F434097

General Info

Members Datasets Scaffolds Average Seq Length
398 173 398 172

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0201799|Ga0395900_0201799_1346_1978
Length 210
Sequence MSVCQLFPIQVTGNGLSDCTRLPNGPCDPAGFNLDWRVSAMSFGMWEASVPLFVNSLTNMRDWLDKAAGEKDEAALIEARLAPDMRPLPAQYQMASDSAKNALARLTGTEAPSMPDTEKSFAELKDRCDRTIEYLKSFEPKSLTGSEGREVVLKFPNGSGYRFTGSEYLAGFALPNFYFHVTTAYAILRNAGVSLGKPDFLRHLGPPTAG

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
128 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
139 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
149 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
164 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
165 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
166 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
169 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
170 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
171 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
172 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
173 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.27
Nodule 0
Rhizoplane 4.77
Rhizosphere 89.45
Stem 0
Stem Tuber 0
Unclassified 1.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1021150 3300001976 Bacteria 849
2 JGI24737J22298_10002645 3300001990 Bacteria 6333
3 JGI24743J22301_10029590 3300001991 Bacteria 1075
4 Ga0065712_10024387 3300005290 Unclassified 1496
5 Ga0065715_10348461 3300005293 Unclassified 931
6 Ga0065707_10248873 3300005295 Bacteria 1132
7 Ga0070658_10010412 3300005327 Bacteria 7456
8 Ga0070658_10057703 3300005327 Bacteria 3158
9 Ga0070658_11220567 3300005327 Bacteria 654
10 Ga0070670_100014484 3300005331 Bacteria 6771
11 Ga0070670_100023002 3300005331 Bacteria 5362
12 Ga0070670_100128161 3300005331 Unclassified 2190
13 Ga0070666_10003235 3300005335 Bacteria 9891
14 Ga0070666_10078426 3300005335 Bacteria 2255
15 Ga0070666_10821150 3300005335 Unclassified 685
16 Ga0068868_100037939 3300005338 Bacteria 3738
17 Ga0068868_100260376 3300005338 Bacteria 1462
18 Ga0070660_100005456 3300005339 Bacteria 8805
19 Ga0070660_100008354 3300005339 Bacteria 7239
20 Ga0070661_100035455 3300005344 Unclassified 3623
21 Ga0070661_100066514 3300005344 Bacteria 2648
22 Ga0070661_100196154 3300005344 Unclassified 1541
23 Ga0070668_100018634 3300005347 Bacteria 5212
24 Ga0070668_100078795 3300005347 Bacteria 2578
25 Ga0070668_100224451 3300005347 Unclassified 1551
26 Ga0070668_100462636 3300005347 Bacteria 1092
27 Ga0070669_100105504 3300005353 Bacteria 2132
28 Ga0070669_100117638 3300005353 Bacteria 2024
29 Ga0070669_100369403 3300005353 Unclassified 1168
30 Ga0070675_100051826 3300005354 Bacteria 3373
31 Ga0070675_100443484 3300005354 Bacteria 1163
32 Ga0070671_100003691 3300005355 Bacteria 12005
33 Ga0070671_100075533 3300005355 Bacteria 2815
34 Ga0070671_100334375 3300005355 Bacteria 1291
35 Ga0070674_100065171 3300005356 Plasmid 2556
36 Ga0070673_100006469 3300005364 Bacteria 7618
37 Ga0070673_100041934 3300005364 Bacteria 3524
38 Ga0070673_100042797 3300005364 Bacteria 3494
39 Ga0070673_100155534 3300005364 Bacteria 1940
40 Ga0070673_100415953 3300005364 Unclassified 1205
41 Ga0070659_100053957 3300005366 Plasmid 3165
42 Ga0070667_100019361 3300005367 Bacteria 5646
43 Ga0070667_100036331 3300005367 Bacteria 4130
44 Ga0070667_100075236 3300005367 Bacteria 2882
45 Ga0070667_100167662 3300005367 Bacteria 1937
46 Ga0070667_100175009 3300005367 Unclassified 1896
47 Ga0070714_100339690 3300005435 Bacteria 1408
48 Ga0070713_100889533 3300005436 Bacteria 856
49 Ga0070713_100938572 3300005436 Bacteria 833
50 Ga0070678_100092061 3300005456 Bacteria 2328
51 Ga0070678_100103368 3300005456 Unclassified 2213
52 Ga0070662_100004294 3300005457 Bacteria 8997
53 Ga0070662_100107014 3300005457 Bacteria 2125
54 Ga0070662_100259960 3300005457 Bacteria 1398
55 Ga0070681_10370635 3300005458 Unclassified 1342
56 Ga0068867_100016476 3300005459 Bacteria 5248
57 Ga0068867_100019280 3300005459 Bacteria 4862
58 Ga0070684_101271547 3300005535 Unclassified 692
59 Ga0068853_100032774 3300005539 Bacteria 4403
60 Ga0068853_101252269 3300005539 Bacteria 717
61 Ga0070672_100012993 3300005543 Bacteria 5868
62 Ga0070672_100122087 3300005543 Bacteria 2133
63 Ga0070665_100026147 3300005548 Bacteria 5877
64 Ga0070665_100051475 3300005548 Bacteria 4130
65 Ga0070665_100054204 3300005548 Bacteria 4022
66 Ga0070665_101011562 3300005548 Bacteria 843
67 Ga0068855_100033095 3300005563 Bacteria 6172
68 Ga0070664_100057089 3300005564 Bacteria 3318
69 Ga0070664_100456172 3300005564 Bacteria 1174
70 Ga0070664_100565592 3300005564 Bacteria 1052
71 Ga0068857_100013505 3300005577 Bacteria 7115
72 Ga0068854_100282841 3300005578 Unclassified 1336
73 Ga0068856_100807834 3300005614 Unclassified 957
74 Ga0068852_100050391 3300005616 Bacteria 3568
75 Ga0068852_100067571 3300005616 Bacteria 3125
76 Ga0068852_100601352 3300005616 Bacteria 1104
77 Ga0068852_100989638 3300005616 Bacteria 859
78 Ga0068859_100000088 3300005617 Bacteria 84390
79 Ga0068859_100179078 3300005617 Bacteria 2202
80 Ga0068859_100509549 3300005617 Bacteria 1298
81 Ga0068864_100000136 3300005618 Bacteria 70797
82 Ga0068864_100002426 3300005618 Bacteria 15410
83 Ga0068864_100014686 3300005618 Bacteria 6505
84 Ga0068864_100016278 3300005618 Bacteria 6191
85 Ga0068864_100020504 3300005618 Bacteria 5531
86 Ga0068864_100021856 3300005618 Bacteria 5362
87 Ga0068864_100560297 3300005618 Bacteria 1105
88 Ga0068851_10058955 3300005834 Unclassified 1963
89 Ga0068851_10084041 3300005834 Bacteria 1667
90 Ga0068851_10209048 3300005834 Bacteria 1092
91 Ga0068870_10182890 3300005840 Unclassified 1259
92 Ga0068863_100000167 3300005841 Bacteria 70943
93 Ga0068863_100000384 3300005841 Bacteria 44825
94 Ga0068863_100004005 3300005841 Bacteria 14546
95 Ga0068863_100025913 3300005841 Bacteria 5595
96 Ga0068863_100028267 3300005841 Bacteria 5354
97 Ga0068863_100030468 3300005841 Bacteria 5151
98 Ga0068863_100050590 3300005841 Unclassified 3938
99 Ga0068863_100298882 3300005841 Bacteria 1561
100 Ga0068858_100000063 3300005842 Bacteria 111811
101 Ga0068858_100000198 3300005842 Bacteria 64645
102 Ga0068858_100006677 3300005842 Bacteria 11223
103 Ga0068858_100026724 3300005842 Bacteria 5362
104 Ga0068858_100797124 3300005842 Bacteria 922
105 Ga0068858_101266089 3300005842 Bacteria 725
106 Ga0068860_100000479 3300005843 Bacteria 49770
107 Ga0068860_100064324 3300005843 Bacteria 3484
108 Ga0068860_100144850 3300005843 Bacteria 2285
109 Ga0068860_100160226 3300005843 Bacteria 2169
110 Ga0068860_100249150 3300005843 Unclassified 1729
111 Ga0068860_100899614 3300005843 Unclassified 901
112 Ga0068862_100000118 3300005844 Bacteria 92548
113 Ga0068862_100011336 3300005844 Bacteria 7360
114 Ga0068862_100560111 3300005844 Bacteria 1092
115 Ga0068862_100636234 3300005844 Bacteria 1028
116 Ga0070717_10197104 3300006028 Bacteria 1762
117 Ga0075368_10019813 3300006042 Bacteria 2541
118 Ga0075363_100020217 3300006048 Bacteria 3337
119 Ga0075367_10032013 3300006178 Bacteria 3023
120 Ga0097621_100025108 3300006237 Unclassified 4660
121 Ga0097621_100129922 3300006237 Bacteria 2143
122 Ga0075370_10083090 3300006353 Bacteria 1842
123 Ga0075370_10198598 3300006353 Bacteria 1183
124 Ga0068871_100007735 3300006358 Bacteria 7695
125 Ga0068871_100009438 3300006358 Bacteria 7071
126 Ga0068865_100123300 3300006881 Bacteria 1930
127 Ga0097620_100000088 3300006931 Bacteria 84390
128 Ga0097620_100179089 3300006931 Bacteria 2202
129 Ga0097620_100509498 3300006931 Bacteria 1298
130 Ga0105250_10023119 3300009092 Bacteria 2504
131 Ga0105245_10169329 3300009098 Bacteria 2079
132 Ga0105247_10086331 3300009101 Bacteria 1986
133 Ga0105247_10096625 3300009101 Unclassified 1883
134 Ga0105243_10103834 3300009148 Bacteria 2364
135 Ga0105242_10046670 3300009176 Bacteria 3515
136 Ga0105248_10000169 3300009177 Bacteria 75948
137 Ga0105248_10000604 3300009177 Bacteria 40877
138 Ga0105248_10002620 3300009177 Bacteria 20006
139 Ga0105248_10011420 3300009177 Bacteria 9789
140 Ga0105248_10022740 3300009177 Bacteria 6957
141 Ga0105248_10733480 3300009177 Bacteria 1115
142 Ga0105238_10107575 3300009551 Bacteria 2770
143 Ga0105249_10000119 3300009553 Bacteria 107840
144 Ga0105249_10015607 3300009553 Bacteria 6723
145 Ga0105249_10043788 3300009553 Bacteria 4071
146 Ga0105239_10094823 3300010375 Bacteria 3296
147 Ga0105246_11301832 3300011119 Unclassified 674
148 Ga0157373_10402396 3300013100 Bacteria 981
149 Ga0157371_10647245 3300013102 Bacteria 789
150 Ga0157370_10267551 3300013104 Bacteria 1579
151 Ga0157370_10912032 3300013104 Unclassified 797
152 Ga0157369_10129831 3300013105 Bacteria 2671
153 Ga0157374_10012908 3300013296 Bacteria 7278
154 Ga0157378_10331865 3300013297 Unclassified 1480
155 Ga0157378_10413513 3300013297 Bacteria 1332
156 Ga0163162_10003404 3300013306 Bacteria 15182
157 Ga0163162_10024995 3300013306 Bacteria 5901
158 Ga0163162_10081113 3300013306 Bacteria 3314
159 Ga0157372_10269737 3300013307 Bacteria 1977
160 Ga0157375_10135557 3300013308 Plasmid 2585
161 Ga0157375_10151601 3300013308 Bacteria 2454
162 Ga0157375_10364237 3300013308 Bacteria 1612
163 Ga0163163_10000170 3300014325 Bacteria 68377
164 Ga0163163_10024398 3300014325 Bacteria 5756
165 Ga0157380_10071399 3300014326 Bacteria 2808
166 Ga0157380_10205844 3300014326 Bacteria 1749
167 Ga0157379_10014561 3300014968 Bacteria 6901
168 Ga0157379_10073398 3300014968 Bacteria 3062
169 Ga0157379_10195401 3300014968 Bacteria 1828
170 Ga0157376_10036943 3300014969 Bacteria 3961
171 Ga0163161_10181481 3300017792 Unclassified 1614
172 Ga0207696_1017173 3300025711 Bacteria 2403
173 Ga0207710_10000484 3300025900 Bacteria 25194
174 Ga0207688_10051666 3300025901 Unclassified 2302
175 Ga0207680_10061034 3300025903 Bacteria 2298
176 Ga0207680_10093238 3300025903 Bacteria 1920
177 Ga0207680_10106194 3300025903 Unclassified 1813
178 Ga0207680_10152352 3300025903 Bacteria 1542
179 Ga0207705_10000468 3300025909 Bacteria 34564
180 Ga0207705_10031608 3300025909 Bacteria 3780
181 Ga0207705_10142344 3300025909 Bacteria 1792
182 Ga0207657_10005698 3300025919 Bacteria 12998
183 Ga0207657_10007540 3300025919 Bacteria 11152
184 Ga0207649_10090524 3300025920 Bacteria 2002
185 Ga0207649_10591707 3300025920 Unclassified 852
186 Ga0207652_10082638 3300025921 Bacteria 2811
187 Ga0207681_10103817 3300025923 Unclassified 2055
188 Ga0207681_10113988 3300025923 Bacteria 1971
189 Ga0207681_10246163 3300025923 Bacteria 1394
190 Ga0207681_10545179 3300025923 Bacteria 954
191 Ga0207681_11032085 3300025923 Bacteria 690
192 Ga0207694_10242390 3300025924 Unclassified 1473
193 Ga0207650_10000136 3300025925 Bacteria 89925
194 Ga0207650_10037594 3300025925 Plasmid 3529
195 Ga0207650_10561842 3300025925 Unclassified 957
196 Ga0207659_10059299 3300025926 Bacteria 2751
197 Ga0207659_11283995 3300025926 Bacteria 629
198 Ga0207687_10110377 3300025927 Bacteria 2040
199 Ga0207700_10344795 3300025928 Bacteria 1296
200 Ga0207644_10000061 3300025931 Bacteria 79079
201 Ga0207644_10023683 3300025931 Bacteria 4208
202 Ga0207644_10026218 3300025931 Bacteria 4013
203 Ga0207690_10149376 3300025932 Unclassified 1731
204 Ga0207690_10251712 3300025932 Bacteria 1365
205 Ga0207706_10002200 3300025933 Bacteria 19004
206 Ga0207706_10004173 3300025933 Bacteria 13606
207 Ga0207706_10149390 3300025933 Bacteria 2055
208 Ga0207706_10191778 3300025933 Bacteria 1794
209 Ga0207706_10988140 3300025933 Bacteria 708
210 Ga0207686_10285744 3300025934 Bacteria 1219
211 Ga0207691_10007149 3300025940 Bacteria 10771
212 Ga0207691_10007401 3300025940 Bacteria 10572
213 Ga0207691_10025850 3300025940 Bacteria 5510
214 Ga0207691_10131011 3300025940 Bacteria 2215
215 Ga0207711_10000039 3300025941 Bacteria 162974
216 Ga0207711_10002205 3300025941 Bacteria 17482
217 Ga0207711_10014171 3300025941 Bacteria 6623
218 Ga0207711_10015210 3300025941 Bacteria 6389
219 Ga0207711_10134537 3300025941 Bacteria 2219
220 Ga0207711_10229069 3300025941 Bacteria 1701
221 Ga0207711_10268180 3300025941 Bacteria 1570
222 Ga0207679_10005984 3300025945 Bacteria 7652
223 Ga0207679_10424786 3300025945 Bacteria 1174
224 Ga0207667_10084314 3300025949 Unclassified 3290
225 Ga0207667_10419134 3300025949 Bacteria 1362
226 Ga0207651_10001804 3300025960 Bacteria 9960
227 Ga0207651_10005876 3300025960 Bacteria 6348
228 Ga0207651_10013014 3300025960 Bacteria 4739
229 Ga0207651_10137964 3300025960 Unclassified 1879
230 Ga0207712_10000048 3300025961 Bacteria 160050
231 Ga0207712_10000772 3300025961 Bacteria 23947
232 Ga0207712_10061275 3300025961 Bacteria 2670
233 Ga0207712_10314110 3300025961 Unclassified 1290
234 Ga0207668_10005475 3300025972 Bacteria 7477
235 Ga0207668_10017968 3300025972 Bacteria 4440
236 Ga0207668_10292241 3300025972 Unclassified 1341
237 Ga0207668_10649553 3300025972 Bacteria 923
238 Ga0207640_10775287 3300025981 Bacteria 829
239 Ga0207658_10000167 3300025986 Bacteria 70202
240 Ga0207658_10001595 3300025986 Bacteria 17495
241 Ga0207658_10002756 3300025986 Bacteria 12666
242 Ga0207658_10048674 3300025986 Bacteria 3109
243 Ga0207658_10131466 3300025986 Bacteria 2011
244 Ga0207658_10179262 3300025986 Bacteria 1752
245 Ga0207658_10965136 3300025986 Bacteria 777
246 Ga0207677_10594306 3300026023 Unclassified 970
247 Ga0207677_11123131 3300026023 Bacteria 717
248 Ga0207703_10000189 3300026035 Bacteria 72189
249 Ga0207703_10000327 3300026035 Bacteria 51797
250 Ga0207703_10019349 3300026035 Bacteria 5320
251 Ga0207703_10156598 3300026035 Unclassified 1991
252 Ga0207703_10528569 3300026035 Bacteria 1110
253 Ga0207703_10717727 3300026035 Bacteria 951
254 Ga0207703_10886665 3300026035 Bacteria 854
255 Ga0207678_10086544 3300026067 Bacteria 2678
256 Ga0207678_10276433 3300026067 Unclassified 1441
257 Ga0207678_10362937 3300026067 Bacteria 1250
258 Ga0207702_10338310 3300026078 Bacteria 1437
259 Ga0207641_10000120 3300026088 Bacteria 116070
260 Ga0207641_10000138 3300026088 Bacteria 106531
261 Ga0207641_10003524 3300026088 Bacteria 13854
262 Ga0207641_10004180 3300026088 Bacteria 12578
263 Ga0207641_10006879 3300026088 Bacteria 9520
264 Ga0207641_10069752 3300026088 Plasmid 3019
265 Ga0207641_10163030 3300026088 Bacteria 2028
266 Ga0207641_10248727 3300026088 Bacteria 1659
267 Ga0207641_10423310 3300026088 Unclassified 1282
268 Ga0207648_10015252 3300026089 Bacteria 7067
269 Ga0207648_10098971 3300026089 Unclassified 2554
270 Ga0207676_10000424 3300026095 Bacteria 35638
271 Ga0207676_10000499 3300026095 Bacteria 33023
272 Ga0207676_10000983 3300026095 Bacteria 21929
273 Ga0207676_10008456 3300026095 Bacteria 7317
274 Ga0207676_10014273 3300026095 Bacteria 5711
275 Ga0207676_10451117 3300026095 Bacteria 1212
276 Ga0207674_10000338 3300026116 Bacteria 60092
277 Ga0207675_100237552 3300026118 Bacteria 1760
278 Ga0207683_10071451 3300026121 Bacteria 3068
279 Ga0207683_10151998 3300026121 Bacteria 2089
280 Ga0207698_10051400 3300026142 Bacteria 3151
281 Ga0207698_10066849 3300026142 Bacteria 2832
282 Ga0207698_10094666 3300026142 Bacteria 2456
283 Ga0207698_10438432 3300026142 Bacteria 1258
284 Ga0207698_11153715 3300026142 Bacteria 788
285 Ga0207698_11154322 3300026142 Unclassified 788
286 Ga0209813_10012071 3300027866 Bacteria 2273
287 Ga0268266_10019857 3300028379 Bacteria 5726
288 Ga0268266_10088811 3300028379 Bacteria 2705
289 Ga0268266_11434931 3300028379 Bacteria 666
290 Ga0268265_10000139 3300028380 Bacteria 92561
291 Ga0268265_10103089 3300028380 Bacteria 2309
292 Ga0268265_10392683 3300028380 Bacteria 1280
293 Ga0268264_10000585 3300028381 Bacteria 44270
294 Ga0268264_10002490 3300028381 Bacteria 16193
295 Ga0268264_10003421 3300028381 Bacteria 13690
296 Ga0268264_10049895 3300028381 Bacteria 3483
297 Ga0268264_10171255 3300028381 Unclassified 1964
298 Ga0268264_10177384 3300028381 Bacteria 1932
299 Ga0268264_11105728 3300028381 Bacteria 801
300 Ga0307517_10067914 3300028786 Bacteria 3256
301 Ga0307517_10234455 3300028786 Bacteria 1097
302 Ga0265338_10011878 3300028800 Bacteria 10001
303 Ga0307410_10095268 3300031852 Bacteria 2122
304 Ga0307410_10709867 3300031852 Bacteria 848
305 Ga0307409_100125147 3300031995 Bacteria 2185
306 Ga0307409_100167244 3300031995 Bacteria 1931
307 Ga0307416_100869559 3300032002 Bacteria 1000
308 Ga0307416_101155372 3300032002 Bacteria 879
309 Ga0307414_10024715 3300032004 Bacteria 3836
310 Ga0307414_10054106 3300032004 Bacteria 2803
311 Ga0307414_10297684 3300032004 Bacteria 1363
312 Ga0307411_10023093 3300032005 Bacteria 3676
313 Ga0307411_10076493 3300032005 Bacteria 2288
314 Ga0373956_0049802 3300035119 Bacteria 1879
315 Ga0373957_0088550 3300035120 Bacteria 1228
316 Ga0373955_0033240 3300035172 Bacteria 2715
317 Ga0373935_0493702 3300035692 Bacteria 888
318 Ga0373933_0264458 3300035724 Bacteria 1109
319 Ga0373937_0720621 3300036401 Bacteria 944
320 Ga0395899_0000738 3300037312 Bacteria 32643
321 Ga0395899_0056458 3300037312 Bacteria 2902
322 Ga0395900_0000723 3300037418 Bacteria 43948
323 Ga0395900_0002146 3300037418 Bacteria 22069
324 Ga0395900_0182973 3300037418 Bacteria 2128
325 Ga0395900_0193157 3300037418 Bacteria 2064
326 Ga0395900_0201799 3300037418 Bacteria 2012
327 Ga0395900_0227057 3300037418 Bacteria 1879
328 Ga0395900_0362907 3300037418 Bacteria 1419
329 Ga0395900_0733524 3300037418 Bacteria 919
330 Ga0395900_0776881 3300037418 Unclassified 887
331 Ga0395900_0815305 3300037418 Bacteria 860
332 Ga0395898_0000087 3300037466 Bacteria 239211
333 Ga0395898_0184174 3300037466 Bacteria 1995
334 Ga0395898_0230239 3300037466 Bacteria 1767
335 Ga0395898_0253104 3300037466 Bacteria 1680
336 Ga0395898_0370627 3300037466 Bacteria 1365
337 Ga0395898_0419411 3300037466 Bacteria 1275
338 Ga0395905_0000005 3300037471 Bacteria 557808
339 Ga0395905_0004198 3300037471 Bacteria 15079
340 Ga0395905_0012333 3300037471 Bacteria 8227
341 Ga0395905_0027610 3300037471 Bacteria 5352
342 Ga0395905_0075451 3300037471 Bacteria 3160
343 Ga0395905_0090883 3300037471 Bacteria 2862
344 Ga0395905_0429230 3300037471 Bacteria 1218
345 Ga0395901_0004296 3300038443 Bacteria 14371
346 Ga0395901_0066762 3300038443 Bacteria 3746
347 Ga0395901_0158945 3300038443 Bacteria 2373
348 Ga0395901_0207372 3300038443 Bacteria 2052
349 Ga0395901_0312221 3300038443 Bacteria 1628
350 Ga0395901_0502895 3300038443 Bacteria 1233
351 Ga0395901_0841706 3300038443 Bacteria 903
352 Ga0451841_0498122 3300041498 Unclassified 796
353 Ga0451843_0281590 3300041509 Bacteria 1208
354 Ga0451843_0776697 3300041509 Bacteria 710
355 Ga0451853_1049919 3300041512 Bacteria 860
356 Ga0439458_0006030 3300042157 Bacteria 2711
357 Ga0466963_0493027 3300044694 Bacteria 865
358 Ga0466967_0855899 3300045976 Bacteria 904
359 Ga0495605_0334226 3300046474 Bacteria 637
360 Ga0495625_0211863 3300046660 Bacteria 1273
361 Ga0495623_0325257 3300046679 Bacteria 843
362 Ga0495669_0000672 3300046684 Bacteria 14889
363 Ga0495677_0037792 3300047445 Bacteria 1764
364 Ga0495685_040094 3300047447 Bacteria 1602
365 Ga0495686_0102439 3300047472 Bacteria 1725
366 Ga0495602_0137338 3300048088 Bacteria 1940
367 Ga0496100_1239699 3300048903 Bacteria 588
368 Ga0496101_0063216 3300048904 Unclassified 2694
369 Ga0496102_0023075 3300048905 Bacteria 5522
370 Ga0496102_0430319 3300048905 Unclassified 1239
371 Ga0496104_0397583 3300048907 Bacteria 1290
372 Ga0496104_1257759 3300048907 Bacteria 643
373 Ga0496108_0014277 3300048911 Bacteria 6480
374 Ga0496108_0085930 3300048911 Bacteria 2671
375 Ga0496109_0010102 3300048912 Bacteria 8052
376 Ga0496109_0057528 3300048912 Bacteria 3549
377 Ga0496110_0008076 3300048913 Bacteria 8450
378 Ga0496111_0047774 3300048914 Bacteria 3082
379 Ga0496111_0241559 3300048914 Bacteria 1341
380 Ga0496112_0027353 3300048915 Bacteria 5498
381 Ga0496112_0220997 3300048915 Bacteria 1850
382 Ga0496113_0015082 3300048916 Bacteria 5295
383 Ga0496113_0029264 3300048916 Bacteria 3975
384 Ga0496113_0029609 3300048916 Bacteria 3957
385 Ga0496114_0708609 3300048917 Unclassified 882
386 nmdc:mga03683_13471_c1 3300050489 Bacteria 3011
387 nmdc:mga03n38_36924_c1 3300050490 Bacteria 2104
388 nmdc:mga06z11_51784_c1 3300050494 Bacteria 2104
389 nmdc:mga04h51_22973_c1 3300050495 Bacteria 1894
390 nmdc:mga07m45_160853_c1 3300050496 Bacteria 1304
391 nmdc:mga07m45_245005_c1 3300050496 Bacteria 1043
392 nmdc:mga0sz30_13857_c1 3300050516 Bacteria 3164
393 nmdc:mga0sz30_74871_c1 3300050516 Bacteria 1461
394 Ga0495612_0173340 3300053078 Bacteria 945
395 Ga0495655_0147899 3300053083 Bacteria 736
396 Ga0500652_085729 3300053131 Bacteria 1313
397 Ga0500658_0000036 3300053134 Bacteria 85304
398 Ga0500559_0046268 3300053136 Bacteria 1907

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_11220567 Ga0070658_112205671 169
2 3300005842 Ga0068858_100797124 Ga0068858_1007971242 169
3 3300013308 Ga0157375_10364237 Ga0157375_103642372 169
4 3300026035 Ga0207703_10717727 Ga0207703_107177272 169
5 3300041509 Ga0451843_0776697 Ga0451843_0776697_62_571 169
6 3300005331 Ga0070670_100014484 Ga0070670_1000144843 170
7 3300005335 Ga0070666_10003235 Ga0070666_100032355 170
8 3300005338 Ga0068868_100037939 Ga0068868_1000379395 170
9 3300005339 Ga0070660_100005456 Ga0070660_1000054565 170
10 3300005344 Ga0070661_100035455 Ga0070661_1000354555 170
11 3300005344 Ga0070661_100196154 Ga0070661_1001961542 170
12 3300005354 Ga0070675_100051826 Ga0070675_1000518264 170
13 3300005355 Ga0070671_100075533 Ga0070671_1000755333 170
14 3300005364 Ga0070673_100006469 Ga0070673_1000064696 170
15 3300005367 Ga0070667_100019361 Ga0070667_1000193613 170
16 3300005436 Ga0070713_100938572 Ga0070713_1009385721 170
17 3300005456 Ga0070678_100103368 Ga0070678_1001033682 170
18 3300005457 Ga0070662_100004294 Ga0070662_1000042945 170
19 3300005458 Ga0070681_10370635 Ga0070681_103706351 170
20 3300005459 Ga0068867_100016476 Ga0068867_1000164766 170
21 3300005535 Ga0070684_101271547 Ga0070684_1012715471 170
22 3300005539 Ga0068853_100032774 Ga0068853_1000327744 170
23 3300005543 Ga0070672_100012993 Ga0070672_1000129934 170
24 3300005548 Ga0070665_100054204 Ga0070665_1000542046 170
25 3300005548 Ga0070665_101011562 Ga0070665_1010115622 170
26 3300005564 Ga0070664_100057089 Ga0070664_1000570893 170
27 3300005578 Ga0068854_100282841 Ga0068854_1002828413 170
28 3300005616 Ga0068852_100050391 Ga0068852_1000503915 170
29 3300005616 Ga0068852_100989638 Ga0068852_1009896381 170
30 3300005618 Ga0068864_100020504 Ga0068864_1000205044 170
31 3300005834 Ga0068851_10058955 Ga0068851_100589552 170
32 3300005834 Ga0068851_10209048 Ga0068851_102090481 170
33 3300005840 Ga0068870_10182890 Ga0068870_101828902 170
34 3300005841 Ga0068863_100050590 Ga0068863_1000505901 170
35 3300005842 Ga0068858_100006677 Ga0068858_10000667716 170
36 3300005843 Ga0068860_100249150 Ga0068860_1002491504 170
37 3300006042 Ga0075368_10019813 Ga0075368_100198132 170
38 3300006048 Ga0075363_100020217 Ga0075363_1000202173 170
39 3300006178 Ga0075367_10032013 Ga0075367_100320132 170
40 3300006237 Ga0097621_100025108 Ga0097621_1000251082 170
41 3300006353 Ga0075370_10083090 Ga0075370_100830902 170
42 3300006353 Ga0075370_10198598 Ga0075370_101985981 170
43 3300006358 Ga0068871_100009438 Ga0068871_1000094388 170
44 3300009101 Ga0105247_10096625 Ga0105247_100966253 170
45 3300009177 Ga0105248_10011420 Ga0105248_100114209 170
46 3300009177 Ga0105248_10733480 Ga0105248_107334802 170
47 3300013100 Ga0157373_10402396 Ga0157373_104023962 170
48 3300013102 Ga0157371_10647245 Ga0157371_106472452 170
49 3300013104 Ga0157370_10912032 Ga0157370_109120321 170
50 3300013296 Ga0157374_10012908 Ga0157374_1001290810 170
51 3300013297 Ga0157378_10331865 Ga0157378_103318652 170
52 3300013306 Ga0163162_10024995 Ga0163162_100249956 170
53 3300013307 Ga0157372_10269737 Ga0157372_102697374 170
54 3300013308 Ga0157375_10151601 Ga0157375_101516014 170
55 3300014325 Ga0163163_10024398 Ga0163163_100243987 170
56 3300025903 Ga0207680_10106194 Ga0207680_101061942 170
57 3300025909 Ga0207705_10000468 Ga0207705_1000046820 170
58 3300025919 Ga0207657_10005698 Ga0207657_100056985 170
59 3300025920 Ga0207649_10090524 Ga0207649_100905241 170
60 3300025920 Ga0207649_10591707 Ga0207649_105917072 170
61 3300025921 Ga0207652_10082638 Ga0207652_100826382 170
62 3300025924 Ga0207694_10242390 Ga0207694_102423902 170
63 3300025926 Ga0207659_10059299 Ga0207659_100592994 170
64 3300025931 Ga0207644_10023683 Ga0207644_100236834 170
65 3300025933 Ga0207706_10002200 Ga0207706_1000220011 170
66 3300025940 Ga0207691_10007149 Ga0207691_1000714913 170
67 3300025941 Ga0207711_10015210 Ga0207711_100152108 170
68 3300025941 Ga0207711_10268180 Ga0207711_102681802 170
69 3300025945 Ga0207679_10005984 Ga0207679_100059849 170
70 3300025949 Ga0207667_10419134 Ga0207667_104191341 170
71 3300025960 Ga0207651_10001804 Ga0207651_1000180411 170
72 3300025986 Ga0207658_10048674 Ga0207658_100486743 170
73 3300026035 Ga0207703_10156598 Ga0207703_101565982 170
74 3300026067 Ga0207678_10086544 Ga0207678_100865444 170
75 3300026067 Ga0207678_10276433 Ga0207678_102764333 170
76 3300026088 Ga0207641_10423310 Ga0207641_104233101 170
77 3300026089 Ga0207648_10098971 Ga0207648_100989713 170
78 3300026095 Ga0207676_10008456 Ga0207676_1000845610 170
79 3300026142 Ga0207698_10066849 Ga0207698_100668493 170
80 3300026142 Ga0207698_11153715 Ga0207698_111537152 170
81 3300026142 Ga0207698_11154322 Ga0207698_111543222 170
82 3300027866 Ga0209813_10012071 Ga0209813_100120712 170
83 3300028379 Ga0268266_10088811 Ga0268266_100888112 170
84 3300028381 Ga0268264_10171255 Ga0268264_101712554 170
85 3300037418 Ga0395900_0000723 Ga0395900_0000723_13668_14180 170
86 3300037418 Ga0395900_0201799 Ga0395900_0201799_1346_1978 170
87 3300037418 Ga0395900_0776881 Ga0395900_0776881_237_776 170
88 3300037466 Ga0395898_0000087 Ga0395898_0000087_43880_44392 170
89 3300037471 Ga0395905_0000005 Ga0395905_0000005_43880_44392 170
90 3300037471 Ga0395905_0429230 Ga0395905_0429230_364_876 170
91 3300038443 Ga0395901_0066762 Ga0395901_0066762_1649_2161 170
92 3300045976 Ga0466967_0855899 Ga0466967_0855899_63_575 170
93 3300048904 Ga0496101_0063216 Ga0496101_0063216_1386_1898 170
94 3300048905 Ga0496102_0430319 Ga0496102_0430319_283_795 170
95 3300048911 Ga0496108_0014277 Ga0496108_0014277_1472_1984 170
96 3300048912 Ga0496109_0010102 Ga0496109_0010102_3402_3914 170
97 3300048913 Ga0496110_0008076 Ga0496110_0008076_2974_3486 170
98 3300048914 Ga0496111_0047774 Ga0496111_0047774_805_1317 170
99 3300048915 Ga0496112_0027353 Ga0496112_0027353_1292_1804 170
100 3300048915 Ga0496112_0220997 Ga0496112_0220997_151_783 170
101 3300048916 Ga0496113_0029264 Ga0496113_0029264_2035_2547 170
102 3300048916 Ga0496113_0029609 Ga0496113_0029609_2497_3129 170
103 3300048917 Ga0496114_0708609 Ga0496114_0708609_330_842 170
104 3300050489 nmdc:mga03683_13471_c1 nmdc:mga03683_13471_c1_1893_2405 170
105 3300050490 nmdc:mga03n38_36924_c1 nmdc:mga03n38_36924_c1_672_1184 170
106 3300050494 nmdc:mga06z11_51784_c1 nmdc:mga06z11_51784_c1_607_1119 170
107 3300050495 nmdc:mga04h51_22973_c1 nmdc:mga04h51_22973_c1_579_1091 170
108 3300050496 nmdc:mga07m45_160853_c1 nmdc:mga07m45_160853_c1_186_698 170
109 3300050496 nmdc:mga07m45_245005_c1 nmdc:mga07m45_245005_c1_142_654 170
110 3300050516 nmdc:mga0sz30_13857_c1 nmdc:mga0sz30_13857_c1_2046_2558 170
111 3300050516 nmdc:mga0sz30_74871_c1 nmdc:mga0sz30_74871_c1_29_541 170
112 3300001990 JGI24737J22298_10002645 JGI24737J22298_100026452 171
113 3300001991 JGI24743J22301_10029590 JGI24743J22301_100295902 171
114 3300005290 Ga0065712_10024387 Ga0065712_100243872 171
115 3300005327 Ga0070658_10010412 Ga0070658_100104122 171
116 3300005327 Ga0070658_10057703 Ga0070658_100577034 171
117 3300005331 Ga0070670_100128161 Ga0070670_1001281613 171
118 3300005335 Ga0070666_10078426 Ga0070666_100784262 171
119 3300005335 Ga0070666_10821150 Ga0070666_108211501 171
120 3300005338 Ga0068868_100260376 Ga0068868_1002603762 171
121 3300005339 Ga0070660_100008354 Ga0070660_1000083542 171
122 3300005344 Ga0070661_100066514 Ga0070661_1000665143 171
123 3300005347 Ga0070668_100224451 Ga0070668_1002244514 171
124 3300005353 Ga0070669_100105504 Ga0070669_1001055043 171
125 3300005353 Ga0070669_100117638 Ga0070669_1001176383 171
126 3300005353 Ga0070669_100369403 Ga0070669_1003694031 171
127 3300005354 Ga0070675_100443484 Ga0070675_1004434841 171
128 3300005355 Ga0070671_100003691 Ga0070671_1000036919 171
129 3300005355 Ga0070671_100334375 Ga0070671_1003343751 171
130 3300005356 Ga0070674_100065171 Ga0070674_1000651711 171
131 3300005364 Ga0070673_100041934 Ga0070673_1000419342 171
132 3300005364 Ga0070673_100042797 Ga0070673_1000427971 171
133 3300005364 Ga0070673_100155534 Ga0070673_1001555344 171
134 3300005364 Ga0070673_100415953 Ga0070673_1004159531 171
135 3300005366 Ga0070659_100053957 Ga0070659_1000539573 171
136 3300005367 Ga0070667_100075236 Ga0070667_1000752362 171
137 3300005367 Ga0070667_100167662 Ga0070667_1001676623 171
138 3300005367 Ga0070667_100175009 Ga0070667_1001750092 171
139 3300005435 Ga0070714_100339690 Ga0070714_1003396902 171
140 3300005436 Ga0070713_100889533 Ga0070713_1008895331 171
141 3300005456 Ga0070678_100092061 Ga0070678_1000920612 171
142 3300005457 Ga0070662_100107014 Ga0070662_1001070142 171
143 3300005457 Ga0070662_100259960 Ga0070662_1002599602 171
144 3300005459 Ga0068867_100019280 Ga0068867_1000192802 171
145 3300005539 Ga0068853_101252269 Ga0068853_1012522691 171
146 3300005543 Ga0070672_100122087 Ga0070672_1001220872 171
147 3300005563 Ga0068855_100033095 Ga0068855_1000330953 171
148 3300005564 Ga0070664_100456172 Ga0070664_1004561722 171
149 3300005564 Ga0070664_100565592 Ga0070664_1005655921 171
150 3300005577 Ga0068857_100013505 Ga0068857_1000135052 171
151 3300005614 Ga0068856_100807834 Ga0068856_1008078342 171
152 3300005616 Ga0068852_100067571 Ga0068852_1000675712 171
153 3300005616 Ga0068852_100601352 Ga0068852_1006013522 171
154 3300005617 Ga0068859_100000088 Ga0068859_10000008874 171
155 3300005617 Ga0068859_100179078 Ga0068859_1001790783 171
156 3300005618 Ga0068864_100000136 Ga0068864_10000013627 171
157 3300005618 Ga0068864_100014686 Ga0068864_1000146864 171
158 3300005618 Ga0068864_100016278 Ga0068864_1000162788 171
159 3300005834 Ga0068851_10084041 Ga0068851_100840413 171
160 3300005841 Ga0068863_100000384 Ga0068863_10000038428 171
161 3300005841 Ga0068863_100030468 Ga0068863_1000304681 171
162 3300005841 Ga0068863_100298882 Ga0068863_1002988821 171
163 3300005842 Ga0068858_100000063 Ga0068858_10000006360 171
164 3300005842 Ga0068858_101266089 Ga0068858_1012660891 171
165 3300005843 Ga0068860_100144850 Ga0068860_1001448504 171
166 3300005843 Ga0068860_100899614 Ga0068860_1008996142 171
167 3300006028 Ga0070717_10197104 Ga0070717_101971042 171
168 3300006237 Ga0097621_100129922 Ga0097621_1001299222 171
169 3300006358 Ga0068871_100007735 Ga0068871_1000077355 171
170 3300006881 Ga0068865_100123300 Ga0068865_1001233003 171
171 3300006931 Ga0097620_100000088 Ga0097620_10000008874 171
172 3300006931 Ga0097620_100179089 Ga0097620_1001790893 171
173 3300009092 Ga0105250_10023119 Ga0105250_100231194 171
174 3300009098 Ga0105245_10169329 Ga0105245_101693293 171
175 3300009101 Ga0105247_10086331 Ga0105247_100863312 171
176 3300009148 Ga0105243_10103834 Ga0105243_101038342 171
177 3300009176 Ga0105242_10046670 Ga0105242_100466705 171
178 3300009177 Ga0105248_10000169 Ga0105248_1000016966 171
179 3300009177 Ga0105248_10000604 Ga0105248_1000060430 171
180 3300009551 Ga0105238_10107575 Ga0105238_101075753 171
181 3300009553 Ga0105249_10015607 Ga0105249_100156072 171
182 3300010375 Ga0105239_10094823 Ga0105239_100948233 171
183 3300011119 Ga0105246_11301832 Ga0105246_113018321 171
184 3300013104 Ga0157370_10267551 Ga0157370_102675512 171
185 3300013105 Ga0157369_10129831 Ga0157369_101298313 171
186 3300013297 Ga0157378_10413513 Ga0157378_104135132 171
187 3300013306 Ga0163162_10003404 Ga0163162_1000340410 171
188 3300013308 Ga0157375_10135557 Ga0157375_101355571 171
189 3300014325 Ga0163163_10000170 Ga0163163_1000017050 171
190 3300014968 Ga0157379_10014561 Ga0157379_100145618 171
191 3300014969 Ga0157376_10036943 Ga0157376_100369431 171
192 3300017792 Ga0163161_10181481 Ga0163161_101814813 171
193 3300025711 Ga0207696_1017173 Ga0207696_10171734 171
194 3300025901 Ga0207688_10051666 Ga0207688_100516663 171
195 3300025903 Ga0207680_10061034 Ga0207680_100610342 171
196 3300025903 Ga0207680_10093238 Ga0207680_100932382 171
197 3300025909 Ga0207705_10031608 Ga0207705_100316084 171
198 3300025909 Ga0207705_10142344 Ga0207705_101423442 171
199 3300025919 Ga0207657_10007540 Ga0207657_1000754012 171
200 3300025923 Ga0207681_10103817 Ga0207681_101038173 171
201 3300025923 Ga0207681_10113988 Ga0207681_101139884 171
202 3300025923 Ga0207681_10246163 Ga0207681_102461631 171
203 3300025923 Ga0207681_10545179 Ga0207681_105451791 171
204 3300025925 Ga0207650_10037594 Ga0207650_100375942 171
205 3300025925 Ga0207650_10561842 Ga0207650_105618422 171
206 3300025926 Ga0207659_11283995 Ga0207659_112839951 171
207 3300025927 Ga0207687_10110377 Ga0207687_101103773 171
208 3300025928 Ga0207700_10344795 Ga0207700_103447952 171
209 3300025931 Ga0207644_10000061 Ga0207644_1000006131 171
210 3300025931 Ga0207644_10026218 Ga0207644_100262183 171
211 3300025932 Ga0207690_10149376 Ga0207690_101493761 171
212 3300025932 Ga0207690_10251712 Ga0207690_102517122 171
213 3300025933 Ga0207706_10004173 Ga0207706_1000417316 171
214 3300025933 Ga0207706_10149390 Ga0207706_101493902 171
215 3300025933 Ga0207706_10191778 Ga0207706_101917782 171
216 3300025933 Ga0207706_10988140 Ga0207706_109881401 171
217 3300025934 Ga0207686_10285744 Ga0207686_102857441 171
218 3300025940 Ga0207691_10007401 Ga0207691_100074014 171
219 3300025940 Ga0207691_10025850 Ga0207691_100258502 171
220 3300025940 Ga0207691_10131011 Ga0207691_101310112 171
221 3300025941 Ga0207711_10000039 Ga0207711_10000039135 171
222 3300025941 Ga0207711_10014171 Ga0207711_100141714 171
223 3300025941 Ga0207711_10134537 Ga0207711_101345372 171
224 3300025945 Ga0207679_10424786 Ga0207679_104247862 171
225 3300025949 Ga0207667_10084314 Ga0207667_100843142 171
226 3300025960 Ga0207651_10005876 Ga0207651_100058766 171
227 3300025960 Ga0207651_10013014 Ga0207651_100130142 171
228 3300025960 Ga0207651_10137964 Ga0207651_101379642 171
229 3300025961 Ga0207712_10061275 Ga0207712_100612755 171
230 3300025961 Ga0207712_10314110 Ga0207712_103141102 171
231 3300025972 Ga0207668_10292241 Ga0207668_102922411 171
232 3300025972 Ga0207668_10649553 Ga0207668_106495531 171
233 3300025981 Ga0207640_10775287 Ga0207640_107752871 171
234 3300025986 Ga0207658_10002756 Ga0207658_100027562 171
235 3300025986 Ga0207658_10131466 Ga0207658_101314662 171
236 3300025986 Ga0207658_10179262 Ga0207658_101792621 171
237 3300025986 Ga0207658_10965136 Ga0207658_109651361 171
238 3300026023 Ga0207677_10594306 Ga0207677_105943062 171
239 3300026023 Ga0207677_11123131 Ga0207677_111231311 171
240 3300026035 Ga0207703_10000327 Ga0207703_1000032713 171
241 3300026035 Ga0207703_10528569 Ga0207703_105285692 171
242 3300026035 Ga0207703_10886665 Ga0207703_108866651 171
243 3300026067 Ga0207678_10362937 Ga0207678_103629372 171
244 3300026078 Ga0207702_10338310 Ga0207702_103383101 171
245 3300026088 Ga0207641_10000138 Ga0207641_1000013846 171
246 3300026088 Ga0207641_10006879 Ga0207641_100068791 171
247 3300026088 Ga0207641_10069752 Ga0207641_100697526 171
248 3300026088 Ga0207641_10248727 Ga0207641_102487272 171
249 3300026089 Ga0207648_10015252 Ga0207648_100152523 171
250 3300026095 Ga0207676_10000983 Ga0207676_1000098321 171
251 3300026095 Ga0207676_10014273 Ga0207676_100142733 171
252 3300026116 Ga0207674_10000338 Ga0207674_1000033815 171
253 3300026121 Ga0207683_10071451 Ga0207683_100714512 171
254 3300026121 Ga0207683_10151998 Ga0207683_101519983 171
255 3300026142 Ga0207698_10051400 Ga0207698_100514002 171
256 3300026142 Ga0207698_10094666 Ga0207698_100946662 171
257 3300026142 Ga0207698_10438432 Ga0207698_104384322 171
258 3300028379 Ga0268266_11434931 Ga0268266_114349312 171
259 3300028381 Ga0268264_10049895 Ga0268264_100498955 171
260 3300028381 Ga0268264_10177384 Ga0268264_101773844 171
261 3300028381 Ga0268264_11105728 Ga0268264_111057281 171
262 3300031852 Ga0307410_10095268 Ga0307410_100952682 171
263 3300031852 Ga0307410_10709867 Ga0307410_107098672 171
264 3300031995 Ga0307409_100125147 Ga0307409_1001251474 171
265 3300031995 Ga0307409_100167244 Ga0307409_1001672442 171
266 3300032002 Ga0307416_100869559 Ga0307416_1008695591 171
267 3300032002 Ga0307416_101155372 Ga0307416_1011553722 171
268 3300032004 Ga0307414_10024715 Ga0307414_100247155 171
269 3300032004 Ga0307414_10054106 Ga0307414_100541063 171
270 3300032004 Ga0307414_10297684 Ga0307414_102976843 171
271 3300032005 Ga0307411_10023093 Ga0307411_100230932 171
272 3300032005 Ga0307411_10076493 Ga0307411_100764932 171
273 3300035119 Ga0373956_0049802 Ga0373956_0049802_83_598 171
274 3300035120 Ga0373957_0088550 Ga0373957_0088550_244_759 171
275 3300035172 Ga0373955_0033240 Ga0373955_0033240_752_1267 171
276 3300035692 Ga0373935_0493702 Ga0373935_0493702_304_819 171
277 3300035724 Ga0373933_0264458 Ga0373933_0264458_535_1050 171
278 3300036401 Ga0373937_0720621 Ga0373937_0720621_133_648 171
279 3300037312 Ga0395899_0000738 Ga0395899_0000738_8624_9139 171
280 3300037312 Ga0395899_0056458 Ga0395899_0056458_1744_2259 171
281 3300037418 Ga0395900_0002146 Ga0395900_0002146_12229_12744 171
282 3300037418 Ga0395900_0182973 Ga0395900_0182973_640_1155 171
283 3300037418 Ga0395900_0193157 Ga0395900_0193157_1024_1539 171
284 3300037418 Ga0395900_0227057 Ga0395900_0227057_410_925 171
285 3300037418 Ga0395900_0362907 Ga0395900_0362907_195_716 171
286 3300037418 Ga0395900_0733524 Ga0395900_0733524_353_868 171
287 3300037418 Ga0395900_0815305 Ga0395900_0815305_322_837 171
288 3300037466 Ga0395898_0184174 Ga0395898_0184174_771_1292 171
289 3300037466 Ga0395898_0230239 Ga0395898_0230239_622_1137 171
290 3300037466 Ga0395898_0253104 Ga0395898_0253104_1023_1538 171
291 3300037466 Ga0395898_0370627 Ga0395898_0370627_251_766 171
292 3300037466 Ga0395898_0419411 Ga0395898_0419411_50_565 171
293 3300037471 Ga0395905_0004198 Ga0395905_0004198_853_1368 171
294 3300037471 Ga0395905_0012333 Ga0395905_0012333_848_1363 171
295 3300037471 Ga0395905_0027610 Ga0395905_0027610_3547_4062 171
296 3300037471 Ga0395905_0075451 Ga0395905_0075451_1915_2430 171
297 3300037471 Ga0395905_0090883 Ga0395905_0090883_806_1321 171
298 3300038443 Ga0395901_0004296 Ga0395901_0004296_2715_3230 171
299 3300038443 Ga0395901_0158945 Ga0395901_0158945_431_946 171
300 3300038443 Ga0395901_0207372 Ga0395901_0207372_1010_1531 171
301 3300038443 Ga0395901_0312221 Ga0395901_0312221_708_1262 171
302 3300038443 Ga0395901_0502895 Ga0395901_0502895_202_717 171
303 3300038443 Ga0395901_0841706 Ga0395901_0841706_43_567 171
304 3300042157 Ga0439458_0006030 Ga0439458_0006030_369_884 171
305 3300044694 Ga0466963_0493027 Ga0466963_0493027_230_745 171
306 3300046474 Ga0495605_0334226 Ga0495605_0334226_32_547 171
307 3300046660 Ga0495625_0211863 Ga0495625_0211863_604_1119 171
308 3300046679 Ga0495623_0325257 Ga0495623_0325257_252_767 171
309 3300046684 Ga0495669_0000672 Ga0495669_0000672_10713_11228 171
310 3300047445 Ga0495677_0037792 Ga0495677_0037792_325_840 171
311 3300047447 Ga0495685_040094 Ga0495685_040094_944_1459 171
312 3300048088 Ga0495602_0137338 Ga0495602_0137338_800_1315 171
313 3300048907 Ga0496104_0397583 Ga0496104_0397583_82_597 171
314 3300048911 Ga0496108_0085930 Ga0496108_0085930_99_614 171
315 3300048912 Ga0496109_0057528 Ga0496109_0057528_2671_3186 171
316 3300048914 Ga0496111_0241559 Ga0496111_0241559_361_876 171
317 3300048916 Ga0496113_0015082 Ga0496113_0015082_2563_3078 171
318 3300053078 Ga0495612_0173340 Ga0495612_0173340_346_861 171
319 3300053083 Ga0495655_0147899 Ga0495655_0147899_174_689 171
320 3300053131 Ga0500652_085729 Ga0500652_085729_58_573 171
321 3300053134 Ga0500658_0000036 Ga0500658_0000036_40661_41293 171
322 3300053136 Ga0500559_0046268 Ga0500559_0046268_1323_1841 171
323 3300005293 Ga0065715_10348461 Ga0065715_103484611 172
324 3300005295 Ga0065707_10248873 Ga0065707_102488731 172
325 3300005347 Ga0070668_100078795 Ga0070668_1000787954 172
326 3300005841 Ga0068863_100004005 Ga0068863_10000400510 172
327 3300005843 Ga0068860_100000479 Ga0068860_10000047926 172
328 3300005844 Ga0068862_100000118 Ga0068862_10000011850 172
329 3300005844 Ga0068862_100636234 Ga0068862_1006362342 172
330 3300009553 Ga0105249_10000119 Ga0105249_1000011950 172
331 3300014326 Ga0157380_10071399 Ga0157380_100713995 172
332 3300014326 Ga0157380_10205844 Ga0157380_102058442 172
333 3300025900 Ga0207710_10000484 Ga0207710_1000048413 172
334 3300025923 Ga0207681_11032085 Ga0207681_110320851 172
335 3300025961 Ga0207712_10000048 Ga0207712_1000004849 172
336 3300026088 Ga0207641_10004180 Ga0207641_100041803 172
337 3300028380 Ga0268265_10000139 Ga0268265_1000013935 172
338 3300028380 Ga0268265_10392683 Ga0268265_103926833 172
339 3300028381 Ga0268264_10000585 Ga0268264_1000058523 172
340 3300028786 Ga0307517_10067914 Ga0307517_100679141 172
341 3300028800 Ga0265338_10011878 Ga0265338_100118784 172
342 3300041512 Ga0451853_1049919 Ga0451853_1049919_182_700 172
343 3300047472 Ga0495686_0102439 Ga0495686_0102439_1085_1603 172
344 3300028786 Ga0307517_10234455 Ga0307517_102344552 173
345 3300041498 Ga0451841_0498122 Ga0451841_0498122_137_658 173
346 3300041509 Ga0451843_0281590 Ga0451843_0281590_361_882 173
347 3300001976 JGI24752J21851_1021150 JGI24752J21851_10211502 174
348 3300005331 Ga0070670_100023002 Ga0070670_1000230022 174
349 3300005347 Ga0070668_100018634 Ga0070668_1000186343 174
350 3300005347 Ga0070668_100462636 Ga0070668_1004626362 174
351 3300005367 Ga0070667_100036331 Ga0070667_1000363312 174
352 3300005548 Ga0070665_100026147 Ga0070665_1000261472 174
353 3300005548 Ga0070665_100051475 Ga0070665_1000514752 174
354 3300005617 Ga0068859_100509549 Ga0068859_1005095492 174
355 3300005618 Ga0068864_100002426 Ga0068864_1000024268 174
356 3300005618 Ga0068864_100021856 Ga0068864_1000218562 174
357 3300005618 Ga0068864_100560297 Ga0068864_1005602972 174
358 3300005841 Ga0068863_100000167 Ga0068863_10000016721 174
359 3300005841 Ga0068863_100025913 Ga0068863_1000259132 174
360 3300005841 Ga0068863_100028267 Ga0068863_1000282672 174
361 3300005842 Ga0068858_100000198 Ga0068858_10000019810 174
362 3300005842 Ga0068858_100026724 Ga0068858_1000267248 174
363 3300005843 Ga0068860_100064324 Ga0068860_1000643241 174
364 3300005843 Ga0068860_100160226 Ga0068860_1001602261 174
365 3300005844 Ga0068862_100011336 Ga0068862_1000113366 174
366 3300005844 Ga0068862_100560111 Ga0068862_1005601112 174
367 3300006931 Ga0097620_100509498 Ga0097620_1005094982 174
368 3300009177 Ga0105248_10002620 Ga0105248_1000262010 174
369 3300009177 Ga0105248_10022740 Ga0105248_100227401 174
370 3300009553 Ga0105249_10043788 Ga0105249_100437881 174
371 3300013306 Ga0163162_10081113 Ga0163162_100811131 174
372 3300014968 Ga0157379_10073398 Ga0157379_100733982 174
373 3300014968 Ga0157379_10195401 Ga0157379_101954012 174
374 3300025903 Ga0207680_10152352 Ga0207680_101523522 174
375 3300025925 Ga0207650_10000136 Ga0207650_1000013675 174
376 3300025941 Ga0207711_10002205 Ga0207711_1000220511 174
377 3300025941 Ga0207711_10229069 Ga0207711_102290691 174
378 3300025961 Ga0207712_10000772 Ga0207712_1000077217 174
379 3300025972 Ga0207668_10005475 Ga0207668_1000547510 174
380 3300025972 Ga0207668_10017968 Ga0207668_100179686 174
381 3300025986 Ga0207658_10000167 Ga0207658_1000016744 174
382 3300025986 Ga0207658_10001595 Ga0207658_1000159518 174
383 3300026035 Ga0207703_10000189 Ga0207703_1000018918 174
384 3300026035 Ga0207703_10019349 Ga0207703_100193497 174
385 3300026088 Ga0207641_10000120 Ga0207641_1000012084 174
386 3300026088 Ga0207641_10003524 Ga0207641_100035249 174
387 3300026088 Ga0207641_10163030 Ga0207641_101630303 174
388 3300026095 Ga0207676_10000424 Ga0207676_1000042418 174
389 3300026095 Ga0207676_10000499 Ga0207676_1000049931 174
390 3300026095 Ga0207676_10451117 Ga0207676_104511171 174
391 3300026118 Ga0207675_100237552 Ga0207675_1002375522 174
392 3300028379 Ga0268266_10019857 Ga0268266_100198577 174
393 3300028380 Ga0268265_10103089 Ga0268265_101030891 174
394 3300028381 Ga0268264_10002490 Ga0268264_100024901 174
395 3300028381 Ga0268264_10003421 Ga0268264_100034218 174
396 3300048903 Ga0496100_1239699 Ga0496100_1239699_11_535 174
397 3300048905 Ga0496102_0023075 Ga0496102_0023075_2606_3142 174
398 3300048907 Ga0496104_1257759 Ga0496104_1257759_36_572 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09351

DUF1993

Domain of unknown function (DUF1993)

45

201

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qth-assembly1.cif.gz_B crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.9132 6 161
3qth-assembly1.cif.gz_A crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.8905 6 161
2oqm-assembly2.cif.gz_D crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution 0.8693 5 173
2oqm-assembly2.cif.gz_D crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution 0.8411 5 173
3qth-assembly1.cif.gz_B crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.8082 6 161
ID Description Score Start End Superfamily
3qthB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9104 6 161 1.20.120.450
2oqmC01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8921 11 162 1.20.120.450
2oqmC01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.811 11 162 1.20.120.450
3qthB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.808 6 161 1.20.120.450
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6547 4 151 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A359D5N7-F1-model_v4 DUF1993 domain-containing protein 0.9853 40 154
AF-A0A2R7SJI8-F1-model_v4 deleted 0.9779 40 162
AF-A0A359D5N7-F1-model_v4 DUF1993 domain-containing protein 0.9768 40 154
AF-A0A3N5H1L3-F1-model_v4 DUF1993 domain-containing protein 0.976 49 162
AF-A0A2T5I0L7-F1-model_v4 DUF1993 domain-containing protein 0.972 46 162

Feature Viewer

pLDDT pTM Quality
93.01 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map