_3682_4635 | 286 |
| 8 | 3300049590 | Ga0501074_0087841 | Ga0501074_0087841_794_1747 | 286 |
| 9 | 3300049744 | Ga0501083_0006940 | Ga0501083_0006940_3273_4235 | 288 |
| 10 | 3300049823 | Ga0501044_0069036 | Ga0501044_0069036_2349_3311 | 288 |
| 11 | 3300049581 | Ga0501047_0188129 | Ga0501047_0188129_238_1203 | 291 |
| 12 | 3300050492 | nmdc:mga0yw44_13135_c1 | nmdc:mga0yw44_13135_c1_564_1532 | 291 |
| 13 | 3300005331 | Ga0070670_100038748 | Ga0070670_1000387484 | 293 |
| 14 | 3300025925 | Ga0207650_10028940 | Ga0207650_100289404 | 293 |
| 15 | 3300049579 | Ga0501043_0219039 | Ga0501043_0219039_230_1183 | 293 |
| 16 | 3300049741 | Ga0501079_0005145 | Ga0501079_0005145_386_1339 | 293 |
| 17 | 3300049742 | Ga0501080_0034327 | Ga0501080_0034327_3273_4226 | 293 |
| 18 | 3300005335 | Ga0070666_10085952 | Ga0070666_100859522 | 294 |
| 19 | 3300005367 | Ga0070667_100040624 | Ga0070667_1000406242 | 294 |
| 20 | 3300005548 | Ga0070665_100208389 | Ga0070665_1002083892 | 294 |
| 21 | 3300025903 | Ga0207680_10028112 | Ga0207680_100281122 | 294 |
| 22 | 3300025986 | Ga0207658_10005758 | Ga0207658_100057583 | 294 |
| 23 | 3300028379 | Ga0268266_10000324 | Ga0268266_1000032410 | 294 |
| 24 | 3300036401 | Ga0373937_0010103 | Ga0373937_0010103_2338_3315 | 294 |
| 25 | 3300048911 | Ga0496108_0000024 | Ga0496108_0000024_63996_64919 | 294 |
| 26 | 3300048912 | Ga0496109_0000033 | Ga0496109_0000033_41103_42026 | 294 |
| 27 | 3300048929 | Ga0496126_0227219 | Ga0496126_0227219_533_1492 | 294 |
| 28 | 3300048928 | Ga0496125_0203146 | Ga0496125_0203146_68_1033 | 295 |
| 29 | 3300046660 | Ga0495625_0000020 | Ga0495625_0000020_222100_223098 | 297 |
| 30 | 3300005341 | Ga0070691_10000006 | Ga0070691_1000000621 | 298 |
| 31 | 3300005365 | Ga0070688_100000468 | Ga0070688_10000046812 | 298 |
| 32 | 3300009101 | Ga0105247_10079489 | Ga0105247_100794892 | 298 |
| 33 | 3300005614 | Ga0068856_100000403 | Ga0068856_10000040319 | 299 |
| 34 | 3300006038 | Ga0075365_10019940 | Ga0075365_100199408 | 299 |
| 35 | 3300006048 | Ga0075363_100040803 | Ga0075363_1000408032 | 299 |
| 36 | 3300006051 | Ga0075364_10273073 | Ga0075364_102730732 | 299 |
| 37 | 3300014326 | Ga0157380_10206717 | Ga0157380_102067172 | 299 |
| 38 | 3300026078 | Ga0207702_10000027 | Ga0207702_10000027172 | 299 |
| 39 | 3300050490 | nmdc:mga03n38_28209_c1 | nmdc:mga03n38_28209_c1_254_1222 | 299 |
| 40 | 3300048911 | Ga0496108_0000002 | Ga0496108_0000002_224608_225591 | 300 |
| 41 | 3300048912 | Ga0496109_0000001 | Ga0496109_0000001_224570_225553 | 300 |
| 42 | 3300005329 | Ga0070683_100044735 | Ga0070683_1000447352 | 301 |
| 43 | 3300005564 | Ga0070664_100068607 | Ga0070664_1000686074 | 301 |
| 44 | 3300010375 | Ga0105239_10084325 | Ga0105239_100843252 | 301 |
| 45 | 3300025944 | Ga0207661_10032158 | Ga0207661_100321584 | 301 |
| 46 | 3300025945 | Ga0207679_10111900 | Ga0207679_101119003 | 301 |
| 47 | 3300046515 | Ga0495620_0005333 | Ga0495620_0005333_2002_2973 | 301 |
| 48 | 3300046533 | Ga0495640_0012284 | Ga0495640_0012284_2794_3753 | 301 |
| 49 | 3300046642 | Ga0495634_0000910 | Ga0495634_0000910_20948_21940 | 301 |
| 50 | 3300047319 | Ga0495674_0000007 | Ga0495674_0000007_9584_10543 | 301 |
| 51 | 3300048905 | Ga0496102_0073447 | Ga0496102_0073447_1642_2595 | 301 |
| 52 | 3300048906 | Ga0496103_0012116 | Ga0496103_0012116_2574_3527 | 301 |
| 53 | 3300035398 | Ga0316574_0028527 | Ga0316574_0028527_976_1914 | 302 |
| 54 | 3300047472 | Ga0495686_0041131 | Ga0495686_0041131_1048_2013 | 302 |
| 55 | 3300009174 | Ga0105241_10219283 | Ga0105241_102192832 | 303 |
| 56 | 3300028563 | Ga0265319_1000421 | Ga0265319_100042120 | 303 |
| 57 | 3300028800 | Ga0265338_10002111 | Ga0265338_100021119 | 303 |
| 58 | 3300031241 | Ga0265325_10002586 | Ga0265325_100025867 | 303 |
| 59 | 3300046517 | Ga0495630_0153555 | Ga0495630_0153555_783_1736 | 303 |
| 60 | 3300046689 | Ga0495613_0000185 | Ga0495613_0000185_22828_23748 | 303 |
| 61 | 3300053077 | Ga0495601_0000012 | Ga0495601_0000012_117362_118282 | 303 |
| 62 | 3300005366 | Ga0070659_100005667 | Ga0070659_1000056678 | 304 |
| 63 | 3300005436 | Ga0070713_100023846 | Ga0070713_1000238465 | 304 |
| 64 | 3300013104 | Ga0157370_10007442 | Ga0157370_1000744211 | 304 |
| 65 | 3300014325 | Ga0163163_10160997 | Ga0163163_101609972 | 304 |
| 66 | 3300025928 | Ga0207700_10538298 | Ga0207700_105382982 | 304 |
| 67 | 3300025932 | Ga0207690_10004598 | Ga0207690_100045984 | 304 |
| 68 | 3300049571 | Ga0501034_0253968 | Ga0501034_0253968_244_1197 | 304 |
| 69 | 3300049586 | Ga0501070_0171934 | Ga0501070_0171934_724_1659 | 304 |
| 70 | 3300049586 | Ga0501070_0414675 | Ga0501070_0414675_38_973 | 304 |
| 71 | 3300049744 | Ga0501083_0192002 | Ga0501083_0192002_208_1140 | 304 |
| 72 | 3300005330 | Ga0070690_100132560 | Ga0070690_1001325602 | 305 |
| 73 | 3300005337 | Ga0070682_100000016 | Ga0070682_100000016222 | 305 |
| 74 | 3300005365 | Ga0070688_100000225 | Ga0070688_10000022512 | 305 |
| 75 | 3300005455 | Ga0070663_100000641 | Ga0070663_1000006412 | 305 |
| 76 | 3300005456 | Ga0070678_100035596 | Ga0070678_1000355964 | 305 |
| 77 | 3300005457 | Ga0070662_100000008 | Ga0070662_100000008101 | 305 |
| 78 | 3300005466 | Ga0070685_10000124 | Ga0070685_1000012412 | 305 |
| 79 | 3300005530 | Ga0070679_100001824 | Ga0070679_1000018246 | 305 |
| 80 | 3300005544 | Ga0070686_100188946 | Ga0070686_1001889462 | 305 |
| 81 | 3300005578 | Ga0068854_100001877 | Ga0068854_1000018774 | 305 |
| 82 | 3300005834 | Ga0068851_10001306 | Ga0068851_100013064 | 305 |
| 83 | 3300013308 | Ga0157375_10070732 | Ga0157375_100707322 | 305 |
| 84 | 3300025321 | Ga0207656_10000727 | Ga0207656_100007278 | 305 |
| 85 | 3300025903 | Ga0207680_10299918 | Ga0207680_102999181 | 305 |
| 86 | 3300025921 | Ga0207652_10001669 | Ga0207652_100016699 | 305 |
| 87 | 3300025933 | Ga0207706_10000016 | Ga0207706_1000001673 | 305 |
| 88 | 3300025981 | Ga0207640_10000122 | Ga0207640_1000012235 | 305 |
| 89 | 3300026067 | Ga0207678_10001410 | Ga0207678_100014106 | 305 |
| 90 | 3300026121 | Ga0207683_10055449 | Ga0207683_100554492 | 305 |
| 91 | 3300048913 | Ga0496110_0030719 | Ga0496110_0030719_2134_3063 | 305 |
| 92 | 3300048914 | Ga0496111_0134303 | Ga0496111_0134303_122_1051 | 305 |
| 93 | 3300048920 | Ga0496117_0066044 | Ga0496117_0066044_374_1369 | 305 |
| 94 | 3300048921 | Ga0496118_0110916 | Ga0496118_0110916_787_1782 | 305 |
| 95 | 3300048922 | Ga0496119_0058474 | Ga0496119_0058474_518_1513 | 305 |
| 96 | 3300048924 | Ga0496121_0015158 | Ga0496121_0015158_6011_6973 | 305 |
| 97 | 3300048924 | Ga0496121_0140818 | Ga0496121_0140818_525_1520 | 305 |
| 98 | 3300048927 | Ga0496124_0120528 | Ga0496124_0120528_743_1702 | 305 |
| 99 | 3300048927 | Ga0496124_0193034 | Ga0496124_0193034_39_968 | 305 |
| 100 | 3300053085 | Ga0495619_0000020 | Ga0495619_0000020_176011_177000 | 305 |
| 101 | 3300001979 | JGI24740J21852_10015307 | JGI24740J21852_100153074 | 306 |
| 102 | 3300005338 | Ga0068868_100005673 | Ga0068868_1000056735 | 306 |
| 103 | 3300005367 | Ga0070667_100366095 | Ga0070667_1003660952 | 306 |
| 104 | 3300005459 | Ga0068867_100000179 | Ga0068867_10000017945 | 306 |
| 105 | 3300005548 | Ga0070665_100000725 | Ga0070665_10000072510 | 306 |
| 106 | 3300006881 | Ga0068865_100000020 | Ga0068865_100000020105 | 306 |
| 107 | 3300009098 | Ga0105245_10000327 | Ga0105245_1000032713 | 306 |
| 108 | 3300009177 | Ga0105248_10000803 | Ga0105248_1000080321 | 306 |
| 109 | 3300010375 | Ga0105239_10240039 | Ga0105239_102400392 | 306 |
| 110 | 3300014326 | Ga0157380_10428522 | Ga0157380_104285222 | 306 |
| 111 | 3300025900 | Ga0207710_10018459 | Ga0207710_100184594 | 306 |
| 112 | 3300025924 | Ga0207694_10080216 | Ga0207694_100802162 | 306 |
| 113 | 3300025927 | Ga0207687_10000021 | Ga0207687_1000002113 | 306 |
| 114 | 3300025938 | Ga0207704_10000004 | Ga0207704_1000000489 | 306 |
| 115 | 3300025941 | Ga0207711_10000019 | Ga0207711_1000001921 | 306 |
| 116 | 3300025949 | Ga0207667_10109267 | Ga0207667_101092673 | 306 |
| 117 | 3300025986 | Ga0207658_10353965 | Ga0207658_103539652 | 306 |
| 118 | 3300026023 | Ga0207677_10001003 | Ga0207677_1000100312 | 306 |
| 119 | 3300026089 | Ga0207648_10000228 | Ga0207648_1000022844 | 306 |
| 120 | 3300028379 | Ga0268266_10001184 | Ga0268266_1000118431 | 306 |
| 121 | 3300028556 | Ga0265337_1000013 | Ga0265337_100001363 | 306 |
| 122 | 3300028558 | Ga0265326_10000012 | Ga0265326_10000012106 | 306 |
| 123 | 3300028654 | Ga0265322_10000003 | Ga0265322_10000003393 | 306 |
| 124 | 3300031238 | Ga0265332_10020728 | Ga0265332_100207284 | 306 |
| 125 | 3300031239 | Ga0265328_10000700 | Ga0265328_1000070012 | 306 |
| 126 | 3300031240 | Ga0265320_10000001 | Ga0265320_10000001393 | 306 |
| 127 | 3300031242 | Ga0265329_10005962 | Ga0265329_100059626 | 306 |
| 128 | 3300031249 | Ga0265339_10062855 | Ga0265339_100628552 | 306 |
| 129 | 3300031250 | Ga0265331_10001257 | Ga0265331_1000125716 | 306 |
| 130 | 3300031251 | Ga0265327_10000003 | Ga0265327_10000003393 | 306 |
| 131 | 3300031344 | Ga0265316_10073539 | Ga0265316_100735393 | 306 |
| 132 | 3300031711 | Ga0265314_10000044 | Ga0265314_1000004474 | 306 |
| 133 | 3300046559 | Ga0495667_0000015 | Ga0495667_0000015_102087_103064 | 306 |
| 134 | 3300047322 | Ga0495680_0001062 | Ga0495680_0001062_24899_25876 | 306 |
| 135 | 3300048088 | Ga0495602_0001999 | Ga0495602_0001999_2262_3239 | 306 |
| 136 | 3300048905 | Ga0496102_0008829 | Ga0496102_0008829_2115_3089 | 306 |
| 137 | 3300048907 | Ga0496104_0042581 | Ga0496104_0042581_2247_3209 | 306 |
| 138 | 3300048917 | Ga0496114_0100948 | Ga0496114_0100948_704_1639 | 306 |
| 139 | 3300048920 | Ga0496117_0002396 | Ga0496117_0002396_5127_6101 | 306 |
| 140 | 3300048921 | Ga0496118_0001663 | Ga0496118_0001663_27004_27978 | 306 |
| 141 | 3300048923 | Ga0496120_0012622 | Ga0496120_0012622_1588_2604 | 306 |
| 142 | 3300048928 | Ga0496125_0026708 | Ga0496125_0026708_3871_4833 | 306 |
| 143 | 3300049587 | Ga0501071_0093518 | Ga0501071_0093518_42_971 | 306 |
| 144 | 3300049742 | Ga0501080_0297045 | Ga0501080_0297045_307_1263 | 306 |
| 145 | 3300053119 | Ga0500595_028569 | Ga0500595_028569_296_1270 | 306 |
| 146 | 3300005329 | Ga0070683_100000190 | Ga0070683_10000019011 | 307 |
| 147 | 3300005548 | Ga0070665_100152684 | Ga0070665_1001526842 | 307 |
| 148 | 3300005614 | Ga0068856_100012776 | Ga0068856_10001277610 | 307 |
| 149 | 3300005616 | Ga0068852_100000013 | Ga0068852_100000013118 | 307 |
| 150 | 3300005618 | Ga0068864_100000044 | Ga0068864_100000044119 | 307 |
| 151 | 3300006175 | Ga0070712_100001773 | Ga0070712_1000017734 | 307 |
| 152 | 3300006852 | Ga0075433_10000031 | Ga0075433_100000313 | 307 |
| 153 | 3300009093 | Ga0105240_10378925 | Ga0105240_103789252 | 307 |
| 154 | 3300009098 | Ga0105245_10000045 | Ga0105245_1000004518 | 307 |
| 155 | 3300013105 | Ga0157369_10000037 | Ga0157369_1000003723 | 307 |
| 156 | 3300014326 | Ga0157380_10000024 | Ga0157380_10000024104 | 307 |
| 157 | 3300025915 | Ga0207693_10004681 | Ga0207693_100046814 | 307 |
| 158 | 3300025927 | Ga0207687_10000023 | Ga0207687_1000002318 | 307 |
| 159 | 3300025935 | Ga0207709_10005335 | Ga0207709_100053357 | 307 |
| 160 | 3300025944 | Ga0207661_10000339 | Ga0207661_1000033911 | 307 |
| 161 | 3300026078 | Ga0207702_10002040 | Ga0207702_1000204012 | 307 |
| 162 | 3300026095 | Ga0207676_10000043 | Ga0207676_10000043118 | 307 |
| 163 | 3300026142 | Ga0207698_10000002 | Ga0207698_10000002245 | 307 |
| 164 | 3300028379 | Ga0268266_10082124 | Ga0268266_100821242 | 307 |
| 165 | 3300028379 | Ga0268266_10108225 | Ga0268266_101082253 | 307 |
| 166 | 3300046455 | Ga0495603_0000095 | Ga0495603_0000095_21_977 | 307 |
| 167 | 3300046461 | Ga0495641_0000187 | Ga0495641_0000187_33013_33948 | 307 |
| 168 | 3300046536 | Ga0495587_0038069 | Ga0495587_0038069_491_1426 | 307 |
| 169 | 3300047321 | Ga0495676_0000400 | Ga0495676_0000400_11227_12276 | 307 |
| 170 | 3300048903 | Ga0496100_0000008 | Ga0496100_0000008_110770_111786 | 307 |
| 171 | 3300048904 | Ga0496101_0000016 | Ga0496101_0000016_119552_120568 | 307 |
| 172 | 3300048909 | Ga0496106_0000085 | Ga0496106_0000085_35370_36386 | 307 |
| 173 | 3300048910 | Ga0496107_0000009 | Ga0496107_0000009_110484_111500 | 307 |
| 174 | 3300048912 | Ga0496109_0000237 | Ga0496109_0000237_24922_25908 | 307 |
| 175 | 3300048912 | Ga0496109_0000299 | Ga0496109_0000299_7723_8715 | 307 |
| 176 | 3300049568 | Ga0501031_0000251 | Ga0501031_0000251_13335_14300 | 307 |
| 177 | 3300049569 | Ga0501032_0011731 | Ga0501032_0011731_4227_5192 | 307 |
| 178 | 3300049570 | Ga0501033_0001728 | Ga0501033_0001728_4790_5755 | 307 |
| 179 | 3300049571 | Ga0501034_0001057 | Ga0501034_0001057_32126_33091 | 307 |
| 180 | 3300049572 | Ga0501036_0000413 | Ga0501036_0000413_13356_14321 | 307 |
| 181 | 3300049573 | Ga0501037_0001212 | Ga0501037_0001212_4749_5714 | 307 |
| 182 | 3300049574 | Ga0501038_0001433 | Ga0501038_0001433_4879_5844 | 307 |
| 183 | 3300049576 | Ga0501040_0059385 | Ga0501040_0059385_667_1632 | 307 |
| 184 | 3300049578 | Ga0501042_0050740 | Ga0501042_0050740_1858_2823 | 307 |
| 185 | 3300049579 | Ga0501043_0001710 | Ga0501043_0001710_13313_14278 | 307 |
| 186 | 3300049580 | Ga0501046_0002042 | Ga0501046_0002042_13397_14362 | 307 |
| 187 | 3300049581 | Ga0501047_0002582 | Ga0501047_0002582_5188_6153 | 307 |
| 188 | 3300049582 | Ga0501048_0000406 | Ga0501048_0000406_13383_14348 | 307 |
| 189 | 3300049585 | Ga0501069_0015868 | Ga0501069_0015868_80_1045 | 307 |
| 190 | 3300049586 | Ga0501070_0000079 | Ga0501070_0000079_67405_68370 | 307 |
| 191 | 3300049588 | Ga0501072_0152867 | Ga0501072_0152867_779_1744 | 307 |
| 192 | 3300049589 | Ga0501073_0085895 | Ga0501073_0085895_439_1404 | 307 |
| 193 | 3300049590 | Ga0501074_0082422 | Ga0501074_0082422_916_1881 | 307 |
| 194 | 3300049741 | Ga0501079_0015322 | Ga0501079_0015322_4728_5693 | 307 |
| 195 | 3300049742 | Ga0501080_0092475 | Ga0501080_0092475_213_1178 | 307 |
| 196 | 3300049744 | Ga0501083_0000966 | Ga0501083_0000966_4938_5903 | 307 |
| 197 | 3300049822 | Ga0501035_0000059 | Ga0501035_0000059_78248_79213 | 307 |
| 198 | 3300049823 | Ga0501044_0000417 | Ga0501044_0000417_38291_39256 | 307 |
| 199 | 3300049824 | Ga0501045_0120203 | Ga0501045_0120203_171_1136 | 307 |
| 200 | 3300050515 | nmdc:mga0a205_9_c1 | nmdc:mga0a205_9_c1_872_1822 | 307 |
| 201 | 3300053123 | Ga0500614_003634 | Ga0500614_003634_1789_2724 | 307 |
| 202 | 3300005344 | Ga0070661_100000217 | Ga0070661_10000021726 | 308 |
| 203 | 3300025920 | Ga0207649_10001043 | Ga0207649_1000104311 | 308 |
| 204 | 3300028381 | Ga0268264_10429951 | Ga0268264_104299512 | 308 |
| 205 | 3300047317 | Ga0495604_0032469 | Ga0495604_0032469_860_1792 | 308 |
| 206 | 3300048088 | Ga0495602_0000010 | Ga0495602_0000010_116349_117335 | 308 |
| 207 | 3300048905 | Ga0496102_0000054 | Ga0496102_0000054_60745_61680 | 308 |
| 208 | 3300048906 | Ga0496103_0000079 | Ga0496103_0000079_48958_49893 | 308 |
| 209 | 3300048907 | Ga0496104_0000063 | Ga0496104_0000063_15051_16004 | 308 |
| 210 | 3300048908 | Ga0496105_0000041 | Ga0496105_0000041_100615_101568 | 308 |
| 211 | 3300048918 | Ga0496115_0000074 | Ga0496115_0000074_80447_81412 | 308 |
| 212 | 3300048922 | Ga0496119_0007318 | Ga0496119_0007318_655_1608 | 308 |
| 213 | 3300053085 | Ga0495619_0000192 | Ga0495619_0000192_8416_9363 | 308 |
| 214 | 3300053085 | Ga0495619_0033526 | Ga0495619_0033526_1758_2690 | 308 |
| 215 | 3300005455 | Ga0070663_100207363 | Ga0070663_1002073632 | 309 |
| 216 | 3300005543 | Ga0070672_100000039 | Ga0070672_10000003936 | 309 |
| 217 | 3300005834 | Ga0068851_10001155 | Ga0068851_1000115513 | 309 |
| 218 | 3300009177 | Ga0105248_10098732 | Ga0105248_100987323 | 309 |
| 219 | 3300025321 | Ga0207656_10036913 | Ga0207656_100369132 | 309 |
| 220 | 3300025940 | Ga0207691_10000199 | Ga0207691_1000019936 | 309 |
| 221 | 3300028379 | Ga0268266_10199527 | Ga0268266_101995272 | 309 |
| 222 | 3300046459 | Ga0495629_0001002 | Ga0495629_0001002_3306_4304 | 309 |
| 223 | 3300046642 | Ga0495634_0000592 | Ga0495634_0000592_26319_27290 | 309 |
| 224 | 3300047321 | Ga0495676_0063345 | Ga0495676_0063345_751_1734 | 309 |
| 225 | 3300048915 | Ga0496112_0000002 | Ga0496112_0000002_663312_664289 | 309 |
| 226 | 3300005354 | Ga0070675_100000429 | Ga0070675_1000004294 | 310 |
| 227 | 3300005435 | Ga0070714_100008433 | Ga0070714_1000084334 | 310 |
| 228 | 3300005937 | Ga0081455_10002828 | Ga0081455_100028286 | 310 |
| 229 | 3300009176 | Ga0105242_10002594 | Ga0105242_100025943 | 310 |
| 230 | 3300025928 | Ga0207700_10000009 | Ga0207700_10000009150 | 310 |
| 231 | 3300025934 | Ga0207686_10000544 | Ga0207686_1000054418 | 310 |
| 232 | 3300026035 | Ga0207703_10083415 | Ga0207703_100834151 | 310 |
| 233 | 3300045976 | Ga0466967_0000004 | Ga0466967_0000004_24786_25790 | 310 |
| 234 | 3300046499 | Ga0495594_0000004 | Ga0495594_0000004_52480_53448 | 310 |
| 235 | 3300046517 | Ga0495630_0000037 | Ga0495630_0000037_82706_83710 | 310 |
| 236 | 3300046543 | Ga0495645_0006912 | Ga0495645_0006912_4762_5718 | 310 |
| 237 | 3300046690 | Ga0495624_0007342 | Ga0495624_0007342_2224_3228 | 310 |
| 238 | 3300048088 | Ga0495602_0066345 | Ga0495602_0066345_955_1908 | 310 |
| 239 | 3300048917 | Ga0496114_0223240 | Ga0496114_0223240_362_1315 | 310 |
| 240 | 3300049571 | Ga0501034_0002306 | Ga0501034_0002306_1486_2469 | 310 |
| 241 | 3300049571 | Ga0501034_0028939 | Ga0501034_0028939_688_1683 | 310 |
| 242 | 3300049581 | Ga0501047_0032521 | Ga0501047_0032521_734_1717 | 310 |
| 243 | 3300053083 | Ga0495655_0000003 | Ga0495655_0000003_66742_67734 | 310 |
| 244 | 3300053129 | Ga0500628_000002 | Ga0500628_000002_66742_67734 | 310 |
| 245 | 3300003659 | JGI25404J52841_10001611 | JGI25404J52841_100016111 | 311 |
| 246 | 3300005329 | Ga0070683_100026488 | Ga0070683_1000264883 | 311 |
| 247 | 3300005347 | Ga0070668_100004533 | Ga0070668_1000045336 | 311 |
| 248 | 3300005367 | Ga0070667_100036060 | Ga0070667_1000360605 | 311 |
| 249 | 3300005367 | Ga0070667_100186694 | Ga0070667_1001866942 | 311 |
| 250 | 3300005535 | Ga0070684_100072078 | Ga0070684_1000720782 | 311 |
| 251 | 3300005548 | Ga0070665_100123267 | Ga0070665_1001232672 | 311 |
| 252 | 3300005841 | Ga0068863_100065201 | Ga0068863_1000652011 | 311 |
| 253 | 3300005842 | Ga0068858_100438445 | Ga0068858_1004384452 | 311 |
| 254 | 3300005843 | Ga0068860_100084749 | Ga0068860_1000847493 | 311 |
| 255 | 3300005844 | Ga0068862_100003975 | Ga0068862_1000039755 | 311 |
| 256 | 3300009098 | Ga0105245_10000150 | Ga0105245_1000015028 | 311 |
| 257 | 3300009101 | Ga0105247_10000712 | Ga0105247_1000071221 | 311 |
| 258 | 3300009176 | Ga0105242_10000120 | Ga0105242_1000012050 | 311 |
| 259 | 3300009553 | Ga0105249_10003887 | Ga0105249_1000388714 | 311 |
| 260 | 3300017792 | Ga0163161_10262495 | Ga0163161_102624952 | 311 |
| 261 | 3300025900 | Ga0207710_10000103 | Ga0207710_100001035 | 311 |
| 262 | 3300025927 | Ga0207687_10000099 | Ga0207687_1000009927 | 311 |
| 263 | 3300025934 | Ga0207686_10000176 | Ga0207686_1000017649 | 311 |
| 264 | 3300025944 | Ga0207661_10017970 | Ga0207661_100179703 | 311 |
| 265 | 3300025972 | Ga0207668_10010976 | Ga0207668_100109764 | 311 |
| 266 | 3300025986 | Ga0207658_10023009 | Ga0207658_100230094 | 311 |
| 267 | 3300026035 | Ga0207703_10109761 | Ga0207703_101097612 | 311 |
| 268 | 3300026088 | Ga0207641_10043456 | Ga0207641_100434564 | 311 |
| 269 | 3300028379 | Ga0268266_10068496 | Ga0268266_100684963 | 311 |
| 270 | 3300028380 | Ga0268265_10008188 | Ga0268265_100081883 | 311 |
| 271 | 3300028381 | Ga0268264_10075637 | Ga0268264_100756374 | 311 |
| 272 | 3300041512 | Ga0451853_3177988 | Ga0451853_3177988_771_1769 | 311 |
| 273 | 3300046459 | Ga0495629_0000682 | Ga0495629_0000682_24430_25377 | 311 |
| 274 | 3300047444 | Ga0495675_0039612 | Ga0495675_0039612_1421_2401 | 311 |
| 275 | 3300049584 | Ga0501068_0095818 | Ga0501068_0095818_106_1077 | 311 |
| 276 | 3300053096 | Ga0500641_0008785 | Ga0500641_0008785_2479_3489 | 311 |
| 277 | 3300025899 | Ga0207642_10014164 | Ga0207642_100141642 | 312 |
| 278 | 3300046455 | Ga0495603_0001218 | Ga0495603_0001218_469_1428 | 312 |
| 279 | 3300046557 | Ga0495622_0000016 | Ga0495622_0000016_18117_19091 | 312 |
| 280 | 3300048089 | Ga0495614_0020870 | Ga0495614_0020870_266_1261 | 312 |
| 281 | 3300048917 | Ga0496114_0000010 | Ga0496114_0000010_142956_143939 | 312 |
| 282 | 3300048918 | Ga0496115_0000850 | Ga0496115_0000850_595_1578 | 312 |
| 283 | 3300046514 | Ga0495618_0000068 | Ga0495618_0000068_51012_51989 | 313 |
| 284 | 3300046516 | Ga0495628_0134017 | Ga0495628_0134017_585_1532 | 313 |
| 285 | 3300046529 | Ga0495652_0006039 | Ga0495652_0006039_7226_8173 | 313 |
| 286 | 3300046539 | Ga0495621_0007695 | Ga0495621_0007695_1494_2438 | 313 |
| 287 | 3300046543 | Ga0495645_0013323 | Ga0495645_0013323_1199_2146 | 313 |
| 288 | 3300046809 | Ga0495600_0001883 | Ga0495600_0001883_3526_4503 | 313 |
| 289 | 3300047322 | Ga0495680_0002013 | Ga0495680_0002013_6204_7154 | 313 |
| 290 | 3300061734 | Ga0530510_0154803 | Ga0530510_0154803_412_1401 | 313 |
| 291 | 3300002074 | JGI24748J21848_1000153 | JGI24748J21848_10001539 | 314 |
| 292 | 3300002239 | JGI24034J26672_10000074 | JGI24034J26672_1000007416 | 314 |
| 293 | 3300005333 | Ga0070677_10000048 | Ga0070677_1000004818 | 314 |
| 294 | 3300005439 | Ga0070711_100108847 | Ga0070711_1001088471 | 314 |
| 295 | 3300025893 | Ga0207682_10000168 | Ga0207682_1000016815 | 314 |
| 296 | 3300025916 | Ga0207663_10331258 | Ga0207663_103312581 | 314 |
| 297 | 3300046529 | Ga0495652_0081240 | Ga0495652_0081240_711_1655 | 314 |
| 298 | 3300046642 | Ga0495634_0011662 | Ga0495634_0011662_5159_6142 | 314 |
| 299 | 3300046689 | Ga0495613_0000257 | Ga0495613_0000257_20320_21315 | 314 |
| 300 | 3300047322 | Ga0495680_0000023 | Ga0495680_0000023_49125_50120 | 314 |
| 301 | 3300048088 | Ga0495602_0052115 | Ga0495602_0052115_2314_3267 | 314 |
| 302 | 3300048907 | Ga0496104_0000003 | Ga0496104_0000003_136975_137958 | 314 |
| 303 | 3300005365 | Ga0070688_100014171 | Ga0070688_1000141715 | 315 |
| 304 | 3300005466 | Ga0070685_10116617 | Ga0070685_101166172 | 315 |
| 305 | 3300005548 | Ga0070665_100000120 | Ga0070665_10000012017 | 315 |
| 306 | 3300005842 | Ga0068858_100000035 | Ga0068858_10000003515 | 315 |
| 307 | 3300009553 | Ga0105249_10000095 | Ga0105249_100000959 | 315 |
| 308 | 3300014968 | Ga0157379_10014627 | Ga0157379_100146275 | 315 |
| 309 | 3300025961 | Ga0207712_10000003 | Ga0207712_10000003503 | 315 |
| 310 | 3300026035 | Ga0207703_10000067 | Ga0207703_1000006748 | 315 |
| 311 | 3300028379 | Ga0268266_10000023 | Ga0268266_10000023377 | 315 |
| 312 | 3300041512 | Ga0451853_2601553 | Ga0451853_2601553_85_1071 | 315 |
| 313 | 3300046511 | Ga0495608_0000001 | Ga0495608_0000001_159813_160802 | 315 |
| 314 | 3300046675 | Ga0495657_0000002 | Ga0495657_0000002_160493_161482 | 315 |
| 315 | 3300053084 | Ga0495595_0000001 | Ga0495595_0000001_250477_251466 | 315 |
| 316 | 3300005356 | Ga0070674_100000241 | Ga0070674_10000024122 | 316 |
| 317 | 3300009176 | Ga0105242_10116213 | Ga0105242_101162133 | 316 |
| 318 | 3300025934 | Ga0207686_10060684 | Ga0207686_100606842 | 316 |
| 319 | 3300025937 | Ga0207669_10000014 | Ga0207669_10000014111 | 316 |
| 320 | 3300048912 | Ga0496109_0051666 | Ga0496109_0051666_1397_2359 | 316 |
| 321 | 3300048914 | Ga0496111_0060263 | Ga0496111_0060263_1742_2704 | 316 |
| 322 | 3300053078 | Ga0495612_0000843 | Ga0495612_0000843_1342_2307 | 316 |
| 323 | 3300005539 | Ga0068853_100001640 | Ga0068853_1000016407 | 317 |
| 324 | 3300026041 | Ga0207639_10001333 | Ga0207639_1000133313 | 317 |
| 325 | 3300026118 | Ga0207675_100236330 | Ga0207675_1002363302 | 317 |
| 326 | 3300046678 | Ga0495599_0057875 | Ga0495599_0057875_592_1563 | 317 |
| 327 | 3300005338 | Ga0068868_100000451 | Ga0068868_10000045113 | 318 |
| 328 | 3300005530 | Ga0070679_100000823 | Ga0070679_10000082319 | 318 |
| 329 | 3300026023 | Ga0207677_10000376 | Ga0207677_1000037613 | 318 |
| 330 | 3300005364 | Ga0070673_100061197 | Ga0070673_1000611972 | 319 |
| 331 | 3300005843 | Ga0068860_100005398 | Ga0068860_10000539813 | 319 |
| 332 | 3300006163 | Ga0070715_10000015 | Ga0070715_1000001587 | 319 |
| 333 | 3300025905 | Ga0207685_10000001 | Ga0207685_10000001339 | 319 |
| 334 | 3300025960 | Ga0207651_10040926 | Ga0207651_100409262 | 319 |
| 335 | 3300028381 | Ga0268264_10005149 | Ga0268264_100051494 | 319 |
| 336 | 3300026075 | Ga0207708_10053790 | Ga0207708_100537903 | 320 |
| 337 | 3300048911 | Ga0496108_0004351 | Ga0496108_0004351_576_1544 | 320 |
| 338 | 3300048912 | Ga0496109_0505026 | Ga0496109_0505026_68_1036 | 320 |
| 339 | 3300053085 | Ga0495619_0003820 | Ga0495619_0003820_3362_4345 | 320 |
| 340 | 3300005439 | Ga0070711_100008682 | Ga0070711_1000086826 | 321 |
| 341 | 3300005458 | Ga0070681_10003882 | Ga0070681_100038827 | 321 |
| 342 | 3300005841 | Ga0068863_100000080 | Ga0068863_1000000805 | 321 |
| 343 | 3300025912 | Ga0207707_10005314 | Ga0207707_100053144 | 321 |
| 344 | 3300025916 | Ga0207663_10049926 | Ga0207663_100499263 | 321 |
| 345 | 3300026088 | Ga0207641_10017737 | Ga0207641_100177374 | 321 |
| 346 | 3300005356 | Ga0070674_100000033 | Ga0070674_10000003327 | 322 |
| 347 | 3300005564 | Ga0070664_100093239 | Ga0070664_1000932393 | 322 |
| 348 | 3300005718 | Ga0068866_10000002 | Ga0068866_1000000281 | 322 |
| 349 | 3300025899 | Ga0207642_10000001 | Ga0207642_10000001527 | 322 |
| 350 | 3300025899 | Ga0207642_10000003 | Ga0207642_10000003527 | 322 |
| 351 | 3300025937 | Ga0207669_10000137 | Ga0207669_1000013727 | 322 |
| 352 | 3300025945 | Ga0207679_10049377 | Ga0207679_100493774 | 322 |
| 353 | 3300046463 | Ga0495653_0035641 | Ga0495653_0035641_93_1070 | 322 |
| 354 | 3300046511 | Ga0495608_0000702 | Ga0495608_0000702_20355_21332 | 322 |
| 355 | 3300046516 | Ga0495628_0021689 | Ga0495628_0021689_1327_2304 | 322 |
| 356 | 3300046517 | Ga0495630_0001004 | Ga0495630_0001004_6251_7228 | 322 |
| 357 | 3300046681 | Ga0495647_0000037 | Ga0495647_0000037_35352_36350 | 322 |
| 358 | 3300047471 | Ga0495684_0091697 | Ga0495684_0091697_1115_2095 | 322 |
| 359 | 3300049578 | Ga0501042_0079923 | Ga0501042_0079923_103_1077 | 322 |
| 360 | 3300053084 | Ga0495595_0000109 | Ga0495595_0000109_8384_9361 | 322 |
| 361 | 3300053085 | Ga0495619_0000909 | Ga0495619_0000909_13517_14497 | 322 |
| 362 | 3300005339 | Ga0070660_100181885 | Ga0070660_1001818852 | 323 |
| 363 | 3300005547 | Ga0070693_100000793 | Ga0070693_10000079312 | 323 |
| 364 | 3300009551 | Ga0105238_10000240 | Ga0105238_1000024039 | 323 |
| 365 | 3300013296 | Ga0157374_10000668 | Ga0157374_1000066810 | 323 |
| 366 | 3300014326 | Ga0157380_10000202 | Ga0157380_1000020219 | 323 |
| 367 | 3300025924 | Ga0207694_10000067 | Ga0207694_10000067103 | 323 |
| 368 | 3300044694 | Ga0466963_0000710 | Ga0466963_0000710_12798_13784 | 323 |
| 369 | 3300046459 | Ga0495629_0028100 | Ga0495629_0028100_2448_3419 | 323 |
| 370 | 3300046461 | Ga0495641_0013772 | Ga0495641_0013772_2198_3175 | 323 |
| 371 | 3300046463 | Ga0495653_0075953 | Ga0495653_0075953_419_1405 | 323 |
| 372 | 3300046473 | Ga0495582_0000005 | Ga0495582_0000005_124471_125448 | 323 |
| 373 | 3300046476 | Ga0495662_0000022 | Ga0495662_0000022_33798_34817 | 323 |
| 374 | 3300046523 | Ga0495644_0000600 | Ga0495644_0000600_10577_11551 | 323 |
| 375 | 3300046535 | Ga0495586_0001124 | Ga0495586_0001124_6989_7963 | 323 |
| 376 | 3300046558 | Ga0495633_0014022 | Ga0495633_0014022_1662_2645 | 323 |
| 377 | 3300046616 | Ga0495668_0023328 | Ga0495668_0023328_681_1661 | 323 |
| 378 | 3300046681 | Ga0495647_0005678 | Ga0495647_0005678_411_1418 | 323 |
| 379 | 3300046683 | Ga0495658_0000019 | Ga0495658_0000019_30733_31710 | 323 |
| 380 | 3300046690 | Ga0495624_0000013 | Ga0495624_0000013_103722_104693 | 323 |
| 381 | 3300047321 | Ga0495676_0000091 | Ga0495676_0000091_2458_3459 | 323 |
| 382 | 3300048909 | Ga0496106_0000013 | Ga0496106_0000013_200040_201020 | 323 |
| 383 | 3300049591 | Ga0501075_0000855 | Ga0501075_0000855_5977_6948 | 323 |
| 384 | 3300053077 | Ga0495601_0023045 | Ga0495601_0023045_2628_3599 | 323 |
| 385 | 3300053085 | Ga0495619_0000024 | Ga0495619_0000024_5141_6124 | 323 |
| 386 | 3300013308 | Ga0157375_10000723 | Ga0157375_1000072315 | 324 |
| 387 | 3300009176 | Ga0105242_10071243 | Ga0105242_100712433 | 325 |
| 388 | 3300025934 | Ga0207686_10136247 | Ga0207686_101362472 | 325 |
| 389 | 3300046454 | Ga0495592_0001063 | Ga0495592_0001063_6238_7224 | 325 |
| 390 | 3300046559 | Ga0495667_0046643 | Ga0495667_0046643_562_1578 | 325 |
| 391 | 3300047317 | Ga0495604_0000033 | Ga0495604_0000033_40237_41253 | 325 |
| 392 | 3300005842 | Ga0068858_100000042 | Ga0068858_100000042121 | 326 |
| 393 | 3300013296 | Ga0157374_10048215 | Ga0157374_100482154 | 326 |
| 394 | 3300026035 | Ga0207703_10000060 | Ga0207703_1000006015 | 326 |
| 395 | 3300048907 | Ga0496104_0001015 | Ga0496104_0001015_20978_21979 | 327 |
| 396 | 3300048908 | Ga0496105_0000138 | Ga0496105_0000138_6261_7262 | 327 |
| 397 | 3300050515 | nmdc:mga0a205_758_c1 | nmdc:mga0a205_758_c1_18946_19971 | 327 |
| 398 | 3300001977 | JGI24746J21847_1000405 | JGI24746J21847_10004052 | 334 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nsq-assembly1.cif.gz_A | crystal structure of pcaf | 0.8044 | 166 | 275 |
| 5trm-assembly1.cif.gz_J | crystal structure of human gcn5 histone acetyltransferase domain | 0.7942 | 166 | 275 |
| 5trm-assembly1.cif.gz_H | crystal structure of human gcn5 histone acetyltransferase domain | 0.7761 | 166 | 275 |
| 3fyn-assembly1.cif.gz_A-2 | crystal structure from the mobile metagenome of cole harbour salt marsh: integron cassette protein hfx_cass3 | 0.769 | 168 | 277 |
| 1cm0-assembly1.cif.gz_B | crystal structure of the pcaf/coenzyme-a complex | 0.7667 | 166 | 275 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6G8A0_124_211_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8499 | 216 | 277 | 3.40.630.30 |
| 1p4nA02 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8387 | 151 | 296 | 3.40.630.30 |
| af_Q2FZ34_165_379_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8243 | 151 | 275 | 3.40.630.30 |
| af_Q2FYR1_179_367_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8103 | 154 | 275 | 3.40.630.30 |
| af_P9WQ85_157_310_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8063 | 153 | 285 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537YT91-F1-model_v4 | GNAT family N-acetyltransferase | 0.9729 | 1 | 333 |
GO:0016740
|
| AF-A0A7V9HNY8-F1-model_v4 | GNAT family N-acetyltransferase | 0.9691 | 8 | 334 |
GO:0016740
|
| AF-A0A838V9A3-F1-model_v4 | GNAT family N-acetyltransferase | 0.9637 | 104 | 333 |
GO:0016740
|
| AF-A0A7V9HNY8-F1-model_v4 | GNAT family N-acetyltransferase | 0.9599 | 8 | 334 |
GO:0016740
|
| AF-A0A838V9A3-F1-model_v4 | GNAT family N-acetyltransferase | 0.9597 | 104 | 333 |
GO:0016740
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar