F434010

General Info

Members Datasets Scaffolds Average Seq Length
398 209 796 139

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10216272|Ga0075366_102162721
Length 151
Sequence LERSVAGRYHSTAMTNPRVPDMTLSMTWQGEERFHGVSRGASILVDGKGQAGPSPVQTLAFSLGGCMGIDVADVIVKGRFELKALTCDLQVFRSPETPKRIVGVNLHYAVSGNVPEDRVARAIELSRDKYCSVWHSLNPDIDFKTSFTVTA

Samples

Sample ID Description Type Environment
1 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
154 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
155 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
156 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
184 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
185 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
188 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
203 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.79
Nodule 0
Rhizoplane 4.52
Rhizosphere 87.44
Stem 0
Stem Tuber 0
Unclassified 34.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075366_10216272 3300006195 Bacteria 1167
2 Ga0065712_10090977 3300005290 Bacteria 2387
3 Ga0065712_10403481 3300005290 Unclassified 729
4 Ga0065712_10508583 3300005290 Bacteria 644
5 Ga0065715_10034102 3300005293 Unclassified 1672
6 Ga0065715_10303407 3300005293 Bacteria 1036
7 Ga0065715_10582949 3300005293 Unclassified 719
8 Ga0065715_10725997 3300005293 Unclassified 641
9 Ga0065715_10820724 3300005293 Unclassified 601
10 Ga0070683_101269082 3300005329 Bacteria 708
11 Ga0070690_100040231 3300005330 Bacteria 2956
12 Ga0070670_102240676 3300005331 Unclassified 503
13 Ga0068869_100527809 3300005334 Unclassified 989
14 Ga0070666_10007954 3300005335 Bacteria 6555
15 Ga0070666_10049802 3300005335 Bacteria 2817
16 Ga0070666_10170169 3300005335 Unclassified 1526
17 Ga0070682_100090493 3300005337 Unclassified 2001
18 Ga0070682_100096673 3300005337 Bacteria 1942
19 Ga0068868_100032766 3300005338 Bacteria 3998
20 Ga0068868_100074344 3300005338 Bacteria 2714
21 Ga0070660_100466116 3300005339 Bacteria 1049
22 Ga0070660_100489913 3300005339 Unclassified 1022
23 Ga0070689_100155852 3300005340 Unclassified 1844
24 Ga0070689_100275619 3300005340 Unclassified 1394
25 Ga0070687_100093876 3300005343 Unclassified 1665
26 Ga0070687_100180624 3300005343 Bacteria 1263
27 Ga0070687_100778536 3300005343 Unclassified 676
28 Ga0070668_100093426 3300005347 Bacteria 2374
29 Ga0070669_100005895 3300005353 Bacteria 8840
30 Ga0070669_100288819 3300005353 Bacteria 1316
31 Ga0070669_100368129 3300005353 Unclassified 1170
32 Ga0070675_100029644 3300005354 Bacteria 4414
33 Ga0070671_100009313 3300005355 Bacteria 7886
34 Ga0070671_100807851 3300005355 Bacteria 817
35 Ga0070671_101243664 3300005355 Bacteria 656
36 Ga0070674_100299947 3300005356 Bacteria 1280
37 Ga0070674_100564708 3300005356 Bacteria 957
38 Ga0070674_101409716 3300005356 Unclassified 624
39 Ga0070673_100111220 3300005364 Bacteria 2272
40 Ga0070673_100174752 3300005364 Unclassified 1835
41 Ga0070673_100276744 3300005364 Bacteria 1471
42 Ga0070673_100408666 3300005364 Bacteria 1215
43 Ga0070673_101041542 3300005364 Bacteria 763
44 Ga0070688_100194256 3300005365 Unclassified 1416
45 Ga0070659_100026453 3300005366 Bacteria 4466
46 Ga0070659_100147834 3300005366 Bacteria 1915
47 Ga0070667_100010894 3300005367 Bacteria 7521
48 Ga0070713_100069492 3300005436 Unclassified 2970
49 Ga0070701_10050679 3300005438 Bacteria 2151
50 Ga0070705_100086816 3300005440 Bacteria 1938
51 Ga0070705_101285248 3300005440 Unclassified 606
52 Ga0070700_100005286 3300005441 Bacteria 6828
53 Ga0070700_100389928 3300005441 Unclassified 1044
54 Ga0070694_100033353 3300005444 Bacteria 3388
55 Ga0070678_100198704 3300005456 Bacteria 1653
56 Ga0070678_100676380 3300005456 Bacteria 928
57 Ga0070662_100977995 3300005457 Unclassified 724
58 Ga0070662_101681360 3300005457 Unclassified 548
59 Ga0070681_10448568 3300005458 Bacteria 1202
60 Ga0068867_100013682 3300005459 Bacteria 5747
61 Ga0068867_100589189 3300005459 Unclassified 968
62 Ga0070685_10092043 3300005466 Unclassified 1837
63 Ga0070685_10339219 3300005466 Unclassified 1024
64 Ga0070706_100860455 3300005467 Bacteria 838
65 Ga0070698_100224261 3300005471 Bacteria 1813
66 Ga0070698_100801281 3300005471 Unclassified 886
67 Ga0070699_100090058 3300005518 Bacteria 2681
68 Ga0070679_100159555 3300005530 Unclassified 2230
69 Ga0070679_100706121 3300005530 Unclassified 951
70 Ga0070697_101512393 3300005536 Bacteria 600
71 Ga0068853_100277957 3300005539 Unclassified 1543
72 Ga0068853_100307758 3300005539 Bacteria 1466
73 Ga0068853_100732988 3300005539 Unclassified 944
74 Ga0070672_100006559 3300005543 Bacteria 7828
75 Ga0070672_100132367 3300005543 Bacteria 2051
76 Ga0070672_101135441 3300005543 Unclassified 695
77 Ga0070686_100002486 3300005544 Bacteria 10150
78 Ga0070686_100104153 3300005544 Bacteria 1922
79 Ga0070686_100209190 3300005544 Unclassified 1403
80 Ga0070686_100212672 3300005544 Bacteria 1393
81 Ga0070686_100319708 3300005544 Unclassified 1157
82 Ga0070695_100009755 3300005545 Bacteria 5718
83 Ga0070695_100533693 3300005545 Unclassified 912
84 Ga0070695_101466050 3300005545 Unclassified 567
85 Ga0070696_100024139 3300005546 Bacteria 4132
86 Ga0070693_100129968 3300005547 Bacteria 1573
87 Ga0070693_100311840 3300005547 Unclassified 1064
88 Ga0070665_100015165 3300005548 Bacteria 7737
89 Ga0070665_101459750 3300005548 Unclassified 693
90 Ga0070704_100008799 3300005549 Bacteria 6074
91 Ga0068855_100946955 3300005563 Bacteria 907
92 Ga0068857_101047227 3300005577 Unclassified 786
93 Ga0068854_100004254 3300005578 Bacteria 9013
94 Ga0068854_100032945 3300005578 Unclassified 3609
95 Ga0068852_100059295 3300005616 Unclassified 3319
96 Ga0068852_100192278 3300005616 Bacteria 1926
97 Ga0068859_100121473 3300005617 Unclassified 2679
98 Ga0068859_100655185 3300005617 Unclassified 1142
99 Ga0068859_101026470 3300005617 Bacteria 906
100 Ga0068864_100006759 3300005618 Bacteria 9393
101 Ga0068866_10178206 3300005718 Unclassified 1253
102 Ga0068861_100027291 3300005719 Bacteria 4158
103 Ga0068861_100360134 3300005719 Bacteria 1279
104 Ga0068861_100921832 3300005719 Unclassified 829
105 Ga0068863_100108599 3300005841 Unclassified 2640
106 Ga0068863_100467074 3300005841 Bacteria 1240
107 Ga0068863_101460873 3300005841 Unclassified 692
108 Ga0068858_100010010 3300005842 Bacteria 9006
109 Ga0068858_100106058 3300005842 Bacteria 2623
110 Ga0068858_100356949 3300005842 Bacteria 1400
111 Ga0068858_100694485 3300005842 Unclassified 990
112 Ga0068858_101164516 3300005842 Bacteria 757
113 Ga0068860_100020582 3300005843 Bacteria 6391
114 Ga0068860_100105687 3300005843 Unclassified 2688
115 Ga0068860_102584633 3300005843 Bacteria 527
116 Ga0068862_100067281 3300005844 Bacteria 3088
117 Ga0068862_100098320 3300005844 Bacteria 2556
118 Ga0081455_10053981 3300005937 Bacteria 3429
119 Ga0081455_10223463 3300005937 Bacteria 1394
120 Ga0070717_11484321 3300006028 Unclassified 615
121 Ga0075365_10008916 3300006038 Bacteria 5728
122 Ga0075365_10049958 3300006038 Bacteria 2757
123 Ga0075368_10006981 3300006042 Bacteria 3971
124 Ga0075368_10049884 3300006042 Bacteria 1661
125 Ga0075363_100031091 3300006048 Bacteria 2766
126 Ga0075363_100084373 3300006048 Bacteria 1742
127 Ga0075364_10009586 3300006051 Bacteria 5815
128 Ga0075364_10026938 3300006051 Bacteria 3669
129 Ga0075364_10198149 3300006051 Bacteria 1361
130 Ga0075364_10230762 3300006051 Archaea 1257
131 Ga0075364_10427108 3300006051 Bacteria 905
132 Ga0075367_10009656 3300006178 Bacteria 5051
133 Ga0075367_10029815 3300006178 Bacteria 3124
134 Ga0075366_10003651 3300006195 Bacteria 8158
135 Ga0075366_10088603 3300006195 Bacteria 1853
136 Ga0075366_10345797 3300006195 Unclassified 912
137 Ga0097621_100078460 3300006237 Bacteria 2743
138 Ga0075370_10017088 3300006353 Bacteria 3915
139 Ga0075370_10421631 3300006353 Bacteria 802
140 Ga0068871_100012578 3300006358 Bacteria 6248
141 Ga0075428_100149292 3300006844 Unclassified 2539
142 Ga0075428_100497400 3300006844 Unclassified 1305
143 Ga0075430_100003066 3300006846 Bacteria 13964
144 Ga0075430_100017767 3300006846 Bacteria 6055
145 Ga0075430_100297930 3300006846 Bacteria 1334
146 Ga0075431_100019158 3300006847 Bacteria 6974
147 Ga0075431_100138476 3300006847 Unclassified 2509
148 Ga0075431_101397743 3300006847 Unclassified 659
149 Ga0075433_10125161 3300006852 Bacteria 2283
150 Ga0075433_10349551 3300006852 Unclassified 1307
151 Ga0075434_100021551 3300006871 Bacteria 6264
152 Ga0075434_100713499 3300006871 Bacteria 1020
153 Ga0075429_100120726 3300006880 Unclassified 2291
154 Ga0068865_100145955 3300006881 Bacteria 1789
155 Ga0097620_100121477 3300006931 Unclassified 2679
156 Ga0097620_100655251 3300006931 Unclassified 1142
157 Ga0097620_101026497 3300006931 Bacteria 906
158 Ga0105240_10056018 3300009093 Unclassified 4935
159 Ga0105240_10343518 3300009093 Unclassified 1695
160 Ga0111539_10045853 3300009094 Bacteria 5231
161 Ga0111539_10155960 3300009094 Bacteria 2672
162 Ga0111539_10237550 3300009094 Bacteria 2121
163 Ga0111539_11029477 3300009094 Unclassified 957
164 Ga0111539_12307436 3300009094 Bacteria 624
165 Ga0105247_10002709 3300009101 Bacteria 11878
166 Ga0114129_10000400 3300009147 Bacteria 50737
167 Ga0114129_10005089 3300009147 Bacteria 18513
168 Ga0114129_10015154 3300009147 Bacteria 10974
169 Ga0114129_10038750 3300009147 Bacteria 6719
170 Ga0114129_10184686 3300009147 Unclassified 2835
171 Ga0114129_10225473 3300009147 Unclassified 2526
172 Ga0114129_10301293 3300009147 Bacteria 2136
173 Ga0114129_11002976 3300009147 Bacteria 1051
174 Ga0114129_11793983 3300009147 Unclassified 746
175 Ga0114129_11977725 3300009147 Unclassified 705
176 Ga0105243_10079808 3300009148 Bacteria 2667
177 Ga0105243_10152988 3300009148 Bacteria 1981
178 Ga0105241_10083107 3300009174 Unclassified 2512
179 Ga0105241_10275664 3300009174 Bacteria 1434
180 Ga0105248_10003179 3300009177 Bacteria 18204
181 Ga0105248_10088268 3300009177 Bacteria 3490
182 Ga0105248_10240957 3300009177 Unclassified 2036
183 Ga0105248_10265996 3300009177 Unclassified 1930
184 Ga0105248_10889938 3300009177 Bacteria 1005
185 Ga0105248_11393759 3300009177 Bacteria 793
186 Ga0105248_13095532 3300009177 Bacteria 529
187 Ga0105238_10312496 3300009551 Bacteria 1556
188 Ga0105238_12478532 3300009551 Unclassified 555
189 Ga0105249_10468670 3300009553 Unclassified 1301
190 Ga0105239_11267381 3300010375 Bacteria 850
191 Ga0105246_10099272 3300011119 Bacteria 2116
192 Ga0105246_11218474 3300011119 Unclassified 694
193 Ga0157371_10807077 3300013102 Unclassified 707
194 Ga0157370_10283799 3300013104 Bacteria 1530
195 Ga0157369_10251120 3300013105 Bacteria 1846
196 Ga0157378_10109121 3300013297 Bacteria 2535
197 Ga0163162_10131578 3300013306 Unclassified 2610
198 Ga0163162_10203573 3300013306 Bacteria 2108
199 Ga0163162_10865409 3300013306 Bacteria 1018
200 Ga0157375_10023141 3300013308 Bacteria 5728
201 Ga0157375_10069692 3300013308 Bacteria 3524
202 Ga0157375_10096776 3300013308 Bacteria 3025
203 Ga0157375_10291186 3300013308 Unclassified 1796
204 Ga0163163_10003494 3300014325 Bacteria 13340
205 Ga0163163_10339814 3300014325 Unclassified 1556
206 Ga0163163_13008583 3300014325 Unclassified 526
207 Ga0157380_10061764 3300014326 Bacteria 2999
208 Ga0157380_10172429 3300014326 Bacteria 1892
209 Ga0157380_10391057 3300014326 Bacteria 1316
210 Ga0157380_11319688 3300014326 Unclassified 769
211 Ga0157380_11556483 3300014326 Unclassified 716
212 Ga0157377_10227027 3300014745 Unclassified 1198
213 Ga0157377_10251614 3300014745 Unclassified 1145
214 Ga0157377_10308609 3300014745 Unclassified 1047
215 Ga0157379_10012221 3300014968 Bacteria 7500
216 Ga0157376_10023104 3300014969 Bacteria 4861
217 Ga0157376_10547544 3300014969 Unclassified 1145
218 Ga0207642_10084896 3300025899 Unclassified 1548
219 Ga0207642_10183899 3300025899 Unclassified 1141
220 Ga0207710_10006230 3300025900 Bacteria 5100
221 Ga0207680_10028684 3300025903 Unclassified 3117
222 Ga0207680_10281446 3300025903 Unclassified 1155
223 Ga0207680_10363670 3300025903 Bacteria 1018
224 Ga0207645_10002542 3300025907 Bacteria 14280
225 Ga0207645_10055549 3300025907 Bacteria 2528
226 Ga0207654_10078566 3300025911 Unclassified 1980
227 Ga0207707_10958002 3300025912 Unclassified 704
228 Ga0207662_10226935 3300025918 Bacteria 1218
229 Ga0207657_10384017 3300025919 Bacteria 1106
230 Ga0207657_10743319 3300025919 Unclassified 760
231 Ga0207652_10393703 3300025921 Bacteria 1250
232 Ga0207652_10665829 3300025921 Unclassified 930
233 Ga0207681_10030038 3300025923 Bacteria 3539
234 Ga0207681_10093978 3300025923 Bacteria 2148
235 Ga0207650_10287617 3300025925 Bacteria 1340
236 Ga0207659_10067411 3300025926 Bacteria 2599
237 Ga0207687_10027291 3300025927 Unclassified 3830
238 Ga0207644_10948209 3300025931 Bacteria 722
239 Ga0207644_11068632 3300025931 Unclassified 678
240 Ga0207690_10025787 3300025932 Bacteria 3696
241 Ga0207690_10119521 3300025932 Bacteria 1912
242 Ga0207690_10567672 3300025932 Bacteria 924
243 Ga0207670_10771004 3300025936 Bacteria 800
244 Ga0207670_11716072 3300025936 Unclassified 534
245 Ga0207669_10196652 3300025937 Bacteria 1460
246 Ga0207704_10358329 3300025938 Bacteria 1138
247 Ga0207691_10173912 3300025940 Bacteria 1884
248 Ga0207691_10968115 3300025940 Unclassified 711
249 Ga0207711_10011246 3300025941 Bacteria 7436
250 Ga0207711_10315542 3300025941 Bacteria 1444
251 Ga0207711_10525270 3300025941 Bacteria 1104
252 Ga0207679_10656670 3300025945 Unclassified 949
253 Ga0207651_10499020 3300025960 Unclassified 1052
254 Ga0207651_11059026 3300025960 Bacteria 726
255 Ga0207668_10037025 3300025972 Bacteria 3262
256 Ga0207668_10111461 3300025972 Bacteria 2054
257 Ga0207640_10037118 3300025981 Unclassified 3063
258 Ga0207640_10113328 3300025981 Bacteria 1927
259 Ga0207677_10159618 3300026023 Bacteria 1750
260 Ga0207677_10784234 3300026023 Bacteria 852
261 Ga0207703_10154110 3300026035 Bacteria 2006
262 Ga0207703_10401320 3300026035 Unclassified 1272
263 Ga0207639_10123801 3300026041 Unclassified 2129
264 Ga0207708_10006182 3300026075 Bacteria 8876
265 Ga0207708_10009057 3300026075 Bacteria 7364
266 Ga0207641_10023472 3300026088 Bacteria 5082
267 Ga0207641_10174992 3300026088 Unclassified 1962
268 Ga0207648_10015997 3300026089 Bacteria 6874
269 Ga0207648_10048983 3300026089 Unclassified 3699
270 Ga0207648_10631737 3300026089 Bacteria 989
271 Ga0207648_10864389 3300026089 Unclassified 844
272 Ga0207676_10009672 3300026095 Bacteria 6857
273 Ga0207675_100019974 3300026118 Bacteria 6251
274 Ga0207675_100628079 3300026118 Bacteria 1079
275 Ga0268266_10224112 3300028379 Bacteria 1729
276 Ga0268265_10040039 3300028380 Bacteria 3458
277 Ga0268264_10121030 3300028381 Bacteria 2306
278 Ga0268264_10134196 3300028381 Bacteria 2199
279 Ga0268264_10366318 3300028381 Bacteria 1376
280 Ga0268264_10514597 3300028381 Unclassified 1169
281 Ga0307408_100060155 3300031548 Unclassified 2768
282 Ga0307408_100062015 3300031548 Bacteria 2731
283 Ga0307408_100065774 3300031548 Bacteria 2660
284 Ga0307408_100073601 3300031548 Bacteria 2533
285 Ga0307408_100745353 3300031548 Bacteria 884
286 Ga0307408_101382982 3300031548 Bacteria 662
287 Ga0307405_10394863 3300031731 Unclassified 1081
288 Ga0307413_10549366 3300031824 Bacteria 937
289 Ga0307410_10089345 3300031852 Unclassified 2183
290 Ga0307410_11090676 3300031852 Unclassified 692
291 Ga0307406_10414140 3300031901 Unclassified 1072
292 Ga0307412_10024046 3300031911 Bacteria 3757
293 Ga0307412_10176906 3300031911 Unclassified 1601
294 Ga0307409_100251803 3300031995 Bacteria 1615
295 Ga0307409_100567970 3300031995 Bacteria 1116
296 Ga0307416_100003211 3300032002 Bacteria 9580
297 Ga0307414_10838298 3300032004 Bacteria 840
298 Ga0307411_10219724 3300032005 Bacteria 1473
299 Ga0307411_10806446 3300032005 Bacteria 827
300 Ga0307415_100174487 3300032126 Unclassified 1680
301 Ga0373954_0458235 3300035118 Bacteria 631
302 Ga0373957_0377231 3300035120 Unclassified 608
303 Ga0373943_0131443 3300035170 Unclassified 1340
304 Ga0373955_0604764 3300035172 Bacteria 671
305 Ga0373931_0593640 3300035691 Bacteria 723
306 Ga0373947_1065791 3300035725 Bacteria 551
307 Ga0373937_0170190 3300036401 Unclassified 2044
308 Ga0395905_1100014 3300037471 Bacteria 698
309 Ga0436365_1921691 3300039437 Bacteria 2001
310 Ga0439461_0075616 3300041410 Bacteria 787
311 Ga0439433_0035388 3300041999 Unclassified 1151
312 Ga0439445_0018196 3300042004 Bacteria 1742
313 Ga0439445_0186274 3300042004 Bacteria 610
314 Ga0439446_0017092 3300042156 Bacteria 2025
315 Ga0439446_0020012 3300042156 Unclassified 1883
316 Ga0439446_0034004 3300042156 Unclassified 1482
317 Ga0439460_0097918 3300042461 Bacteria 939
318 Ga0451576_2033980 3300045051 Unclassified 591
319 Ga0495582_0280258 3300046473 Unclassified 957
320 Ga0495667_0227988 3300046559 Bacteria 1188
321 Ga0495634_0271098 3300046642 Unclassified 1033
322 Ga0495635_0219144 3300046663 Unclassified 1287
323 Ga0495658_0031944 3300046683 Bacteria 2872
324 Ga0495658_0543196 3300046683 Bacteria 744
325 Ga0496102_0233527 3300048905 Unclassified 1734
326 Ga0496102_1823538 3300048905 Unclassified 525
327 Ga0496104_0142143 3300048907 Bacteria 2306
328 Ga0496104_1064522 3300048907 Bacteria 712
329 Ga0496105_1354344 3300048908 Bacteria 517
330 Ga0496107_0087042 3300048910 Unclassified 2281
331 Ga0496108_0016755 3300048911 Bacteria 5987
332 Ga0496108_0029582 3300048911 Bacteria 4538
333 Ga0496109_0229534 3300048912 Bacteria 1746
334 Ga0496109_0232151 3300048912 Bacteria 1736
335 Ga0496109_0274641 3300048912 Bacteria 1588
336 Ga0496110_1476354 3300048913 Unclassified 590
337 Ga0496112_0001090 3300048915 Bacteria 20076
338 Ga0496112_0059359 3300048915 Bacteria 3769
339 Ga0496112_0622632 3300048915 Bacteria 1010
340 Ga0496113_0159479 3300048916 Bacteria 1783
341 Ga0496113_0188621 3300048916 Unclassified 1636
342 Ga0496114_1241465 3300048917 Bacteria 632
343 Ga0501034_0307717 3300049571 Bacteria 1520
344 Ga0501036_0037688 3300049572 Bacteria 4090
345 Ga0501048_0635742 3300049582 Unclassified 766
346 Ga0501067_0064598 3300049583 Bacteria 2026
347 Ga0501067_0202685 3300049583 Bacteria 1105
348 Ga0501067_0598011 3300049583 Unclassified 619
349 Ga0501070_0372823 3300049586 Bacteria 1157
350 Ga0501071_0519440 3300049587 Unclassified 914
351 Ga0501072_0404745 3300049588 Bacteria 1082
352 Ga0501073_1177937 3300049589 Unclassified 526
353 Ga0501076_0536088 3300049592 Bacteria 965
354 Ga0501206_013803 3300049653 Bacteria 1106
355 Ga0501235_014487 3300049669 Bacteria 1738
356 Ga0501221_051297 3300049704 Bacteria 930
357 Ga0501080_0079611 3300049742 Bacteria 3046
358 Ga0501080_1206492 3300049742 Bacteria 650
359 Ga0501080_1296197 3300049742 Unclassified 624
360 Ga0501268_006190 3300049765 Bacteria 1747
361 nmdc:mga03n38_531394_c1 3300050490 Bacteria 663
362 nmdc:mga03n38_63120_c1 3300050490 Bacteria 1692
363 nmdc:mga00v17_243604_c1 3300050491 Bacteria 1166
364 nmdc:mga00v17_49206_c1 3300050491 Unclassified 2556
365 nmdc:mga0yw44_3253_c1 3300050492 Bacteria 7161
366 nmdc:mga0k408_159089_c1 3300050493 Unclassified 1345
367 nmdc:mga0k408_246030_c1 3300050493 Bacteria 1068
368 nmdc:mga0k408_98585_c1 3300050493 Bacteria 1722
369 nmdc:mga06z11_329706_c1 3300050494 Unclassified 911
370 nmdc:mga04h51_498864_c1 3300050495 Bacteria 520
371 nmdc:mga05p37_201736_c1 3300050507 Bacteria 2408
372 nmdc:mga05p37_237048_c1 3300050507 Bacteria 2195
373 nmdc:mga05p37_47449_c1 3300050507 Bacteria 5282
374 nmdc:mga05p37_54876_c1 3300050507 Bacteria 4901
375 nmdc:mga09592_14199_c1 3300050508 Bacteria 6499
376 nmdc:mga0qj67_104678_c1 3300050509 Bacteria 2283
377 nmdc:mga0qj67_214509_c1 3300050509 Bacteria 1563
378 nmdc:mga0qj67_369842_c1 3300050509 Bacteria 1158
379 nmdc:mga0qj67_74003_c1 3300050509 Bacteria 2722
380 nmdc:mga06r32_113010_c1 3300050510 Unclassified 2673
381 nmdc:mga06r32_121742_c1 3300050510 Bacteria 2574
382 nmdc:mga06r32_302217_c1 3300050510 Bacteria 1586
383 nmdc:mga06r32_58227_c1 3300050510 Bacteria 3040
384 nmdc:mga08y16_1465994_c1 3300050511 Bacteria 644
385 nmdc:mga08y16_151909_c1 3300050511 Bacteria 2406
386 nmdc:mga0n895_1152313_c1 3300050512 Bacteria 751
387 nmdc:mga0rr50_8046_c1 3300050513 Bacteria 6540
388 nmdc:mga0a205_393839_c1 3300050515 Bacteria 1249
389 nmdc:mga0a205_84815_c1 3300050515 Unclassified 3060
390 Ga0500628_119490 3300053129 Unclassified 714
391 Ga0500645_024583 3300053730 Bacteria 1841
392 Ga0501084_0696977 3300054114 Bacteria 856
393 Ga0590071_161476 3300059421 Unclassified 583
394 Ga0590074_072304 3300059423 Unclassified 651
395 Ga0590075_093934 3300059424 Bacteria 779
396 Ga0590077_110835 3300059426 Bacteria 645
397 Ga0501082_0056911 3300060353 Bacteria 3369
398 Ga0501082_1674961 3300060353 Bacteria 555
399 Ga0075366_10216272
400 Ga0065712_10090977
401 Ga0065712_10403481
402 Ga0065712_10508583
403 Ga0065715_10034102
404 Ga0065715_10303407
405 Ga0065715_10582949
406 Ga0065715_10725997
407 Ga0065715_10820724
408 Ga0070683_101269082
409 Ga0070690_100040231
410 Ga0070670_102240676
411 Ga0068869_100527809
412 Ga0070666_10007954
413 Ga0070666_10049802
414 Ga0070666_10170169
415 Ga0070682_100090493
416 Ga0070682_100096673
417 Ga0068868_100032766
418 Ga0068868_100074344
419 Ga0070660_100466116
420 Ga0070660_100489913
421 Ga0070689_100155852
422 Ga0070689_100275619
423 Ga0070687_100093876
424 Ga0070687_100180624
425 Ga0070687_100778536
426 Ga0070668_100093426
427 Ga0070669_100005895
428 Ga0070669_100288819
429 Ga0070669_100368129
430 Ga0070675_100029644
431 Ga0070671_100009313
432 Ga0070671_100807851
433 Ga0070671_101243664
434 Ga0070674_100299947
435 Ga0070674_100564708
436 Ga0070674_101409716
437 Ga0070673_100111220
438 Ga0070673_100174752
439 Ga0070673_100276744
440 Ga0070673_100408666
441 Ga0070673_101041542
442 Ga0070688_100194256
443 Ga0070659_100026453
444 Ga0070659_100147834
445 Ga0070667_100010894
446 Ga0070713_100069492
447 Ga0070701_10050679
448 Ga0070705_100086816
449 Ga0070705_101285248
450 Ga0070700_100005286
451 Ga0070700_100389928
452 Ga0070694_100033353
453 Ga0070678_100198704
454 Ga0070678_100676380
455 Ga0070662_100977995
456 Ga0070662_101681360
457 Ga0070681_10448568
458 Ga0068867_100013682
459 Ga0068867_100589189
460 Ga0070685_10092043
461 Ga0070685_10339219
462 Ga0070706_100860455
463 Ga0070698_100224261
464 Ga0070698_100801281
465 Ga0070699_100090058
466 Ga0070679_100159555
467 Ga0070679_100706121
468 Ga0070697_101512393
469 Ga0068853_100277957
470 Ga0068853_100307758
471 Ga0068853_100732988
472 Ga0070672_100006559
473 Ga0070672_100132367
474 Ga0070672_101135441
475 Ga0070686_100002486
476 Ga0070686_100104153
477 Ga0070686_100209190
478 Ga0070686_100212672
479 Ga0070686_100319708
480 Ga0070695_100009755
481 Ga0070695_100533693
482 Ga0070695_101466050
483 Ga0070696_100024139
484 Ga0070693_100129968
485 Ga0070693_100311840
486 Ga0070665_100015165
487 Ga0070665_101459750
488 Ga0070704_100008799
489 Ga0068855_100946955
490 Ga0068857_101047227
491 Ga0068854_100004254
492 Ga0068854_100032945
493 Ga0068852_100059295
494 Ga0068852_100192278
495 Ga0068859_100121473
496 Ga0068859_100655185
497 Ga0068859_101026470
498 Ga0068864_100006759
499 Ga0068866_10178206
500 Ga0068861_100027291
501 Ga0068861_100360134
502 Ga0068861_100921832
503 Ga0068863_100108599
504 Ga0068863_100467074
505 Ga0068863_101460873
506 Ga0068858_100010010
507 Ga0068858_100106058
508 Ga0068858_100356949
509 Ga0068858_100694485
510 Ga0068858_101164516
511 Ga0068860_100020582
512 Ga0068860_100105687
513 Ga0068860_102584633
514 Ga0068862_100067281
515 Ga0068862_100098320
516 Ga0081455_10053981
517 Ga0081455_10223463
518 Ga0070717_11484321
519 Ga0075365_10008916
520 Ga0075365_10049958
521 Ga0075368_10006981
522 Ga0075368_10049884
523 Ga0075363_100031091
524 Ga0075363_100084373
525 Ga0075364_10009586
526 Ga0075364_10026938
527 Ga0075364_10198149
528 Ga0075364_10230762
529 Ga0075364_10427108
530 Ga0075367_10009656
531 Ga0075367_10029815
532 Ga0075366_10003651
533 Ga0075366_10088603
534 Ga0075366_10345797
535 Ga0097621_100078460
536 Ga0075370_10017088
537 Ga0075370_10421631
538 Ga0068871_100012578
539 Ga0075428_100149292
540 Ga0075428_100497400
541 Ga0075430_100003066
542 Ga0075430_100017767
543 Ga0075430_100297930
544 Ga0075431_100019158
545 Ga0075431_100138476
546 Ga0075431_101397743
547 Ga0075433_10125161
548 Ga0075433_10349551
549 Ga0075434_100021551
550 Ga0075434_100713499
551 Ga0075429_100120726
552 Ga0068865_100145955
553 Ga0097620_100121477
554 Ga0097620_100655251
555 Ga0097620_101026497
556 Ga0105240_10056018
557 Ga0105240_10343518
558 Ga0111539_10045853
559 Ga0111539_10155960
560 Ga0111539_10237550
561 Ga0111539_11029477
562 Ga0111539_12307436
563 Ga0105247_10002709
564 Ga0114129_10000400
565 Ga0114129_10005089
566 Ga0114129_10015154
567 Ga0114129_10038750
568 Ga0114129_10184686
569 Ga0114129_10225473
570 Ga0114129_10301293
571 Ga0114129_11002976
572 Ga0114129_11793983
573 Ga0114129_11977725
574 Ga0105243_10079808
575 Ga0105243_10152988
576 Ga0105241_10083107
577 Ga0105241_10275664
578 Ga0105248_10003179
579 Ga0105248_10088268
580 Ga0105248_10240957
581 Ga0105248_10265996
582 Ga0105248_10889938
583 Ga0105248_11393759
584 Ga0105248_13095532
585 Ga0105238_10312496
586 Ga0105238_12478532
587 Ga0105249_10468670
588 Ga0105239_11267381
589 Ga0105246_10099272
590 Ga0105246_11218474
591 Ga0157371_10807077
592 Ga0157370_10283799
593 Ga0157369_10251120
594 Ga0157378_10109121
595 Ga0163162_10131578
596 Ga0163162_10203573
597 Ga0163162_10865409
598 Ga0157375_10023141
599 Ga0157375_10069692
600 Ga0157375_10096776
601 Ga0157375_10291186
602 Ga0163163_10003494
603 Ga0163163_10339814
604 Ga0163163_13008583
605 Ga0157380_10061764
606 Ga0157380_10172429
607 Ga0157380_10391057
608 Ga0157380_11319688
609 Ga0157380_11556483
610 Ga0157377_10227027
611 Ga0157377_10251614
612 Ga0157377_10308609
613 Ga0157379_10012221
614 Ga0157376_10023104
615 Ga0157376_10547544
616 Ga0207642_10084896
617 Ga0207642_10183899
618 Ga0207710_10006230
619 Ga0207680_10028684
620 Ga0207680_10281446
621 Ga0207680_10363670
622 Ga0207645_10002542
623 Ga0207645_10055549
624 Ga0207654_10078566
625 Ga0207707_10958002
626 Ga0207662_10226935
627 Ga0207657_10384017
628 Ga0207657_10743319
629 Ga0207652_10393703
630 Ga0207652_10665829
631 Ga0207681_10030038
632 Ga0207681_10093978
633 Ga0207650_10287617
634 Ga0207659_10067411
635 Ga0207687_10027291
636 Ga0207644_10948209
637 Ga0207644_11068632
638 Ga0207690_10025787
639 Ga0207690_10119521
640 Ga0207690_10567672
641 Ga0207670_10771004
642 Ga0207670_11716072
643 Ga0207669_10196652
644 Ga0207704_10358329
645 Ga0207691_10173912
646 Ga0207691_10968115
647 Ga0207711_10011246
648 Ga0207711_10315542
649 Ga0207711_10525270
650 Ga0207679_10656670
651 Ga0207651_10499020
652 Ga0207651_11059026
653 Ga0207668_10037025
654 Ga0207668_10111461
655 Ga0207640_10037118
656 Ga0207640_10113328
657 Ga0207677_10159618
658 Ga0207677_10784234
659 Ga0207703_10154110
660 Ga0207703_10401320
661 Ga0207639_10123801
662 Ga0207708_10006182
663 Ga0207708_10009057
664 Ga0207641_10023472
665 Ga0207641_10174992
666 Ga0207648_10015997
667 Ga0207648_10048983
668 Ga0207648_10631737
669 Ga0207648_10864389
670 Ga0207676_10009672
671 Ga0207675_100019974
672 Ga0207675_100628079
673 Ga0268266_10224112
674 Ga0268265_10040039
675 Ga0268264_10121030
676 Ga0268264_10134196
677 Ga0268264_10366318
678 Ga0268264_10514597
679 Ga0307408_100060155
680 Ga0307408_100062015
681 Ga0307408_100065774
682 Ga0307408_100073601
683 Ga0307408_100745353
684 Ga0307408_101382982
685 Ga0307405_10394863
686 Ga0307413_10549366
687 Ga0307410_10089345
688 Ga0307410_11090676
689 Ga0307406_10414140
690 Ga0307412_10024046
691 Ga0307412_10176906
692 Ga0307409_100251803
693 Ga0307409_100567970
694 Ga0307416_100003211
695 Ga0307414_10838298
696 Ga0307411_10219724
697 Ga0307411_10806446
698 Ga0307415_100174487
699 Ga0373954_0458235
700 Ga0373957_0377231
701 Ga0373943_0131443
702 Ga0373955_0604764
703 Ga0373931_0593640
704 Ga0373947_1065791
705 Ga0373937_0170190
706 Ga0395905_1100014
707 Ga0436365_1921691
708 Ga0439461_0075616
709 Ga0439433_0035388
710 Ga0439445_0018196
711 Ga0439445_0186274
712 Ga0439446_0017092
713 Ga0439446_0020012
714 Ga0439446_0034004
715 Ga0439460_0097918
716 Ga0451576_2033980
717 Ga0495582_0280258
718 Ga0495667_0227988
719 Ga0495634_0271098
720 Ga0495635_0219144
721 Ga0495658_0031944
722 Ga0495658_0543196
723 Ga0496102_0233527
724 Ga0496102_1823538
725 Ga0496104_0142143
726 Ga0496104_1064522
727 Ga0496105_1354344
728 Ga0496107_0087042
729 Ga0496108_0016755
730 Ga0496108_0029582
731 Ga0496109_0229534
732 Ga0496109_0232151
733 Ga0496109_0274641
734 Ga0496110_1476354
735 Ga0496112_0001090
736 Ga0496112_0059359
737 Ga0496112_0622632
738 Ga0496113_0159479
739 Ga0496113_0188621
740 Ga0496114_1241465
741 Ga0501034_0307717
742 Ga0501036_0037688
743 Ga0501048_0635742
744 Ga0501067_0064598
745 Ga0501067_0202685
746 Ga0501067_0598011
747 Ga0501070_0372823
748 Ga0501071_0519440
749 Ga0501072_0404745
750 Ga0501073_1177937
751 Ga0501076_0536088
752 Ga0501206_013803
753 Ga0501235_014487
754 Ga0501221_051297
755 Ga0501080_0079611
756 Ga0501080_1206492
757 Ga0501080_1296197
758 Ga0501268_006190
759 nmdc:mga03n38_531394_c1
760 nmdc:mga03n38_63120_c1
761 nmdc:mga00v17_243604_c1
762 nmdc:mga00v17_49206_c1
763 nmdc:mga0yw44_3253_c1
764 nmdc:mga0k408_159089_c1
765 nmdc:mga0k408_246030_c1
766 nmdc:mga0k408_98585_c1
767 nmdc:mga06z11_329706_c1
768 nmdc:mga04h51_498864_c1
769 nmdc:mga05p37_201736_c1
770 nmdc:mga05p37_237048_c1
771 nmdc:mga05p37_47449_c1
772 nmdc:mga05p37_54876_c1
773 nmdc:mga09592_14199_c1
774 nmdc:mga0qj67_104678_c1
775 nmdc:mga0qj67_214509_c1
776 nmdc:mga0qj67_369842_c1
777 nmdc:mga0qj67_74003_c1
778 nmdc:mga06r32_113010_c1
779 nmdc:mga06r32_121742_c1
780 nmdc:mga06r32_302217_c1
781 nmdc:mga06r32_58227_c1
782 nmdc:mga08y16_1465994_c1
783 nmdc:mga08y16_151909_c1
784 nmdc:mga0n895_1152313_c1
785 nmdc:mga0rr50_8046_c1
786 nmdc:mga0a205_393839_c1
787 nmdc:mga0a205_84815_c1
788 Ga0500628_119490
789 Ga0500645_024583
790 Ga0501084_0696977
791 Ga0590071_161476
792 Ga0590074_072304
793 Ga0590075_093934
794 Ga0590077_110835
795 Ga0501082_0056911
796 Ga0501082_1674961

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

47

146

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.9309 2 133
1ml8-assembly1.cif.gz_A-2 structural genomics 0.9221 6 132
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.9042 2 133
1ml8-assembly1.cif.gz_A-2 structural genomics 0.8885 6 132
1lql-assembly4.cif.gz_G crystal structure of osmc like protein from mycoplasma pneumoniae 0.8572 1 132
ID Description Score Start End Superfamily
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9308 37 132 3.30.300.20
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.92 2 133 3.30.300.20
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8945 37 132 3.30.300.20
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8937 2 133 3.30.300.20
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8792 37 134 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A2V6SD09-F1-model_v4 OsmC family peroxiredoxin 0.9824 1 133
AF-A0A843RM36-F1-model_v4 OsmC family peroxiredoxin 0.9791 1 133
AF-A0A3E0NZ49-F1-model_v4 OsmC family peroxiredoxin 0.9754 6 134
AF-A0A143PH15-F1-model_v4 OsmC-like protein 0.9753 1 133
AF-A0A3N5ZJP6-F1-model_v4 OsmC family peroxiredoxin 0.9743 2 133

Map