F434093

General Info

Members Datasets Scaffolds Average Seq Length
398 163 796 158

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0050041|Ga0395900_0050041_1381_1848
Length 155
Sequence MDDVGVPRGATPDRDHEGWYSWGDFPRSSFAAATGRLLFKPDGPGRGICRMFPTDDHMNMGGSIHGGAVMSFIDMSLFAGGLCAGMERAHYVTLDLTTHFLARGQAGSPLDSHVELVRQTRGHAFLQGVVKQNGENCYSFSGTLKKVARPNAPTR

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
117 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
118 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
119 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
120 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
121 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
122 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
123 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
124 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
131 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
132 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
133 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
134 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
135 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
138 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
141 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
153 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
154 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
155 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
156 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
157 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
158 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
159 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
160 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
163 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.76
Rhizosphere 97.74
Stem 0
Stem Tuber 0.25
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0050041 3300037418 Bacteria 4305
2 JGI24746J21847_1000774 3300001977 Bacteria 4918
3 JGI24749J21850_1018751 3300002076 Bacteria 977
4 Ga0065712_10078870 3300005290 Bacteria 3284
5 Ga0065715_10132786 3300005293 Bacteria 1984
6 Ga0065715_10168795 3300005293 Bacteria 1564
7 Ga0065715_10273161 3300005293 Bacteria 1069
8 Ga0065707_10245082 3300005295 Bacteria 1143
9 Ga0070658_10135565 3300005327 Bacteria 2054
10 Ga0070658_10706699 3300005327 Bacteria 875
11 Ga0070676_10004290 3300005328 Bacteria 7489
12 Ga0070683_100736331 3300005329 Bacteria 944
13 Ga0070690_100274157 3300005330 Bacteria 1201
14 Ga0070670_100003242 3300005331 Bacteria 13437
15 Ga0070670_100009025 3300005331 Bacteria 8518
16 Ga0070670_100113909 3300005331 Bacteria 2331
17 Ga0070677_10000720 3300005333 Bacteria 11056
18 Ga0070660_100183709 3300005339 Bacteria 1693
19 Ga0070660_100751727 3300005339 Bacteria 819
20 Ga0070687_100247379 3300005343 Bacteria 1106
21 Ga0070661_100029476 3300005344 Bacteria 3962
22 Ga0070661_100097549 3300005344 Bacteria 2182
23 Ga0070661_100105587 3300005344 Bacteria 2100
24 Ga0070668_100142157 3300005347 Bacteria 1935
25 Ga0070668_100296925 3300005347 Bacteria 1354
26 Ga0070669_100009022 3300005353 Bacteria 7111
27 Ga0070669_100170570 3300005353 Bacteria 1696
28 Ga0070669_100604617 3300005353 Bacteria 919
29 Ga0070675_100003625 3300005354 Bacteria 11742
30 Ga0070675_100004856 3300005354 Bacteria 10257
31 Ga0070671_100010885 3300005355 Bacteria 7304
32 Ga0070671_100896153 3300005355 Bacteria 775
33 Ga0070674_100184585 3300005356 Bacteria 1600
34 Ga0070673_100000497 3300005364 Bacteria 20985
35 Ga0070659_100001394 3300005366 Bacteria 17436
36 Ga0070659_100102786 3300005366 Bacteria 2301
37 Ga0070667_100007689 3300005367 Bacteria 8939
38 Ga0070667_100022762 3300005367 Bacteria 5196
39 Ga0070663_100365474 3300005455 Bacteria 1171
40 Ga0070678_100019463 3300005456 Bacteria 4427
41 Ga0070678_100947681 3300005456 Bacteria 789
42 Ga0070662_100001966 3300005457 Bacteria 12622
43 Ga0070662_100021674 3300005457 Bacteria 4391
44 Ga0070662_100829711 3300005457 Bacteria 787
45 Ga0070672_100001933 3300005543 Bacteria 13014
46 Ga0070672_100003046 3300005543 Bacteria 10798
47 Ga0070672_100888329 3300005543 Bacteria 787
48 Ga0070665_100490251 3300005548 Bacteria 1240
49 Ga0070704_100240631 3300005549 Bacteria 1481
50 Ga0068855_100007354 3300005563 Bacteria 13335
51 Ga0068855_100292206 3300005563 Bacteria 1806
52 Ga0070664_100003799 3300005564 Bacteria 12191
53 Ga0070664_100018308 3300005564 Bacteria 5751
54 Ga0068857_100410244 3300005577 Bacteria 1261
55 Ga0068854_100001522 3300005578 Bacteria 14062
56 Ga0068854_100144399 3300005578 Bacteria 1829
57 Ga0068854_100485829 3300005578 Bacteria 1037
58 Ga0068856_100021355 3300005614 Bacteria 6293
59 Ga0068856_101153171 3300005614 Bacteria 792
60 Ga0068852_100002128 3300005616 Bacteria 13573
61 Ga0068852_101342940 3300005616 Bacteria 737
62 Ga0068852_101343194 3300005616 Bacteria 737
63 Ga0068859_100008026 3300005617 Bacteria 10703
64 Ga0068864_100023546 3300005618 Bacteria 5172
65 Ga0068864_100354051 3300005618 Bacteria 1386
66 Ga0068866_10963158 3300005718 Bacteria 604
67 Ga0068861_100069888 3300005719 Bacteria 2718
68 Ga0068860_100201314 3300005843 Bacteria 1930
69 Ga0068862_100115672 3300005844 Bacteria 2359
70 Ga0068862_100287545 3300005844 Bacteria 1509
71 Ga0097621_100428809 3300006237 Bacteria 1188
72 Ga0075431_100180285 3300006847 Bacteria 2168
73 Ga0075433_10897803 3300006852 Bacteria 773
74 Ga0097620_100008026 3300006931 Bacteria 10703
75 Ga0105240_10031879 3300009093 Bacteria 6829
76 Ga0111539_10243402 3300009094 Bacteria 2094
77 Ga0114129_11316248 3300009147 Bacteria 895
78 Ga0105248_10002607 3300009177 Bacteria 20059
79 Ga0105248_10761345 3300009177 Bacteria 1093
80 Ga0105238_10465226 3300009551 Bacteria 1263
81 Ga0105249_10030435 3300009553 Bacteria 4880
82 Ga0105249_10972932 3300009553 Bacteria 917
83 Ga0157373_10005240 3300013100 Bacteria 9733
84 Ga0157373_10438239 3300013100 Bacteria 939
85 Ga0157371_10006979 3300013102 Bacteria 9191
86 Ga0157371_10216613 3300013102 Bacteria 1375
87 Ga0157371_10342389 3300013102 Bacteria 1088
88 Ga0157370_10317374 3300013104 Bacteria 1438
89 Ga0157370_11136567 3300013104 Bacteria 705
90 Ga0157369_10001975 3300013105 Bacteria 24741
91 Ga0157369_10022724 3300013105 Bacteria 6994
92 Ga0157369_10456512 3300013105 Bacteria 1323
93 Ga0163162_10231528 3300013306 Bacteria 1978
94 Ga0157372_10844767 3300013307 Bacteria 1063
95 Ga0157375_10427591 3300013308 Bacteria 1490
96 Ga0157375_11774274 3300013308 Bacteria 731
97 Ga0163163_10104733 3300014325 Bacteria 2854
98 Ga0163163_11961783 3300014325 Bacteria 645
99 Ga0157380_10001477 3300014326 Bacteria 15380
100 Ga0157380_10001524 3300014326 Bacteria 15215
101 Ga0157380_10021905 3300014326 Bacteria 4800
102 Ga0157380_10067598 3300014326 Bacteria 2878
103 Ga0163161_10021139 3300017792 Bacteria 4574
104 Ga0163161_10076584 3300017792 Bacteria 2455
105 Ga0207697_10007792 3300025315 Bacteria 4743
106 Ga0207697_10147975 3300025315 Bacteria 1021
107 Ga0207682_10000874 3300025893 Bacteria 13976
108 Ga0207688_10032959 3300025901 Bacteria 2863
109 Ga0207688_10417154 3300025901 Bacteria 834
110 Ga0207645_10004717 3300025907 Bacteria 10030
111 Ga0207705_10000622 3300025909 Bacteria 29600
112 Ga0207705_10098430 3300025909 Bacteria 2149
113 Ga0207705_10704671 3300025909 Bacteria 785
114 Ga0207695_10018483 3300025913 Bacteria 8058
115 Ga0207695_10031372 3300025913 Bacteria 5829
116 Ga0207657_10038552 3300025919 Bacteria 4254
117 Ga0207649_10002360 3300025920 Bacteria 10582
118 Ga0207681_10002843 3300025923 Bacteria 10951
119 Ga0207681_10067017 3300025923 Bacteria 2487
120 Ga0207681_10316553 3300025923 Bacteria 1239
121 Ga0207681_10378463 3300025923 Bacteria 1139
122 Ga0207650_10001007 3300025925 Bacteria 21201
123 Ga0207650_10002935 3300025925 Bacteria 11760
124 Ga0207650_10035723 3300025925 Bacteria 3611
125 Ga0207659_10003726 3300025926 Bacteria 9186
126 Ga0207659_10009082 3300025926 Bacteria 6202
127 Ga0207644_10001095 3300025931 Bacteria 17391
128 Ga0207644_10171159 3300025931 Bacteria 1695
129 Ga0207690_10001193 3300025932 Bacteria 16417
130 Ga0207706_10000837 3300025933 Bacteria 31802
131 Ga0207706_10026406 3300025933 Bacteria 5199
132 Ga0207706_10233147 3300025933 Bacteria 1610
133 Ga0207709_10415379 3300025935 Bacteria 1032
134 Ga0207669_10058693 3300025937 Bacteria 2349
135 Ga0207691_10001140 3300025940 Bacteria 26349
136 Ga0207691_10005517 3300025940 Bacteria 12221
137 Ga0207711_10024382 3300025941 Bacteria 5067
138 Ga0207711_10585649 3300025941 Bacteria 1041
139 Ga0207661_10226755 3300025944 Bacteria 1653
140 Ga0207679_10001091 3300025945 Bacteria 17278
141 Ga0207667_10042105 3300025949 Bacteria 4857
142 Ga0207667_10094855 3300025949 Bacteria 3080
143 Ga0207667_10209283 3300025949 Bacteria 1999
144 Ga0207651_10002630 3300025960 Bacteria 8584
145 Ga0207712_10003090 3300025961 Bacteria 10621
146 Ga0207668_10002016 3300025972 Bacteria 11853
147 Ga0207668_10081714 3300025972 Bacteria 2345
148 Ga0207668_10302704 3300025972 Bacteria 1320
149 Ga0207668_10834965 3300025972 Bacteria 817
150 Ga0207640_10000363 3300025981 Bacteria 29456
151 Ga0207658_10005039 3300025986 Bacteria 9096
152 Ga0207658_10010161 3300025986 Bacteria 6398
153 Ga0207678_10029870 3300026067 Bacteria 4759
154 Ga0207678_10068372 3300026067 Bacteria 3048
155 Ga0207678_10192045 3300026067 Bacteria 1745
156 Ga0207708_10024565 3300026075 Bacteria 4559
157 Ga0207702_10016188 3300026078 Bacteria 6174
158 Ga0207648_10005430 3300026089 Bacteria 12845
159 Ga0207676_10822830 3300026095 Bacteria 907
160 Ga0207674_10490928 3300026116 Bacteria 1187
161 Ga0207674_10791765 3300026116 Bacteria 915
162 Ga0207675_100021164 3300026118 Bacteria 6059
163 Ga0207683_10054502 3300026121 Bacteria 3506
164 Ga0207683_10149408 3300026121 Bacteria 2108
165 Ga0207698_10008898 3300026142 Bacteria 6366
166 Ga0207698_10167100 3300026142 Bacteria 1932
167 Ga0209983_1038835 3300027665 Bacteria 1027
168 Ga0268265_10269370 3300028380 Bacteria 1518
169 Ga0268265_10348172 3300028380 Bacteria 1352
170 Ga0268265_10816019 3300028380 Bacteria 910
171 Ga0307408_100001902 3300031548 Bacteria 15178
172 Ga0307408_100076998 3300031548 Bacteria 2483
173 Ga0307408_100112354 3300031548 Bacteria 2095
174 Ga0307408_100187396 3300031548 Bacteria 1664
175 Ga0307408_100436666 3300031548 Bacteria 1132
176 Ga0307408_100454067 3300031548 Bacteria 1112
177 Ga0307408_101452955 3300031548 Bacteria 647
178 Ga0307405_10001309 3300031731 Bacteria 10406
179 Ga0307405_10002241 3300031731 Bacteria 8461
180 Ga0307405_10009776 3300031731 Bacteria 4934
181 Ga0307405_10035169 3300031731 Bacteria 2989
182 Ga0307405_10083088 3300031731 Bacteria 2098
183 Ga0307405_10083704 3300031731 Bacteria 2092
184 Ga0307405_10150228 3300031731 Bacteria 1637
185 Ga0307405_10192582 3300031731 Bacteria 1474
186 Ga0307413_10002874 3300031824 Bacteria 7107
187 Ga0307413_10003891 3300031824 Bacteria 6385
188 Ga0307413_10004700 3300031824 Bacteria 5990
189 Ga0307413_10005381 3300031824 Bacteria 5709
190 Ga0307413_10011033 3300031824 Bacteria 4418
191 Ga0307413_10012388 3300031824 Bacteria 4243
192 Ga0307413_10014892 3300031824 Bacteria 3967
193 Ga0307413_10035957 3300031824 Bacteria 2847
194 Ga0307413_10056636 3300031824 Bacteria 2392
195 Ga0307413_10104016 3300031824 Bacteria 1884
196 Ga0307413_10110779 3300031824 Bacteria 1837
197 Ga0307413_10120703 3300031824 Bacteria 1775
198 Ga0307413_10206743 3300031824 Bacteria 1422
199 Ga0307413_10248106 3300031824 Bacteria 1319
200 Ga0307413_10625562 3300031824 Bacteria 884
201 Ga0307413_10664807 3300031824 Bacteria 861
202 Ga0307413_11045064 3300031824 Bacteria 702
203 Ga0307410_10001707 3300031852 Bacteria 10130
204 Ga0307410_10002278 3300031852 Bacteria 9203
205 Ga0307410_10002958 3300031852 Bacteria 8379
206 Ga0307410_10003527 3300031852 Bacteria 7865
207 Ga0307410_10006742 3300031852 Bacteria 6226
208 Ga0307410_10019661 3300031852 Bacteria 4113
209 Ga0307410_10021761 3300031852 Bacteria 3950
210 Ga0307410_10029197 3300031852 Bacteria 3509
211 Ga0307410_10057279 3300031852 Bacteria 2653
212 Ga0307410_10067841 3300031852 Bacteria 2461
213 Ga0307410_10091791 3300031852 Bacteria 2157
214 Ga0307410_10102295 3300031852 Bacteria 2055
215 Ga0307410_10157024 3300031852 Bacteria 1700
216 Ga0307410_10329697 3300031852 Bacteria 1213
217 Ga0307410_10378111 3300031852 Bacteria 1139
218 Ga0307410_10464055 3300031852 Bacteria 1035
219 Ga0307410_10521699 3300031852 Bacteria 980
220 Ga0307410_10596923 3300031852 Bacteria 920
221 Ga0307410_10766805 3300031852 Bacteria 818
222 Ga0307406_10018269 3300031901 Bacteria 4093
223 Ga0307406_10032362 3300031901 Bacteria 3192
224 Ga0307406_10036323 3300031901 Bacteria 3035
225 Ga0307406_10044059 3300031901 Bacteria 2795
226 Ga0307406_10066726 3300031901 Bacteria 2343
227 Ga0307406_10177264 3300031901 Bacteria 1548
228 Ga0307406_10492467 3300031901 Bacteria 992
229 Ga0307407_10001312 3300031903 Bacteria 8885
230 Ga0307407_10003215 3300031903 Bacteria 6635
231 Ga0307407_10006339 3300031903 Bacteria 5240
232 Ga0307407_10025593 3300031903 Bacteria 3112
233 Ga0307407_10042334 3300031903 Bacteria 2553
234 Ga0307407_10045816 3300031903 Bacteria 2473
235 Ga0307407_10071010 3300031903 Bacteria 2072
236 Ga0307407_10115236 3300031903 Bacteria 1694
237 Ga0307407_10273849 3300031903 Bacteria 1166
238 Ga0307407_10463010 3300031903 Bacteria 922
239 Ga0307412_10001080 3300031911 Bacteria 15585
240 Ga0307412_10009742 3300031911 Bacteria 5517
241 Ga0307412_10009927 3300031911 Bacteria 5476
242 Ga0307412_10022501 3300031911 Bacteria 3865
243 Ga0307412_10172796 3300031911 Bacteria 1617
244 Ga0307412_10173795 3300031911 Bacteria 1613
245 Ga0307412_10174061 3300031911 Bacteria 1612
246 Ga0307412_10416916 3300031911 Bacteria 1097
247 Ga0307409_100009310 3300031995 Bacteria 6029
248 Ga0307409_100010525 3300031995 Bacteria 5757
249 Ga0307409_100012104 3300031995 Bacteria 5479
250 Ga0307409_100021424 3300031995 Bacteria 4430
251 Ga0307409_100041318 3300031995 Bacteria 3443
252 Ga0307409_100041967 3300031995 Bacteria 3422
253 Ga0307409_100125906 3300031995 Bacteria 2179
254 Ga0307409_100169925 3300031995 Bacteria 1918
255 Ga0307409_100258505 3300031995 Bacteria 1596
256 Ga0307409_100360162 3300031995 Bacteria 1375
257 Ga0307409_100392499 3300031995 Bacteria 1323
258 Ga0307409_100444369 3300031995 Bacteria 1250
259 Ga0307409_100492142 3300031995 Bacteria 1192
260 Ga0307409_100655340 3300031995 Bacteria 1044
261 Ga0307409_100724160 3300031995 Bacteria 996
262 Ga0307409_101033006 3300031995 Bacteria 841
263 Ga0307409_101218941 3300031995 Bacteria 776
264 Ga0307409_101277012 3300031995 Bacteria 759
265 Ga0307409_101393255 3300031995 Bacteria 727
266 Ga0307416_100003714 3300032002 Bacteria 9048
267 Ga0307416_100004676 3300032002 Bacteria 8286
268 Ga0307416_100012714 3300032002 Bacteria 5685
269 Ga0307416_100036778 3300032002 Bacteria 3759
270 Ga0307416_100081671 3300032002 Bacteria 2734
271 Ga0307416_100129895 3300032002 Bacteria 2265
272 Ga0307416_100660621 3300032002 Bacteria 1131
273 Ga0307414_10003033 3300032004 Bacteria 8903
274 Ga0307414_10004192 3300032004 Bacteria 7797
275 Ga0307414_10004722 3300032004 Bacteria 7434
276 Ga0307414_10004863 3300032004 Bacteria 7339
277 Ga0307414_10006114 3300032004 Bacteria 6684
278 Ga0307414_10009056 3300032004 Bacteria 5694
279 Ga0307414_10019473 3300032004 Bacteria 4206
280 Ga0307414_10037933 3300032004 Bacteria 3231
281 Ga0307414_10103899 3300032004 Bacteria 2145
282 Ga0307414_10226589 3300032004 Bacteria 1538
283 Ga0307414_10244930 3300032004 Bacteria 1486
284 Ga0307414_10265955 3300032004 Bacteria 1433
285 Ga0307414_10416547 3300032004 Bacteria 1170
286 Ga0307414_10495179 3300032004 Bacteria 1080
287 Ga0307414_10585543 3300032004 Bacteria 999
288 Ga0307414_10758639 3300032004 Bacteria 882
289 Ga0307414_10837740 3300032004 Bacteria 840
290 Ga0307414_10862473 3300032004 Bacteria 828
291 Ga0307414_11065076 3300032004 Bacteria 746
292 Ga0307414_11245713 3300032004 Bacteria 689
293 Ga0307414_12123793 3300032004 Bacteria 524
294 Ga0307411_10001400 3300032005 Bacteria 9803
295 Ga0307411_10002471 3300032005 Bacteria 8194
296 Ga0307411_10003378 3300032005 Bacteria 7389
297 Ga0307411_10004479 3300032005 Bacteria 6701
298 Ga0307411_10009793 3300032005 Bacteria 5065
299 Ga0307411_10021426 3300032005 Bacteria 3782
300 Ga0307411_10032109 3300032005 Bacteria 3240
301 Ga0307411_10041295 3300032005 Bacteria 2933
302 Ga0307411_10047893 3300032005 Bacteria 2766
303 Ga0307411_10053217 3300032005 Bacteria 2650
304 Ga0307411_10067339 3300032005 Bacteria 2409
305 Ga0307411_10085484 3300032005 Bacteria 2185
306 Ga0307411_10330156 3300032005 Bacteria 1235
307 Ga0307411_10388025 3300032005 Bacteria 1151
308 Ga0307411_10478343 3300032005 Bacteria 1048
309 Ga0307411_10578917 3300032005 Bacteria 962
310 Ga0307411_10586336 3300032005 Bacteria 956
311 Ga0307411_10723744 3300032005 Bacteria 869
312 Ga0307415_100001677 3300032126 Bacteria 10748
313 Ga0307415_100002105 3300032126 Bacteria 9844
314 Ga0307415_100002388 3300032126 Bacteria 9359
315 Ga0307415_100036875 3300032126 Bacteria 3208
316 Ga0307415_100060240 3300032126 Bacteria 2622
317 Ga0307415_100061489 3300032126 Bacteria 2600
318 Ga0307415_100068160 3300032126 Bacteria 2489
319 Ga0307415_100229792 3300032126 Bacteria 1493
320 Ga0307415_100272471 3300032126 Bacteria 1387
321 Ga0307415_100283372 3300032126 Bacteria 1364
322 Ga0307415_100303908 3300032126 Bacteria 1323
323 Ga0307415_100764548 3300032126 Bacteria 878
324 Ga0395899_0076442 3300037312 Bacteria 2444
325 Ga0395900_0002587 3300037418 Bacteria 19792
326 Ga0395900_0246346 3300037418 Bacteria 1790
327 Ga0395898_1018077 3300037466 Bacteria 764
328 Ga0395905_0000412 3300037471 Bacteria 60157
329 Ga0395905_0290457 3300037471 Bacteria 1522
330 Ga0436364_1406360 3300037853 Bacteria 26034
331 Ga0395901_0001803 3300038443 Bacteria 22120
332 Ga0439453_0021887 3300041408 Bacteria 1155
333 Ga0439465_0031982 3300041413 Bacteria 1678
334 Ga0439465_0171593 3300041413 Bacteria 782
335 Ga0439448_0190162 3300042005 Bacteria 718
336 Ga0439449_0010871 3300042007 Bacteria 3435
337 Ga0450920_011700 3300042122 Bacteria 1638
338 Ga0450920_089259 3300042122 Bacteria 635
339 Ga0439435_0201085 3300042436 Bacteria 657
340 Ga0439435_0313921 3300042436 Bacteria 539
341 Ga0439444_0089080 3300042437 Bacteria 686
342 Ga0439464_0011615 3300042439 Bacteria 2335
343 Ga0450916_012765 3300042530 Bacteria 1076
344 Ga0466966_0000077 3300044684 Bacteria 62463
345 Ga0466963_0047454 3300044694 Bacteria 2834
346 Ga0466960_0072702 3300044901 Bacteria 1715
347 Ga0495584_0393270 3300046491 Bacteria 704
348 Ga0495585_0136950 3300046492 Bacteria 1285
349 Ga0495585_0175881 3300046492 Bacteria 1103
350 Ga0495585_0358944 3300046492 Bacteria 707
351 Ga0495663_0002270 3300046525 Bacteria 5836
352 Ga0495663_0002337 3300046525 Bacteria 5738
353 Ga0495663_0050105 3300046525 Bacteria 1290
354 Ga0495642_0024855 3300046528 Bacteria 2371
355 Ga0495598_0004626 3300046537 Bacteria 2993
356 Ga0495621_0000514 3300046539 Bacteria 9588
357 Ga0495621_0002364 3300046539 Bacteria 5070
358 Ga0495621_0071010 3300046539 Bacteria 1282
359 Ga0495621_0271278 3300046539 Bacteria 697
360 Ga0495597_0184059 3300046542 Bacteria 843
361 Ga0495633_0016373 3300046558 Bacteria 3824
362 Ga0495633_0320831 3300046558 Bacteria 703
363 Ga0495668_0185835 3300046616 Bacteria 1138
364 Ga0495661_0262061 3300046665 Bacteria 878
365 Ga0495661_0438921 3300046665 Bacteria 630
366 Ga0495669_0001526 3300046684 Bacteria 9523
367 Ga0495669_0011235 3300046684 Bacteria 3799
368 Ga0495669_0021736 3300046684 Bacteria 2788
369 Ga0495669_0175598 3300046684 Bacteria 1020
370 Ga0495670_0018902 3300046691 Bacteria 3395
371 Ga0495670_0022655 3300046691 Bacteria 3102
372 Ga0495670_0046642 3300046691 Bacteria 2165
373 Ga0495636_0134611 3300047318 Bacteria 1101
374 Ga0495636_0196015 3300047318 Bacteria 921
375 Ga0495677_0011807 3300047445 Bacteria 3190
376 Ga0495677_0077113 3300047445 Bacteria 1247
377 Ga0495681_0384311 3300047470 Bacteria 528
378 Ga0495615_0162933 3300048090 Bacteria 671
379 Ga0496101_0574615 3300048904 Bacteria 891
380 Ga0496107_0207329 3300048910 Bacteria 1457
381 Ga0496108_0040591 3300048911 Bacteria 3881
382 Ga0496109_0084264 3300048912 Bacteria 2932
383 Ga0496110_0001595 3300048913 Bacteria 16573
384 Ga0496111_0019139 3300048914 Bacteria 4751
385 Ga0496114_0129253 3300048917 Bacteria 2180
386 Ga0501039_1154524 3300049575 Bacteria 600
387 Ga0501209_051017 3300049656 Bacteria 1129
388 Ga0501235_010139 3300049669 Bacteria 2059
389 Ga0501247_039161 3300049677 Bacteria 673
390 Ga0501249_001132 3300049679 Bacteria 5631
391 Ga0501234_013584 3300049707 Bacteria 1278
392 Ga0501262_061782 3300049759 Bacteria 599
393 Ga0501268_053451 3300049765 Bacteria 786
394 Ga0501272_018072 3300049769 Bacteria 833
395 Ga0501279_014040 3300049775 Bacteria 1101
396 nmdc:mga06r32_148851_c1 3300050510 Bacteria 2319
397 2885427523 2885427238 Bacteria 2291351
398 2896431173 2896429255 Bacteria 2557483
399 Ga0395900_0050041
400 JGI24746J21847_1000774
401 JGI24749J21850_1018751
402 Ga0065712_10078870
403 Ga0065715_10132786
404 Ga0065715_10168795
405 Ga0065715_10273161
406 Ga0065707_10245082
407 Ga0070658_10135565
408 Ga0070658_10706699
409 Ga0070676_10004290
410 Ga0070683_100736331
411 Ga0070690_100274157
412 Ga0070670_100003242
413 Ga0070670_100009025
414 Ga0070670_100113909
415 Ga0070677_10000720
416 Ga0070660_100183709
417 Ga0070660_100751727
418 Ga0070687_100247379
419 Ga0070661_100029476
420 Ga0070661_100097549
421 Ga0070661_100105587
422 Ga0070668_100142157
423 Ga0070668_100296925
424 Ga0070669_100009022
425 Ga0070669_100170570
426 Ga0070669_100604617
427 Ga0070675_100003625
428 Ga0070675_100004856
429 Ga0070671_100010885
430 Ga0070671_100896153
431 Ga0070674_100184585
432 Ga0070673_100000497
433 Ga0070659_100001394
434 Ga0070659_100102786
435 Ga0070667_100007689
436 Ga0070667_100022762
437 Ga0070663_100365474
438 Ga0070678_100019463
439 Ga0070678_100947681
440 Ga0070662_100001966
441 Ga0070662_100021674
442 Ga0070662_100829711
443 Ga0070672_100001933
444 Ga0070672_100003046
445 Ga0070672_100888329
446 Ga0070665_100490251
447 Ga0070704_100240631
448 Ga0068855_100007354
449 Ga0068855_100292206
450 Ga0070664_100003799
451 Ga0070664_100018308
452 Ga0068857_100410244
453 Ga0068854_100001522
454 Ga0068854_100144399
455 Ga0068854_100485829
456 Ga0068856_100021355
457 Ga0068856_101153171
458 Ga0068852_100002128
459 Ga0068852_101342940
460 Ga0068852_101343194
461 Ga0068859_100008026
462 Ga0068864_100023546
463 Ga0068864_100354051
464 Ga0068866_10963158
465 Ga0068861_100069888
466 Ga0068860_100201314
467 Ga0068862_100115672
468 Ga0068862_100287545
469 Ga0097621_100428809
470 Ga0075431_100180285
471 Ga0075433_10897803
472 Ga0097620_100008026
473 Ga0105240_10031879
474 Ga0111539_10243402
475 Ga0114129_11316248
476 Ga0105248_10002607
477 Ga0105248_10761345
478 Ga0105238_10465226
479 Ga0105249_10030435
480 Ga0105249_10972932
481 Ga0157373_10005240
482 Ga0157373_10438239
483 Ga0157371_10006979
484 Ga0157371_10216613
485 Ga0157371_10342389
486 Ga0157370_10317374
487 Ga0157370_11136567
488 Ga0157369_10001975
489 Ga0157369_10022724
490 Ga0157369_10456512
491 Ga0163162_10231528
492 Ga0157372_10844767
493 Ga0157375_10427591
494 Ga0157375_11774274
495 Ga0163163_10104733
496 Ga0163163_11961783
497 Ga0157380_10001477
498 Ga0157380_10001524
499 Ga0157380_10021905
500 Ga0157380_10067598
501 Ga0163161_10021139
502 Ga0163161_10076584
503 Ga0207697_10007792
504 Ga0207697_10147975
505 Ga0207682_10000874
506 Ga0207688_10032959
507 Ga0207688_10417154
508 Ga0207645_10004717
509 Ga0207705_10000622
510 Ga0207705_10098430
511 Ga0207705_10704671
512 Ga0207695_10018483
513 Ga0207695_10031372
514 Ga0207657_10038552
515 Ga0207649_10002360
516 Ga0207681_10002843
517 Ga0207681_10067017
518 Ga0207681_10316553
519 Ga0207681_10378463
520 Ga0207650_10001007
521 Ga0207650_10002935
522 Ga0207650_10035723
523 Ga0207659_10003726
524 Ga0207659_10009082
525 Ga0207644_10001095
526 Ga0207644_10171159
527 Ga0207690_10001193
528 Ga0207706_10000837
529 Ga0207706_10026406
530 Ga0207706_10233147
531 Ga0207709_10415379
532 Ga0207669_10058693
533 Ga0207691_10001140
534 Ga0207691_10005517
535 Ga0207711_10024382
536 Ga0207711_10585649
537 Ga0207661_10226755
538 Ga0207679_10001091
539 Ga0207667_10042105
540 Ga0207667_10094855
541 Ga0207667_10209283
542 Ga0207651_10002630
543 Ga0207712_10003090
544 Ga0207668_10002016
545 Ga0207668_10081714
546 Ga0207668_10302704
547 Ga0207668_10834965
548 Ga0207640_10000363
549 Ga0207658_10005039
550 Ga0207658_10010161
551 Ga0207678_10029870
552 Ga0207678_10068372
553 Ga0207678_10192045
554 Ga0207708_10024565
555 Ga0207702_10016188
556 Ga0207648_10005430
557 Ga0207676_10822830
558 Ga0207674_10490928
559 Ga0207674_10791765
560 Ga0207675_100021164
561 Ga0207683_10054502
562 Ga0207683_10149408
563 Ga0207698_10008898
564 Ga0207698_10167100
565 Ga0209983_1038835
566 Ga0268265_10269370
567 Ga0268265_10348172
568 Ga0268265_10816019
569 Ga0307408_100001902
570 Ga0307408_100076998
571 Ga0307408_100112354
572 Ga0307408_100187396
573 Ga0307408_100436666
574 Ga0307408_100454067
575 Ga0307408_101452955
576 Ga0307405_10001309
577 Ga0307405_10002241
578 Ga0307405_10009776
579 Ga0307405_10035169
580 Ga0307405_10083088
581 Ga0307405_10083704
582 Ga0307405_10150228
583 Ga0307405_10192582
584 Ga0307413_10002874
585 Ga0307413_10003891
586 Ga0307413_10004700
587 Ga0307413_10005381
588 Ga0307413_10011033
589 Ga0307413_10012388
590 Ga0307413_10014892
591 Ga0307413_10035957
592 Ga0307413_10056636
593 Ga0307413_10104016
594 Ga0307413_10110779
595 Ga0307413_10120703
596 Ga0307413_10206743
597 Ga0307413_10248106
598 Ga0307413_10625562
599 Ga0307413_10664807
600 Ga0307413_11045064
601 Ga0307410_10001707
602 Ga0307410_10002278
603 Ga0307410_10002958
604 Ga0307410_10003527
605 Ga0307410_10006742
606 Ga0307410_10019661
607 Ga0307410_10021761
608 Ga0307410_10029197
609 Ga0307410_10057279
610 Ga0307410_10067841
611 Ga0307410_10091791
612 Ga0307410_10102295
613 Ga0307410_10157024
614 Ga0307410_10329697
615 Ga0307410_10378111
616 Ga0307410_10464055
617 Ga0307410_10521699
618 Ga0307410_10596923
619 Ga0307410_10766805
620 Ga0307406_10018269
621 Ga0307406_10032362
622 Ga0307406_10036323
623 Ga0307406_10044059
624 Ga0307406_10066726
625 Ga0307406_10177264
626 Ga0307406_10492467
627 Ga0307407_10001312
628 Ga0307407_10003215
629 Ga0307407_10006339
630 Ga0307407_10025593
631 Ga0307407_10042334
632 Ga0307407_10045816
633 Ga0307407_10071010
634 Ga0307407_10115236
635 Ga0307407_10273849
636 Ga0307407_10463010
637 Ga0307412_10001080
638 Ga0307412_10009742
639 Ga0307412_10009927
640 Ga0307412_10022501
641 Ga0307412_10172796
642 Ga0307412_10173795
643 Ga0307412_10174061
644 Ga0307412_10416916
645 Ga0307409_100009310
646 Ga0307409_100010525
647 Ga0307409_100012104
648 Ga0307409_100021424
649 Ga0307409_100041318
650 Ga0307409_100041967
651 Ga0307409_100125906
652 Ga0307409_100169925
653 Ga0307409_100258505
654 Ga0307409_100360162
655 Ga0307409_100392499
656 Ga0307409_100444369
657 Ga0307409_100492142
658 Ga0307409_100655340
659 Ga0307409_100724160
660 Ga0307409_101033006
661 Ga0307409_101218941
662 Ga0307409_101277012
663 Ga0307409_101393255
664 Ga0307416_100003714
665 Ga0307416_100004676
666 Ga0307416_100012714
667 Ga0307416_100036778
668 Ga0307416_100081671
669 Ga0307416_100129895
670 Ga0307416_100660621
671 Ga0307414_10003033
672 Ga0307414_10004192
673 Ga0307414_10004722
674 Ga0307414_10004863
675 Ga0307414_10006114
676 Ga0307414_10009056
677 Ga0307414_10019473
678 Ga0307414_10037933
679 Ga0307414_10103899
680 Ga0307414_10226589
681 Ga0307414_10244930
682 Ga0307414_10265955
683 Ga0307414_10416547
684 Ga0307414_10495179
685 Ga0307414_10585543
686 Ga0307414_10758639
687 Ga0307414_10837740
688 Ga0307414_10862473
689 Ga0307414_11065076
690 Ga0307414_11245713
691 Ga0307414_12123793
692 Ga0307411_10001400
693 Ga0307411_10002471
694 Ga0307411_10003378
695 Ga0307411_10004479
696 Ga0307411_10009793
697 Ga0307411_10021426
698 Ga0307411_10032109
699 Ga0307411_10041295
700 Ga0307411_10047893
701 Ga0307411_10053217
702 Ga0307411_10067339
703 Ga0307411_10085484
704 Ga0307411_10330156
705 Ga0307411_10388025
706 Ga0307411_10478343
707 Ga0307411_10578917
708 Ga0307411_10586336
709 Ga0307411_10723744
710 Ga0307415_100001677
711 Ga0307415_100002105
712 Ga0307415_100002388
713 Ga0307415_100036875
714 Ga0307415_100060240
715 Ga0307415_100061489
716 Ga0307415_100068160
717 Ga0307415_100229792
718 Ga0307415_100272471
719 Ga0307415_100283372
720 Ga0307415_100303908
721 Ga0307415_100764548
722 Ga0395899_0076442
723 Ga0395900_0002587
724 Ga0395900_0246346
725 Ga0395898_1018077
726 Ga0395905_0000412
727 Ga0395905_0290457
728 Ga0436364_1406360
729 Ga0395901_0001803
730 Ga0439453_0021887
731 Ga0439465_0031982
732 Ga0439465_0171593
733 Ga0439448_0190162
734 Ga0439449_0010871
735 Ga0450920_011700
736 Ga0450920_089259
737 Ga0439435_0201085
738 Ga0439435_0313921
739 Ga0439444_0089080
740 Ga0439464_0011615
741 Ga0450916_012765
742 Ga0466966_0000077
743 Ga0466963_0047454
744 Ga0466960_0072702
745 Ga0495584_0393270
746 Ga0495585_0136950
747 Ga0495585_0175881
748 Ga0495585_0358944
749 Ga0495663_0002270
750 Ga0495663_0002337
751 Ga0495663_0050105
752 Ga0495642_0024855
753 Ga0495598_0004626
754 Ga0495621_0000514
755 Ga0495621_0002364
756 Ga0495621_0071010
757 Ga0495621_0271278
758 Ga0495597_0184059
759 Ga0495633_0016373
760 Ga0495633_0320831
761 Ga0495668_0185835
762 Ga0495661_0262061
763 Ga0495661_0438921
764 Ga0495669_0001526
765 Ga0495669_0011235
766 Ga0495669_0021736
767 Ga0495669_0175598
768 Ga0495670_0018902
769 Ga0495670_0022655
770 Ga0495670_0046642
771 Ga0495636_0134611
772 Ga0495636_0196015
773 Ga0495677_0011807
774 Ga0495677_0077113
775 Ga0495681_0384311
776 Ga0495615_0162933
777 Ga0496101_0574615
778 Ga0496107_0207329
779 Ga0496108_0040591
780 Ga0496109_0084264
781 Ga0496110_0001595
782 Ga0496111_0019139
783 Ga0496114_0129253
784 Ga0501039_1154524
785 Ga0501209_051017
786 Ga0501235_010139
787 Ga0501247_039161
788 Ga0501249_001132
789 Ga0501234_013584
790 Ga0501262_061782
791 Ga0501268_053451
792 Ga0501272_018072
793 Ga0501279_014040
794 nmdc:mga06r32_148851_c1
795 2885427523
796 2896431173

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

61

138

0.94

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

54

144

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fs2-assembly1.cif.gz_B structure of the e. coli paai protein from the phyenylacetic acid degradation operon 0.8843 39 150
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.8839 39 150
1wlu-assembly1.cif.gz_A crystal structure of tt0310 protein from thermus thermophilus hb8 0.8829 39 150
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.8807 39 150
3lbe-assembly1.cif.gz_B the crystal structure of smu.793 from streptococcus mutans ua159 bound to acetyl coa 0.8795 41 150
ID Description Score Start End Superfamily
af_Q2FXM2_325_429_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9174 51 150 3.10.129.10
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8829 39 150 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8708 50 150 3.10.129.10
af_O06307_73_209_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.868 35 150 3.10.129.10
2fs2B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8675 39 150 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2W6SBN8-F1-model_v4 PaaI family thioesterase 0.9198 23 150 GO:0016790
AF-A0A4S1WAK4-F1-model_v4 PaaI family thioesterase 0.904 12 153 GO:0016790
AF-B8FKV4-F1-model_v4 Thioesterase superfamily protein 0.9031 39 152
AF-A0A2W6SBN8-F1-model_v4 PaaI family thioesterase 0.8998 23 150 GO:0016790
AF-A0A7G7MC19-F1-model_v4 Acyl-coenzyme A thioesterase THEM4 (EC 3.1.2.2) (Thioesterase superfamily member 4) 0.8983 40 151 GO:0005737
GO:0005886
GO:0006631
GO:0016787
GO:0042995

Map