F434008

General Info

Members Datasets Scaffolds Average Seq Length
398 216 796 182

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100782180|Ga0070716_1007821801
Length 204
Sequence MRRFIITGAPGAGKTAIIRQLELDGFSVVEEAATDVIAAAQARGIKEPWTHPSFIDAIASLQKERVIRASCQPDKVQFHDRSVVCSAALAVYLGYCFSTVLTAELERVKEEGIYDNRVFFIRNLGFVTPTSARRISFEETLRFERIHEETYHRLGFDLVWIEPGDLLTRVAKINRRSIHHLASRFQSETARMPCFVMARIPPLK

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
108 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
109 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
162 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
168 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.78
Rhizosphere 90.95
Stem 0
Stem Tuber 0
Unclassified 36.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_100782180 3300006173 Unclassified 737
2 rootH1_10210918 3300003323 Bacteria 1167
3 Ga0065712_10171734 3300005290 Unclassified 1240
4 Ga0065715_10290132 3300005293 Unclassified 1065
5 Ga0065707_10199719 3300005295 Bacteria 1317
6 Ga0070676_10121394 3300005328 Unclassified 1641
7 Ga0070683_100013870 3300005329 Bacteria 7038
8 Ga0070683_100019063 3300005329 Bacteria 6087
9 Ga0070683_100889932 3300005329 Unclassified 854
10 Ga0070677_10521260 3300005333 Bacteria 647
11 Ga0068869_100055469 3300005334 Unclassified 2888
12 Ga0068869_100111740 3300005334 Bacteria 2079
13 Ga0070666_10011775 3300005335 Bacteria 5499
14 Ga0070666_10115884 3300005335 Bacteria 1856
15 Ga0070666_10369116 3300005335 Bacteria 1029
16 Ga0070682_100811428 3300005337 Unclassified 761
17 Ga0068868_100002841 3300005338 Bacteria 11998
18 Ga0068868_100289760 3300005338 Unclassified 1388
19 Ga0068868_100763635 3300005338 Unclassified 869
20 Ga0070660_100092778 3300005339 Unclassified 2383
21 Ga0070660_100711496 3300005339 Bacteria 842
22 Ga0070689_100302849 3300005340 Bacteria 1331
23 Ga0070689_100402506 3300005340 Unclassified 1157
24 Ga0070691_10018052 3300005341 Unclassified 3249
25 Ga0070661_100035334 3300005344 Unclassified 3628
26 Ga0070661_100377661 3300005344 Bacteria 1117
27 Ga0070661_100842923 3300005344 Unclassified 754
28 Ga0070692_10127393 3300005345 Unclassified 1427
29 Ga0070668_100012225 3300005347 Bacteria 6395
30 Ga0070668_100014678 3300005347 Bacteria 5853
31 Ga0070669_100138901 3300005353 Unclassified 1871
32 Ga0070669_100249020 3300005353 Bacteria 1414
33 Ga0070671_100306650 3300005355 Unclassified 1352
34 Ga0070659_100071008 3300005366 Unclassified 2768
35 Ga0070667_100007558 3300005367 Bacteria 9015
36 Ga0070709_10053106 3300005434 Unclassified 2550
37 Ga0070714_100027938 3300005435 Bacteria 4675
38 Ga0070713_100601103 3300005436 Unclassified 1045
39 Ga0070705_100231737 3300005440 Bacteria 1285
40 Ga0070705_100532424 3300005440 Unclassified 897
41 Ga0070700_100301822 3300005441 Unclassified 1169
42 Ga0070694_100115950 3300005444 Unclassified 1915
43 Ga0070663_100058153 3300005455 Unclassified 2775
44 Ga0070663_100277361 3300005455 Bacteria 1335
45 Ga0070663_100464314 3300005455 Bacteria 1046
46 Ga0070678_100118782 3300005456 Bacteria 2081
47 Ga0070662_100072938 3300005457 Bacteria 2536
48 Ga0070662_100126043 3300005457 Unclassified 1968
49 Ga0070681_10279345 3300005458 Unclassified 1581
50 Ga0068867_100013267 3300005459 Bacteria 5837
51 Ga0068867_100816649 3300005459 Bacteria 833
52 Ga0068867_100821639 3300005459 Unclassified 830
53 Ga0070706_100041264 3300005467 Bacteria 4261
54 Ga0070707_100094424 3300005468 Bacteria 2896
55 Ga0070707_100165640 3300005468 Bacteria 2154
56 Ga0070698_100036994 3300005471 Bacteria 5034
57 Ga0070699_100007463 3300005518 Bacteria 9513
58 Ga0070679_100173550 3300005530 Unclassified 2128
59 Ga0070684_100068406 3300005535 Unclassified 3121
60 Ga0070684_100406867 3300005535 Unclassified 1255
61 Ga0070697_101038441 3300005536 Unclassified 729
62 Ga0068853_100030405 3300005539 Bacteria 4562
63 Ga0068853_100107356 3300005539 Unclassified 2475
64 Ga0068853_100221964 3300005539 Unclassified 1726
65 Ga0068853_100573470 3300005539 Unclassified 1070
66 Ga0070672_100290636 3300005543 Bacteria 1384
67 Ga0070686_100085541 3300005544 Unclassified 2098
68 Ga0070695_100026015 3300005545 Unclassified 3618
69 Ga0070695_100177740 3300005545 Unclassified 1506
70 Ga0070696_100051346 3300005546 Unclassified 2868
71 Ga0070693_100019119 3300005547 Bacteria 3587
72 Ga0070665_100065630 3300005548 Unclassified 3640
73 Ga0070665_100167611 3300005548 Unclassified 2198
74 Ga0068855_100006684 3300005563 Bacteria 14000
75 Ga0068855_100059129 3300005563 Bacteria 4486
76 Ga0068855_100194307 3300005563 Bacteria 2287
77 Ga0068855_100386239 3300005563 Unclassified 1536
78 Ga0070664_100100120 3300005564 Unclassified 2519
79 Ga0070664_100283146 3300005564 Bacteria 1495
80 Ga0068857_100021656 3300005577 Bacteria 5656
81 Ga0068857_100045470 3300005577 Bacteria 3895
82 Ga0068857_100127379 3300005577 Unclassified 2295
83 Ga0068854_100011596 3300005578 Bacteria 5745
84 Ga0068854_100050853 3300005578 Bacteria 2967
85 Ga0068856_100010906 3300005614 Bacteria 8820
86 Ga0068856_100077687 3300005614 Bacteria 3290
87 Ga0068852_100033720 3300005616 Unclassified 4254
88 Ga0068852_100135130 3300005616 Bacteria 2276
89 Ga0068852_100188407 3300005616 Bacteria 1945
90 Ga0068852_100383689 3300005616 Unclassified 1379
91 Ga0068852_100671762 3300005616 Unclassified 1045
92 Ga0068852_101248582 3300005616 Unclassified 764
93 Ga0068859_100008072 3300005617 Bacteria 10672
94 Ga0068864_100267794 3300005618 Unclassified 1591
95 Ga0068864_100611275 3300005618 Bacteria 1059
96 Ga0068864_101464321 3300005618 Unclassified 685
97 Ga0068866_10053422 3300005718 Unclassified 2065
98 Ga0068861_100777474 3300005719 Unclassified 897
99 Ga0068870_10141261 3300005840 Unclassified 1409
100 Ga0068863_100134865 3300005841 Bacteria 2359
101 Ga0068858_100017904 3300005842 Bacteria 6634
102 Ga0068860_100101383 3300005843 Bacteria 2747
103 Ga0068860_100227160 3300005843 Unclassified 1813
104 Ga0068860_100360570 3300005843 Bacteria 1432
105 Ga0068860_100814688 3300005843 Unclassified 947
106 Ga0068862_100099345 3300005844 Unclassified 2544
107 Ga0070716_100433882 3300006173 Bacteria 953
108 Ga0070712_100316901 3300006175 Bacteria 1267
109 Ga0097621_100089051 3300006237 Unclassified 2580
110 Ga0068871_100227752 3300006358 Unclassified 1617
111 Ga0068871_100298842 3300006358 Unclassified 1412
112 Ga0075428_100025128 3300006844 Bacteria 6590
113 Ga0075428_100813726 3300006844 Bacteria 993
114 Ga0075430_100011933 3300006846 Bacteria 7398
115 Ga0075431_100268500 3300006847 Bacteria 1730
116 Ga0075431_100312370 3300006847 Bacteria 1586
117 Ga0075434_100085207 3300006871 Bacteria 3159
118 Ga0075429_100037988 3300006880 Bacteria 4191
119 Ga0075429_100124029 3300006880 Bacteria 2258
120 Ga0075429_100757139 3300006880 Bacteria 851
121 Ga0068865_100323355 3300006881 Unclassified 1241
122 Ga0075436_100000126 3300006914 Bacteria 45406
123 Ga0097620_100008072 3300006931 Bacteria 10672
124 Ga0097620_100185810 3300006931 Bacteria 2162
125 Ga0075435_100000002 3300007076 Bacteria 140391
126 Ga0075435_100038118 3300007076 Bacteria 3831
127 Ga0105240_10003431 3300009093 Bacteria 24635
128 Ga0105240_10005473 3300009093 Bacteria 18926
129 Ga0105240_10055767 3300009093 Bacteria 4947
130 Ga0105240_10084928 3300009093 Bacteria 3880
131 Ga0105240_10123687 3300009093 Bacteria 3112
132 Ga0111539_10001651 3300009094 Bacteria 29787
133 Ga0111539_10018068 3300009094 Bacteria 8735
134 Ga0105245_10002580 3300009098 Bacteria 16317
135 Ga0105245_10046954 3300009098 Unclassified 3860
136 Ga0105247_10034991 3300009101 Bacteria 3059
137 Ga0105247_10058958 3300009101 Unclassified 2376
138 Ga0105247_10468100 3300009101 Unclassified 912
139 Ga0114129_10150036 3300009147 Bacteria 3190
140 Ga0114129_10361526 3300009147 Bacteria 1920
141 Ga0105243_10013953 3300009148 Bacteria 6079
142 Ga0105241_10001305 3300009174 Bacteria 18974
143 Ga0105241_10016098 3300009174 Bacteria 5481
144 Ga0105241_10034157 3300009174 Unclassified 3819
145 Ga0105241_10785711 3300009174 Unclassified 876
146 Ga0105242_10056276 3300009176 Bacteria 3218
147 Ga0105242_10058940 3300009176 Unclassified 3149
148 Ga0105242_10190276 3300009176 Bacteria 1816
149 Ga0105242_10559693 3300009176 Bacteria 1098
150 Ga0105248_10000255 3300009177 Bacteria 62145
151 Ga0105248_10021161 3300009177 Bacteria 7206
152 Ga0105248_10084597 3300009177 Unclassified 3568
153 Ga0105248_11752175 3300009177 Bacteria 704
154 Ga0105248_12098207 3300009177 Bacteria 643
155 Ga0105237_10002493 3300009545 Bacteria 22822
156 Ga0105237_10100148 3300009545 Unclassified 2889
157 Ga0105237_10119741 3300009545 Bacteria 2626
158 Ga0105237_10447712 3300009545 Unclassified 1297
159 Ga0105238_10000262 3300009551 Bacteria 58846
160 Ga0105238_10019865 3300009551 Bacteria 6838
161 Ga0105238_10039529 3300009551 Bacteria 4784
162 Ga0105238_10042067 3300009551 Bacteria 4627
163 Ga0105238_10049641 3300009551 Bacteria 4225
164 Ga0105249_10025509 3300009553 Bacteria 5322
165 Ga0099796_10050177 3300010159 Bacteria 1445
166 Ga0105239_10001873 3300010375 Bacteria 27535
167 Ga0105239_10051044 3300010375 Bacteria 4535
168 Ga0105239_10142948 3300010375 Bacteria 2667
169 Ga0105239_10704604 3300010375 Unclassified 1154
170 Ga0105246_10233832 3300011119 Unclassified 1449
171 Ga0157373_10041632 3300013100 Unclassified 3285
172 Ga0157373_10075784 3300013100 Bacteria 2373
173 Ga0157371_10029635 3300013102 Unclassified 3955
174 Ga0157370_10010753 3300013104 Bacteria 9624
175 Ga0157370_10188344 3300013104 Bacteria 1916
176 Ga0157369_10023925 3300013105 Bacteria 6799
177 Ga0157369_10025260 3300013105 Bacteria 6595
178 Ga0157369_10054168 3300013105 Bacteria 4332
179 Ga0157369_10068974 3300013105 Unclassified 3799
180 Ga0157369_10084039 3300013105 Bacteria 3404
181 Ga0157374_10002163 3300013296 Bacteria 16565
182 Ga0157374_10003993 3300013296 Bacteria 12397
183 Ga0157374_10009888 3300013296 Bacteria 8185
184 Ga0157374_10069667 3300013296 Unclassified 3312
185 Ga0157374_10186525 3300013296 Bacteria 2028
186 Ga0157378_10054133 3300013297 Unclassified 3573
187 Ga0157378_10060332 3300013297 Unclassified 3385
188 Ga0157378_10254659 3300013297 Bacteria 1682
189 Ga0157378_11761621 3300013297 Unclassified 667
190 Ga0163162_10069320 3300013306 Unclassified 3578
191 Ga0163162_10906093 3300013306 Bacteria 995
192 Ga0157372_10115175 3300013307 Unclassified 3082
193 Ga0157372_10136498 3300013307 Bacteria 2825
194 Ga0157372_10233305 3300013307 Bacteria 2134
195 Ga0157372_10624576 3300013307 Unclassified 1255
196 Ga0157372_10690061 3300013307 Bacteria 1188
197 Ga0157372_10950788 3300013307 Unclassified 996
198 Ga0157375_10024784 3300013308 Bacteria 5559
199 Ga0157375_10079559 3300013308 Unclassified 3314
200 Ga0157375_10737109 3300013308 Bacteria 1137
201 Ga0163163_10020751 3300014325 Bacteria 6193
202 Ga0163163_10414658 3300014325 Bacteria 1405
203 Ga0163163_10877009 3300014325 Unclassified 961
204 Ga0182008_10011715 3300014497 Bacteria 4653
205 Ga0157379_10009945 3300014968 Bacteria 8284
206 Ga0157379_10040611 3300014968 Bacteria 4153
207 Ga0157379_10070620 3300014968 Unclassified 3124
208 Ga0157379_10243301 3300014968 Bacteria 1632
209 Ga0157376_10292912 3300014969 Unclassified 1537
210 Ga0182007_10016435 3300015262 Bacteria 2730
211 Ga0213874_10030948 3300021377 Bacteria 1546
212 Ga0213876_10016931 3300021384 Unclassified 3852
213 Ga0213875_10092375 3300021388 Bacteria 1412
214 Ga0213871_10018867 3300021441 Unclassified 1692
215 Ga0224572_1010040 3300024225 Bacteria 1774
216 Ga0224572_1075530 3300024225 Unclassified 622
217 Ga0228598_1001720 3300024227 Bacteria 4786
218 Ga0207682_10309245 3300025893 Unclassified 741
219 Ga0207710_10040667 3300025900 Unclassified 2060
220 Ga0207710_10110808 3300025900 Unclassified 1303
221 Ga0207699_10082562 3300025906 Bacteria 1997
222 Ga0207645_10096686 3300025907 Unclassified 1903
223 Ga0207643_10269226 3300025908 Unclassified 1054
224 Ga0207705_10000589 3300025909 Bacteria 30498
225 Ga0207654_10000013 3300025911 Bacteria 241873
226 Ga0207654_10025933 3300025911 Unclassified 3169
227 Ga0207654_10059881 3300025911 Bacteria 2223
228 Ga0207654_10070770 3300025911 Bacteria 2072
229 Ga0207654_10423171 3300025911 Unclassified 930
230 Ga0207707_10266722 3300025912 Unclassified 1484
231 Ga0207695_10000233 3300025913 Bacteria 147498
232 Ga0207695_10003653 3300025913 Bacteria 21487
233 Ga0207695_10022080 3300025913 Bacteria 7239
234 Ga0207671_10016923 3300025914 Bacteria 5644
235 Ga0207671_10064927 3300025914 Bacteria 2714
236 Ga0207671_10169263 3300025914 Bacteria 1696
237 Ga0207657_10006177 3300025919 Bacteria 12453
238 Ga0207652_10518798 3300025921 Unclassified 1072
239 Ga0207646_11183125 3300025922 Bacteria 671
240 Ga0207694_10000530 3300025924 Bacteria 34549
241 Ga0207694_10178039 3300025924 Bacteria 1723
242 Ga0207694_10339938 3300025924 Unclassified 1241
243 Ga0207694_10350813 3300025924 Unclassified 1221
244 Ga0207659_10590673 3300025926 Bacteria 946
245 Ga0207687_10001365 3300025927 Bacteria 16702
246 Ga0207700_10415610 3300025928 Unclassified 1181
247 Ga0207700_10750931 3300025928 Bacteria 872
248 Ga0207664_10024553 3300025929 Bacteria 4531
249 Ga0207690_10235697 3300025932 Unclassified 1407
250 Ga0207706_10000941 3300025933 Bacteria 29750
251 Ga0207706_10013900 3300025933 Bacteria 7301
252 Ga0207686_10024347 3300025934 Bacteria 3507
253 Ga0207686_10151607 3300025934 Unclassified 1614
254 Ga0207686_10159700 3300025934 Bacteria 1578
255 Ga0207669_10159318 3300025937 Bacteria 1592
256 Ga0207704_10063485 3300025938 Bacteria 2302
257 Ga0207665_10505958 3300025939 Unclassified 934
258 Ga0207691_10022122 3300025940 Bacteria 5999
259 Ga0207711_10000525 3300025941 Bacteria 39339
260 Ga0207711_10003898 3300025941 Bacteria 12836
261 Ga0207711_10016219 3300025941 Bacteria 6186
262 Ga0207711_11296750 3300025941 Bacteria 670
263 Ga0207711_11576742 3300025941 Unclassified 600
264 Ga0207689_10063598 3300025942 Bacteria 3035
265 Ga0207689_10174733 3300025942 Unclassified 1771
266 Ga0207661_10878880 3300025944 Unclassified 825
267 Ga0207661_11217821 3300025944 Bacteria 693
268 Ga0207679_10048643 3300025945 Unclassified 3088
269 Ga0207667_10003515 3300025949 Bacteria 19377
270 Ga0207667_10054410 3300025949 Bacteria 4209
271 Ga0207667_10269534 3300025949 Unclassified 1740
272 Ga0207667_10328368 3300025949 Bacteria 1562
273 Ga0207712_10056090 3300025961 Unclassified 2775
274 Ga0207640_10300674 3300025981 Bacteria 1269
275 Ga0207640_10782172 3300025981 Unclassified 825
276 Ga0207658_10452000 3300025986 Unclassified 1137
277 Ga0207677_10004439 3300026023 Bacteria 7534
278 Ga0207677_10515533 3300026023 Bacteria 1036
279 Ga0207677_10569762 3300026023 Unclassified 990
280 Ga0207703_10036298 3300026035 Unclassified 3923
281 Ga0207703_10064519 3300026035 Bacteria 3006
282 Ga0207639_10049450 3300026041 Unclassified 3188
283 Ga0207639_10059066 3300026041 Bacteria 2953
284 Ga0207639_10076598 3300026041 Unclassified 2634
285 Ga0207678_10003306 3300026067 Bacteria 14534
286 Ga0207708_10966427 3300026075 Bacteria 739
287 Ga0207702_10015558 3300026078 Bacteria 6297
288 Ga0207702_10017604 3300026078 Bacteria 5912
289 Ga0207702_10070862 3300026078 Bacteria 2999
290 Ga0207702_10283807 3300026078 Unclassified 1566
291 Ga0207648_10039189 3300026089 Unclassified 4167
292 Ga0207676_11100372 3300026095 Unclassified 785
293 Ga0207674_10025829 3300026116 Bacteria 6253
294 Ga0207674_10037914 3300026116 Bacteria 5008
295 Ga0207674_10039094 3300026116 Bacteria 4920
296 Ga0207683_10026989 3300026121 Unclassified 4962
297 Ga0207698_10006245 3300026142 Bacteria 7419
298 Ga0207698_10127201 3300026142 Unclassified 2169
299 Ga0207698_10150895 3300026142 Bacteria 2017
300 Ga0207698_10249549 3300026142 Bacteria 1623
301 Ga0207698_10268189 3300026142 Bacteria 1572
302 Ga0207698_10338068 3300026142 Unclassified 1417
303 Ga0209179_1003393 3300027512 Bacteria 2290
304 Ga0265354_1004387 3300028016 Bacteria 1486
305 Ga0268266_10030627 3300028379 Bacteria 4571
306 Ga0268266_10080210 3300028379 Bacteria 2843
307 Ga0268265_10058615 3300028380 Unclassified 2941
308 Ga0268264_10615702 3300028381 Unclassified 1071
309 Ga0268264_10776980 3300028381 Unclassified 956
310 Ga0265338_10024248 3300028800 Bacteria 6203
311 Ga0265760_10001873 3300031090 Bacteria 6170
312 Ga0265760_10003668 3300031090 Bacteria 4450
313 Ga0265760_10213280 3300031090 Bacteria 656
314 Ga0265332_10011583 3300031238 Bacteria 3918
315 Ga0265320_10005668 3300031240 Bacteria 7972
316 Ga0265340_10049145 3300031247 Bacteria 2049
317 Ga0265331_10118995 3300031250 Bacteria 1208
318 Ga0265316_10007333 3300031344 Bacteria 10400
319 Ga0265314_10031877 3300031711 Bacteria 3885
320 Ga0265314_10154132 3300031711 Unclassified 1405
321 Ga0265342_10015520 3300031712 Bacteria 5008
322 Ga0373948_0044569 3300034817 Unclassified 938
323 Ga0373944_0026754 3300035089 Bacteria 1706
324 Ga0373954_0038726 3300035118 Bacteria 2218
325 Ga0373957_0179410 3300035120 Bacteria 877
326 Ga0373946_0129414 3300035171 Bacteria 1160
327 Ga0373961_0054906 3300035241 Unclassified 1192
328 Ga0373935_0533549 3300035692 Bacteria 854
329 Ga0373927_0172156 3300035695 Unclassified 1419
330 Ga0373933_0103109 3300035724 Bacteria 1772
331 Ga0373937_0006975 3300036401 Bacteria 9752
332 Ga0373925_0046510 3300037068 Bacteria 3227
333 Ga0373925_0885763 3300037068 Unclassified 736
334 Ga0436364_0373543 3300037853 Bacteria 5699
335 Ga0436364_0520212 3300037853 Bacteria 5106
336 Ga0436364_1378058 3300037853 Bacteria 3791
337 Ga0436364_1542886 3300037853 Bacteria 2891
338 Ga0436365_0281604 3300039437 Bacteria 4004
339 Ga0436365_0303850 3300039437 Unclassified 4233
340 Ga0436365_0470776 3300039437 Bacteria 1035
341 Ga0436365_1644740 3300039437 Bacteria 1622
342 Ga0436360_0224565 3300039438 Bacteria 3384
343 Ga0436361_0220316 3300039447 Bacteria 2257
344 Ga0436361_0230028 3300039447 Bacteria 994
345 Ga0436361_0752585 3300039447 Bacteria 4113
346 Ga0436361_1020706 3300039447 Bacteria 66534
347 Ga0436363_1636992 3300039450 Bacteria 2284
348 Ga0466966_0194372 3300044684 Bacteria 1229
349 Ga0466967_0095745 3300045976 Bacteria 2707
350 Ga0466967_1504656 3300045976 Unclassified 670
351 Ga0495580_0269425 3300046472 Unclassified 1163
352 Ga0495664_0016907 3300046477 Unclassified 4165
353 Ga0495664_0179573 3300046477 Bacteria 1284
354 Ga0495635_0591355 3300046663 Unclassified 725
355 Ga0495674_0057031 3300047319 Bacteria 3419
356 Ga0495675_0010311 3300047444 Bacteria 5840
357 Ga0495675_0121567 3300047444 Bacteria 1626
358 Ga0495684_0564697 3300047471 Bacteria 773
359 Ga0495602_0081776 3300048088 Bacteria 2714
360 Ga0496101_0143604 3300048904 Bacteria 1821
361 Ga0496102_0018239 3300048905 Bacteria 6163
362 Ga0496102_0269117 3300048905 Bacteria 1606
363 Ga0496103_0018996 3300048906 Bacteria 4126
364 Ga0496103_0145346 3300048906 Unclassified 1518
365 Ga0496104_0020718 3300048907 Bacteria 6030
366 Ga0496104_0020755 3300048907 Bacteria 6025
367 Ga0496104_0160057 3300048907 Unclassified 2160
368 Ga0496105_0393198 3300048908 Bacteria 1102
369 Ga0496106_0099803 3300048909 Unclassified 2251
370 Ga0496106_0356221 3300048909 Unclassified 1175
371 Ga0496106_0443574 3300048909 Bacteria 1043
372 Ga0496107_0145851 3300048910 Unclassified 1750
373 Ga0496109_0187596 3300048912 Bacteria 1943
374 Ga0496110_0648715 3300048913 Unclassified 955
375 Ga0496111_0146814 3300048914 Unclassified 1749
376 Ga0496112_0396738 3300048915 Unclassified 1319
377 Ga0496112_0774182 3300048915 Bacteria 885
378 Ga0496113_0671549 3300048916 Unclassified 828
379 Ga0496114_0032527 3300048917 Unclassified 4294
380 Ga0496115_0032595 3300048918 Bacteria 4110
381 Ga0496115_0039832 3300048918 Plasmid 3733
382 Ga0496115_0575505 3300048918 Bacteria 898
383 Ga0501075_0637055 3300049591 Bacteria 813
384 Ga0501076_1047453 3300049592 Bacteria 672
385 nmdc:mga05p37_103019_c1 3300050507 Bacteria 3514
386 nmdc:mga05p37_212558_c1 3300050507 Unclassified 2338
387 nmdc:mga05p37_306958_c1 3300050507 Bacteria 1882
388 nmdc:mga09592_1103060_c1 3300050508 Bacteria 660
389 nmdc:mga09592_39893_c1 3300050508 Bacteria 3944
390 nmdc:mga0qj67_877713_c1 3300050509 Bacteria 708
391 nmdc:mga08y16_309858_c1 3300050511 Unclassified 1626
392 nmdc:mga08y16_442935_c1 3300050511 Bacteria 1326
393 nmdc:mga0n895_123_c1 3300050512 Bacteria 46084
394 nmdc:mga0n895_84825_c1 3300050512 Bacteria 3161
395 nmdc:mga0rr50_212545_c1 3300050513 Bacteria 1594
396 nmdc:mga0rr50_27_c1 3300050513 Bacteria 109881
397 nmdc:mga08x19_383_c1 3300050514 Bacteria 31056
398 nmdc:mga0a205_438678_c1 3300050515 Bacteria 1167
399 Ga0070716_100782180
400 rootH1_10210918
401 Ga0065712_10171734
402 Ga0065715_10290132
403 Ga0065707_10199719
404 Ga0070676_10121394
405 Ga0070683_100013870
406 Ga0070683_100019063
407 Ga0070683_100889932
408 Ga0070677_10521260
409 Ga0068869_100055469
410 Ga0068869_100111740
411 Ga0070666_10011775
412 Ga0070666_10115884
413 Ga0070666_10369116
414 Ga0070682_100811428
415 Ga0068868_100002841
416 Ga0068868_100289760
417 Ga0068868_100763635
418 Ga0070660_100092778
419 Ga0070660_100711496
420 Ga0070689_100302849
421 Ga0070689_100402506
422 Ga0070691_10018052
423 Ga0070661_100035334
424 Ga0070661_100377661
425 Ga0070661_100842923
426 Ga0070692_10127393
427 Ga0070668_100012225
428 Ga0070668_100014678
429 Ga0070669_100138901
430 Ga0070669_100249020
431 Ga0070671_100306650
432 Ga0070659_100071008
433 Ga0070667_100007558
434 Ga0070709_10053106
435 Ga0070714_100027938
436 Ga0070713_100601103
437 Ga0070705_100231737
438 Ga0070705_100532424
439 Ga0070700_100301822
440 Ga0070694_100115950
441 Ga0070663_100058153
442 Ga0070663_100277361
443 Ga0070663_100464314
444 Ga0070678_100118782
445 Ga0070662_100072938
446 Ga0070662_100126043
447 Ga0070681_10279345
448 Ga0068867_100013267
449 Ga0068867_100816649
450 Ga0068867_100821639
451 Ga0070706_100041264
452 Ga0070707_100094424
453 Ga0070707_100165640
454 Ga0070698_100036994
455 Ga0070699_100007463
456 Ga0070679_100173550
457 Ga0070684_100068406
458 Ga0070684_100406867
459 Ga0070697_101038441
460 Ga0068853_100030405
461 Ga0068853_100107356
462 Ga0068853_100221964
463 Ga0068853_100573470
464 Ga0070672_100290636
465 Ga0070686_100085541
466 Ga0070695_100026015
467 Ga0070695_100177740
468 Ga0070696_100051346
469 Ga0070693_100019119
470 Ga0070665_100065630
471 Ga0070665_100167611
472 Ga0068855_100006684
473 Ga0068855_100059129
474 Ga0068855_100194307
475 Ga0068855_100386239
476 Ga0070664_100100120
477 Ga0070664_100283146
478 Ga0068857_100021656
479 Ga0068857_100045470
480 Ga0068857_100127379
481 Ga0068854_100011596
482 Ga0068854_100050853
483 Ga0068856_100010906
484 Ga0068856_100077687
485 Ga0068852_100033720
486 Ga0068852_100135130
487 Ga0068852_100188407
488 Ga0068852_100383689
489 Ga0068852_100671762
490 Ga0068852_101248582
491 Ga0068859_100008072
492 Ga0068864_100267794
493 Ga0068864_100611275
494 Ga0068864_101464321
495 Ga0068866_10053422
496 Ga0068861_100777474
497 Ga0068870_10141261
498 Ga0068863_100134865
499 Ga0068858_100017904
500 Ga0068860_100101383
501 Ga0068860_100227160
502 Ga0068860_100360570
503 Ga0068860_100814688
504 Ga0068862_100099345
505 Ga0070716_100433882
506 Ga0070712_100316901
507 Ga0097621_100089051
508 Ga0068871_100227752
509 Ga0068871_100298842
510 Ga0075428_100025128
511 Ga0075428_100813726
512 Ga0075430_100011933
513 Ga0075431_100268500
514 Ga0075431_100312370
515 Ga0075434_100085207
516 Ga0075429_100037988
517 Ga0075429_100124029
518 Ga0075429_100757139
519 Ga0068865_100323355
520 Ga0075436_100000126
521 Ga0097620_100008072
522 Ga0097620_100185810
523 Ga0075435_100000002
524 Ga0075435_100038118
525 Ga0105240_10003431
526 Ga0105240_10005473
527 Ga0105240_10055767
528 Ga0105240_10084928
529 Ga0105240_10123687
530 Ga0111539_10001651
531 Ga0111539_10018068
532 Ga0105245_10002580
533 Ga0105245_10046954
534 Ga0105247_10034991
535 Ga0105247_10058958
536 Ga0105247_10468100
537 Ga0114129_10150036
538 Ga0114129_10361526
539 Ga0105243_10013953
540 Ga0105241_10001305
541 Ga0105241_10016098
542 Ga0105241_10034157
543 Ga0105241_10785711
544 Ga0105242_10056276
545 Ga0105242_10058940
546 Ga0105242_10190276
547 Ga0105242_10559693
548 Ga0105248_10000255
549 Ga0105248_10021161
550 Ga0105248_10084597
551 Ga0105248_11752175
552 Ga0105248_12098207
553 Ga0105237_10002493
554 Ga0105237_10100148
555 Ga0105237_10119741
556 Ga0105237_10447712
557 Ga0105238_10000262
558 Ga0105238_10019865
559 Ga0105238_10039529
560 Ga0105238_10042067
561 Ga0105238_10049641
562 Ga0105249_10025509
563 Ga0099796_10050177
564 Ga0105239_10001873
565 Ga0105239_10051044
566 Ga0105239_10142948
567 Ga0105239_10704604
568 Ga0105246_10233832
569 Ga0157373_10041632
570 Ga0157373_10075784
571 Ga0157371_10029635
572 Ga0157370_10010753
573 Ga0157370_10188344
574 Ga0157369_10023925
575 Ga0157369_10025260
576 Ga0157369_10054168
577 Ga0157369_10068974
578 Ga0157369_10084039
579 Ga0157374_10002163
580 Ga0157374_10003993
581 Ga0157374_10009888
582 Ga0157374_10069667
583 Ga0157374_10186525
584 Ga0157378_10054133
585 Ga0157378_10060332
586 Ga0157378_10254659
587 Ga0157378_11761621
588 Ga0163162_10069320
589 Ga0163162_10906093
590 Ga0157372_10115175
591 Ga0157372_10136498
592 Ga0157372_10233305
593 Ga0157372_10624576
594 Ga0157372_10690061
595 Ga0157372_10950788
596 Ga0157375_10024784
597 Ga0157375_10079559
598 Ga0157375_10737109
599 Ga0163163_10020751
600 Ga0163163_10414658
601 Ga0163163_10877009
602 Ga0182008_10011715
603 Ga0157379_10009945
604 Ga0157379_10040611
605 Ga0157379_10070620
606 Ga0157379_10243301
607 Ga0157376_10292912
608 Ga0182007_10016435
609 Ga0213874_10030948
610 Ga0213876_10016931
611 Ga0213875_10092375
612 Ga0213871_10018867
613 Ga0224572_1010040
614 Ga0224572_1075530
615 Ga0228598_1001720
616 Ga0207682_10309245
617 Ga0207710_10040667
618 Ga0207710_10110808
619 Ga0207699_10082562
620 Ga0207645_10096686
621 Ga0207643_10269226
622 Ga0207705_10000589
623 Ga0207654_10000013
624 Ga0207654_10025933
625 Ga0207654_10059881
626 Ga0207654_10070770
627 Ga0207654_10423171
628 Ga0207707_10266722
629 Ga0207695_10000233
630 Ga0207695_10003653
631 Ga0207695_10022080
632 Ga0207671_10016923
633 Ga0207671_10064927
634 Ga0207671_10169263
635 Ga0207657_10006177
636 Ga0207652_10518798
637 Ga0207646_11183125
638 Ga0207694_10000530
639 Ga0207694_10178039
640 Ga0207694_10339938
641 Ga0207694_10350813
642 Ga0207659_10590673
643 Ga0207687_10001365
644 Ga0207700_10415610
645 Ga0207700_10750931
646 Ga0207664_10024553
647 Ga0207690_10235697
648 Ga0207706_10000941
649 Ga0207706_10013900
650 Ga0207686_10024347
651 Ga0207686_10151607
652 Ga0207686_10159700
653 Ga0207669_10159318
654 Ga0207704_10063485
655 Ga0207665_10505958
656 Ga0207691_10022122
657 Ga0207711_10000525
658 Ga0207711_10003898
659 Ga0207711_10016219
660 Ga0207711_11296750
661 Ga0207711_11576742
662 Ga0207689_10063598
663 Ga0207689_10174733
664 Ga0207661_10878880
665 Ga0207661_11217821
666 Ga0207679_10048643
667 Ga0207667_10003515
668 Ga0207667_10054410
669 Ga0207667_10269534
670 Ga0207667_10328368
671 Ga0207712_10056090
672 Ga0207640_10300674
673 Ga0207640_10782172
674 Ga0207658_10452000
675 Ga0207677_10004439
676 Ga0207677_10515533
677 Ga0207677_10569762
678 Ga0207703_10036298
679 Ga0207703_10064519
680 Ga0207639_10049450
681 Ga0207639_10059066
682 Ga0207639_10076598
683 Ga0207678_10003306
684 Ga0207708_10966427
685 Ga0207702_10015558
686 Ga0207702_10017604
687 Ga0207702_10070862
688 Ga0207702_10283807
689 Ga0207648_10039189
690 Ga0207676_11100372
691 Ga0207674_10025829
692 Ga0207674_10037914
693 Ga0207674_10039094
694 Ga0207683_10026989
695 Ga0207698_10006245
696 Ga0207698_10127201
697 Ga0207698_10150895
698 Ga0207698_10249549
699 Ga0207698_10268189
700 Ga0207698_10338068
701 Ga0209179_1003393
702 Ga0265354_1004387
703 Ga0268266_10030627
704 Ga0268266_10080210
705 Ga0268265_10058615
706 Ga0268264_10615702
707 Ga0268264_10776980
708 Ga0265338_10024248
709 Ga0265760_10001873
710 Ga0265760_10003668
711 Ga0265760_10213280
712 Ga0265332_10011583
713 Ga0265320_10005668
714 Ga0265340_10049145
715 Ga0265331_10118995
716 Ga0265316_10007333
717 Ga0265314_10031877
718 Ga0265314_10154132
719 Ga0265342_10015520
720 Ga0373948_0044569
721 Ga0373944_0026754
722 Ga0373954_0038726
723 Ga0373957_0179410
724 Ga0373946_0129414
725 Ga0373961_0054906
726 Ga0373935_0533549
727 Ga0373927_0172156
728 Ga0373933_0103109
729 Ga0373937_0006975
730 Ga0373925_0046510
731 Ga0373925_0885763
732 Ga0436364_0373543
733 Ga0436364_0520212
734 Ga0436364_1378058
735 Ga0436364_1542886
736 Ga0436365_0281604
737 Ga0436365_0303850
738 Ga0436365_0470776
739 Ga0436365_1644740
740 Ga0436360_0224565
741 Ga0436361_0220316
742 Ga0436361_0230028
743 Ga0436361_0752585
744 Ga0436361_1020706
745 Ga0436363_1636992
746 Ga0466966_0194372
747 Ga0466967_0095745
748 Ga0466967_1504656
749 Ga0495580_0269425
750 Ga0495664_0016907
751 Ga0495664_0179573
752 Ga0495635_0591355
753 Ga0495674_0057031
754 Ga0495675_0010311
755 Ga0495675_0121567
756 Ga0495684_0564697
757 Ga0495602_0081776
758 Ga0496101_0143604
759 Ga0496102_0018239
760 Ga0496102_0269117
761 Ga0496103_0018996
762 Ga0496103_0145346
763 Ga0496104_0020718
764 Ga0496104_0020755
765 Ga0496104_0160057
766 Ga0496105_0393198
767 Ga0496106_0099803
768 Ga0496106_0356221
769 Ga0496106_0443574
770 Ga0496107_0145851
771 Ga0496109_0187596
772 Ga0496110_0648715
773 Ga0496111_0146814
774 Ga0496112_0396738
775 Ga0496112_0774182
776 Ga0496113_0671549
777 Ga0496114_0032527
778 Ga0496115_0032595
779 Ga0496115_0039832
780 Ga0496115_0575505
781 Ga0501075_0637055
782 Ga0501076_1047453
783 nmdc:mga05p37_103019_c1
784 nmdc:mga05p37_212558_c1
785 nmdc:mga05p37_306958_c1
786 nmdc:mga09592_1103060_c1
787 nmdc:mga09592_39893_c1
788 nmdc:mga0qj67_877713_c1
789 nmdc:mga08y16_309858_c1
790 nmdc:mga08y16_442935_c1
791 nmdc:mga0n895_123_c1
792 nmdc:mga0n895_84825_c1
793 nmdc:mga0rr50_212545_c1
794 nmdc:mga0rr50_27_c1
795 nmdc:mga08x19_383_c1
796 nmdc:mga0a205_438678_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13521

AAA_28

AAA domain

3

169

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zi4-assembly1.cif.gz_A-2 c4s dck variant of dck in complex with l-da+adp 0.7491 1 180
2zi4-assembly1.cif.gz_A-2 c4s dck variant of dck in complex with l-da+adp 0.7455 1 180
3qen-assembly1.cif.gz_B s74e dck in complex with 5-bromodeoxycytidine and udp 0.7454 1 180
3qen-assembly1.cif.gz_A s74e dck in complex with 5-bromodeoxycytidine and udp 0.7446 2 180
3qen-assembly1.cif.gz_B s74e dck in complex with 5-bromodeoxycytidine and udp 0.7418 1 180
ID Description Score Start End Superfamily
af_Q55C83_3_170_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8094 1 171 3.40.50.300
af_Q55C83_3_170_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7964 1 171 3.40.50.300
af_P96394_152_310_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7695 1 171 3.40.50.300
af_P96394_152_310_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7609 1 171 3.40.50.300
af_Q4D1W4_131_295_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.66 3 151 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V9QMA9-F1-model_v4 ATPase 0.9813 1 177
AF-A0A101N1P8-F1-model_v4 NadR/Ttd14 AAA domain-containing protein 0.9707 79 177
AF-A0A2V9QMA9-F1-model_v4 ATPase 0.9705 1 177
AF-A0A5S4F1N1-F1-model_v4 ATPase 0.9697 56 179
AF-A0A4Q3YDN9-F1-model_v4 ATPase 0.9682 1 176

Map