F433923
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 397 | 329 | 159 | 225 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2885350715|2885356233 |
| Length | 245 |
| Sequence | TSVKPPHREASPAEQTRAALVHAALKLFGRQGFDGTSTREIAAEAKANIGSIAYHFGGKEGLRAAAADYIVDTIQTIAGQALGNQAVSAAQAPAPADAEAARAQLFTALERMVAFIVASPQAGEIVQFVLRELSHPTAALDRIYAGVFEPTHRRLCMIWEQATGEPAESERTRLTVFTLIGQVIYFRIGREAVMRRMGWREIGEAEAAKVVAIASDNLSAMLAARNLAARNPAAGTVAARKEGKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 4 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 5 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 6 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 7 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 8 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 9 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 10 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 11 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 12 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 13 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 14 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 15 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 16 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 17 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 18 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 19 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 20 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 21 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 22 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 23 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 24 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 25 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 26 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 27 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 28 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 29 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 30 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 31 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 32 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 33 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 34 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 35 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 36 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 37 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 38 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 39 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 40 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 41 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 42 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 43 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 44 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 45 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 46 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 47 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 48 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 49 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 50 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 51 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 52 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 53 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 54 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 55 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 56 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 57 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 58 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 59 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 60 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 61 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 62 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 63 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 64 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 65 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 66 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 67 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 68 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 69 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 70 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 71 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 72 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 73 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 74 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 75 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 76 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 77 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 78 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 79 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 80 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 81 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 82 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 83 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 84 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 85 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 86 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 87 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 88 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 89 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 90 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 91 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 92 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 93 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 94 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 95 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 96 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 97 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 98 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 99 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 100 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 101 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 102 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 103 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 104 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 105 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 106 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 107 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 108 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 109 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 110 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 111 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 112 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 113 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 114 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 115 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 116 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 117 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 118 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 119 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 120 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 121 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 122 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 123 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 124 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 125 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 126 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 127 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 128 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 129 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 130 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 131 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 132 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 133 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 134 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 135 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 136 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 137 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 138 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 139 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 140 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 141 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 142 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 143 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 144 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 145 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 146 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 147 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 148 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 149 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 150 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 151 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 152 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 153 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 154 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 155 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 156 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 157 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 158 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 159 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 160 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 161 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 162 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 163 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 164 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 165 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 166 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 167 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 168 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 169 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 170 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 171 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 172 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 173 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 174 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 175 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 176 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 177 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 178 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 179 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 180 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 181 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 182 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 183 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 184 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 185 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 186 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 187 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 188 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 189 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 190 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 191 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 192 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 193 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 194 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 195 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 196 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 197 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 198 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 199 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 200 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 201 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 202 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 203 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 204 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 205 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 206 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 207 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 208 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 209 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 210 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 211 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 212 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 213 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 214 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 215 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 216 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 217 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 218 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 219 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 220 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 221 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 222 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 223 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 224 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 225 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 226 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 227 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 228 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 232 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 233 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 234 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 235 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 236 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 237 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 238 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 239 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 240 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 241 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 242 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 244 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 245 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 246 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 250 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 251 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 253 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 263 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 264 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 265 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 266 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 267 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 268 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 269 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 270 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 271 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 280 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 281 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 306 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 307 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 308 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 309 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 310 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 313 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 314 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 315 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 316 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 318 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 319 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 320 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 321 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 322 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 323 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 324 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 325 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 326 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 327 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 328 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 329 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 40.05 |
| Metatranscriptomes | 0 |
| Isolates | 59.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.79 |
| Nodule | 55.16 |
| Rhizoplane | 1.51 |
| Rhizosphere | 31.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25157J39369_1002326 | 3300002741 | Bacteria | 4935 |
| 2 | JGI25406J46586_10024596 | 3300003203 | Bacteria | 2356 |
| 3 | JGI25165J46597_1000079 | 3300003214 | Bacteria | 179163 |
| 4 | Ga0070670_100998580 | 3300005331 | Bacteria | 761 |
| 5 | Ga0070674_100315163 | 3300005356 | Bacteria | 1252 |
| 6 | Ga0070659_100057793 | 3300005366 | Bacteria | 3060 |
| 7 | Ga0068857_100670072 | 3300005577 | Bacteria | 984 |
| 8 | Ga0068852_100209890 | 3300005616 | Bacteria | 1847 |
| 9 | Ga0081455_10295977 | 3300005937 | Bacteria | 1163 |
| 10 | Ga0081540_1149643 | 3300005983 | Bacteria | 923 |
| 11 | Ga0081539_10008068 | 3300005985 | Bacteria | 9322 |
| 12 | Ga0075365_10071958 | 3300006038 | Bacteria | 2328 |
| 13 | Ga0075365_10414922 | 3300006038 | Bacteria | 950 |
| 14 | Ga0075368_10039012 | 3300006042 | Bacteria | 1860 |
| 15 | Ga0075363_100354394 | 3300006048 | Bacteria | 857 |
| 16 | Ga0075362_10049694 | 3300006177 | Bacteria | 1874 |
| 17 | Ga0075367_10325044 | 3300006178 | Bacteria | 969 |
| 18 | Ga0075369_10037763 | 3300006186 | Bacteria | 2058 |
| 19 | Ga0105240_10115085 | 3300009093 | Bacteria | 3247 |
| 20 | Ga0105240_10580947 | 3300009093 | Bacteria | 1236 |
| 21 | Ga0105240_10625418 | 3300009093 | Bacteria | 1183 |
| 22 | Ga0105241_11141553 | 3300009174 | Bacteria | 735 |
| 23 | Ga0105238_10006361 | 3300009551 | Bacteria | 11745 |
| 24 | Ga0105239_10857208 | 3300010375 | Bacteria | 1042 |
| 25 | Ga0157370_10399418 | 3300013104 | Bacteria | 1265 |
| 26 | Ga0157369_10103857 | 3300013105 | Bacteria | 3027 |
| 27 | Ga0157378_10262148 | 3300013297 | Bacteria | 1659 |
| 28 | Ga0209026_1000141 | 3300025250 | Bacteria | 114545 |
| 29 | Ga0209759_1000554 | 3300025256 | Bacteria | 38251 |
| 30 | Ga0209233_1000247 | 3300025261 | Bacteria | 87890 |
| 31 | Ga0209758_1004711 | 3300025297 | Bacteria | 11129 |
| 32 | Ga0207647_10048553 | 3300025904 | Bacteria | 2635 |
| 33 | Ga0207705_10370876 | 3300025909 | Bacteria | 1105 |
| 34 | Ga0207695_10076880 | 3300025913 | Bacteria | 3392 |
| 35 | Ga0207690_10064636 | 3300025932 | Bacteria | 2499 |
| 36 | Ga0207667_10109287 | 3300025949 | Bacteria | 2852 |
| 37 | Ga0207668_10177548 | 3300025972 | Bacteria | 1677 |
| 38 | Ga0207639_10239292 | 3300026041 | Bacteria | 1577 |
| 39 | Ga0207678_10045026 | 3300026067 | Bacteria | 3815 |
| 40 | Ga0207674_10551527 | 3300026116 | Bacteria | 1113 |
| 41 | Ga0207674_10956172 | 3300026116 | Bacteria | 825 |
| 42 | Ga0307412_10685256 | 3300031911 | Bacteria | 878 |
| 43 | Ga0307412_10865732 | 3300031911 | Bacteria | 789 |
| 44 | Ga0307411_10450477 | 3300032005 | Bacteria | 1077 |
| 45 | Ga0395900_0372398 | 3300037418 | Bacteria | 1398 |
| 46 | Ga0395900_0414928 | 3300037418 | Bacteria | 1308 |
| 47 | Ga0395905_0096245 | 3300037471 | Bacteria | 2779 |
| 48 | Ga0395905_0650324 | 3300037471 | Bacteria | 956 |
| 49 | Ga0395901_0627772 | 3300038443 | Bacteria | 1080 |
| 50 | Ga0436361_0858198 | 3300039447 | Bacteria | 8320 |
| 51 | Ga0439465_0013194 | 3300041413 | Bacteria | 2580 |
| 52 | Ga0439445_0083800 | 3300042004 | Bacteria | 893 |
| 53 | Ga0466972_0168120 | 3300044658 | Bacteria | 1029 |
| 54 | Ga0495638_0186835 | 3300046460 | Bacteria | 1178 |
| 55 | Ga0495668_0036488 | 3300046616 | Bacteria | 2754 |
| 56 | Ga0495625_0008106 | 3300046660 | Bacteria | 9004 |
| 57 | Ga0495625_0424467 | 3300046660 | Bacteria | 826 |
| 58 | Ga0495626_0031871 | 3300048091 | Bacteria | 2534 |
| 59 | Ga0496101_0632186 | 3300048904 | Bacteria | 846 |
| 60 | Ga0496102_0054560 | 3300048905 | Bacteria | 3645 |
| 61 | Ga0496103_0253633 | 3300048906 | Bacteria | 1132 |
| 62 | Ga0496106_0377862 | 3300048909 | Bacteria | 1139 |
| 63 | Ga0496112_0408734 | 3300048915 | Bacteria | 1297 |
| 64 | Ga0496120_0000466 | 3300048923 | Bacteria | 63527 |
| 65 | Ga0496120_0068824 | 3300048923 | Bacteria | 1951 |
| 66 | Ga0501031_0041984 | 3300049568 | Bacteria | 2986 |
| 67 | Ga0501031_0124130 | 3300049568 | Bacteria | 1686 |
| 68 | Ga0501032_0000001 | 3300049569 | Bacteria | 422097 |
| 69 | Ga0501032_0001391 | 3300049569 | Bacteria | 19212 |
| 70 | Ga0501033_0000275 | 3300049570 | Bacteria | 49587 |
| 71 | Ga0501033_0000304 | 3300049570 | Bacteria | 46485 |
| 72 | Ga0501033_0004330 | 3300049570 | Bacteria | 11389 |
| 73 | Ga0501033_0059675 | 3300049570 | Bacteria | 2817 |
| 74 | Ga0501033_0087459 | 3300049570 | Bacteria | 2281 |
| 75 | Ga0501034_0000036 | 3300049571 | Bacteria | 239274 |
| 76 | Ga0501034_0004395 | 3300049571 | Bacteria | 15700 |
| 77 | Ga0501034_0030240 | 3300049571 | Bacteria | 5505 |
| 78 | Ga0501034_0112491 | 3300049571 | Bacteria | 2712 |
| 79 | Ga0501034_0166341 | 3300049571 | Bacteria | 2174 |
| 80 | Ga0501034_0882365 | 3300049571 | Bacteria | 783 |
| 81 | Ga0501034_0935548 | 3300049571 | Bacteria | 753 |
| 82 | Ga0501036_0000358 | 3300049572 | Bacteria | 32271 |
| 83 | Ga0501036_0302294 | 3300049572 | Bacteria | 1338 |
| 84 | Ga0501037_0000091 | 3300049573 | Bacteria | 84811 |
| 85 | Ga0501037_0000154 | 3300049573 | Bacteria | 64077 |
| 86 | Ga0501037_0313552 | 3300049573 | Bacteria | 1087 |
| 87 | Ga0501037_0394233 | 3300049573 | Bacteria | 950 |
| 88 | Ga0501038_0003916 | 3300049574 | Bacteria | 13845 |
| 89 | Ga0501038_0021125 | 3300049574 | Bacteria | 5848 |
| 90 | Ga0501039_0000011 | 3300049575 | Bacteria | 245124 |
| 91 | Ga0501039_0164375 | 3300049575 | Bacteria | 1745 |
| 92 | Ga0501039_0615556 | 3300049575 | Bacteria | 851 |
| 93 | Ga0501043_0000007 | 3300049579 | Bacteria | 224595 |
| 94 | Ga0501043_0000016 | 3300049579 | Bacteria | 170869 |
| 95 | Ga0501043_0029815 | 3300049579 | Bacteria | 4287 |
| 96 | Ga0501043_0128573 | 3300049579 | Bacteria | 1986 |
| 97 | Ga0501043_0343726 | 3300049579 | Bacteria | 1134 |
| 98 | Ga0501046_0093320 | 3300049580 | Bacteria | 2314 |
| 99 | Ga0501046_0500056 | 3300049580 | Bacteria | 871 |
| 100 | Ga0501047_0078162 | 3300049581 | Bacteria | 3182 |
| 101 | Ga0501047_0109180 | 3300049581 | Bacteria | 2649 |
| 102 | Ga0501047_0135357 | 3300049581 | Bacteria | 2344 |
| 103 | Ga0501047_0232741 | 3300049581 | Bacteria | 1695 |
| 104 | Ga0501047_0290110 | 3300049581 | Bacteria | 1480 |
| 105 | Ga0501047_0305352 | 3300049581 | Bacteria | 1433 |
| 106 | Ga0501047_0438765 | 3300049581 | Bacteria | 1136 |
| 107 | Ga0501047_0504851 | 3300049581 | Bacteria | 1036 |
| 108 | Ga0501067_0058436 | 3300049583 | Bacteria | 2136 |
| 109 | Ga0501068_0005949 | 3300049584 | Bacteria | 6695 |
| 110 | Ga0501069_0000027 | 3300049585 | Bacteria | 106217 |
| 111 | Ga0501069_0028850 | 3300049585 | Bacteria | 3044 |
| 112 | Ga0501070_0000650 | 3300049586 | Bacteria | 31944 |
| 113 | Ga0501070_0023230 | 3300049586 | Bacteria | 5194 |
| 114 | Ga0501070_0031603 | 3300049586 | Bacteria | 4435 |
| 115 | Ga0501070_0170962 | 3300049586 | Bacteria | 1790 |
| 116 | Ga0501070_0558283 | 3300049586 | Bacteria | 916 |
| 117 | Ga0501071_0004099 | 3300049587 | Bacteria | 9216 |
| 118 | Ga0501071_0127828 | 3300049587 | Bacteria | 1887 |
| 119 | Ga0501073_0022973 | 3300049589 | Bacteria | 4485 |
| 120 | Ga0501073_0479208 | 3300049589 | Bacteria | 860 |
| 121 | Ga0501074_0000066 | 3300049590 | Bacteria | 50258 |
| 122 | Ga0501074_0079532 | 3300049590 | Bacteria | 2352 |
| 123 | Ga0501075_0436448 | 3300049591 | Bacteria | 999 |
| 124 | Ga0501076_0218089 | 3300049592 | Bacteria | 1559 |
| 125 | Ga0501080_0000667 | 3300049742 | Bacteria | 27300 |
| 126 | Ga0501080_0002747 | 3300049742 | Bacteria | 15450 |
| 127 | Ga0501080_0021270 | 3300049742 | Bacteria | 6005 |
| 128 | Ga0501080_0167488 | 3300049742 | Bacteria | 2027 |
| 129 | Ga0501083_0000012 | 3300049744 | Bacteria | 178668 |
| 130 | Ga0501035_0000073 | 3300049822 | Bacteria | 122603 |
| 131 | Ga0501035_0000806 | 3300049822 | Bacteria | 33416 |
| 132 | Ga0501035_0004944 | 3300049822 | Bacteria | 12646 |
| 133 | Ga0501035_0018465 | 3300049822 | Bacteria | 6424 |
| 134 | Ga0501035_0252654 | 3300049822 | Bacteria | 1496 |
| 135 | Ga0501035_0281877 | 3300049822 | Bacteria | 1404 |
| 136 | Ga0501035_0621941 | 3300049822 | Bacteria | 878 |
| 137 | Ga0501044_0000118 | 3300049823 | Bacteria | 95218 |
| 138 | Ga0501044_0015666 | 3300049823 | Bacteria | 8165 |
| 139 | Ga0501044_0025239 | 3300049823 | Bacteria | 6301 |
| 140 | Ga0501044_0030135 | 3300049823 | Bacteria | 5719 |
| 141 | Ga0501044_0052587 | 3300049823 | Bacteria | 4196 |
| 142 | Ga0501044_0107349 | 3300049823 | Bacteria | 2803 |
| 143 | Ga0501044_0267612 | 3300049823 | Bacteria | 1646 |
| 144 | nmdc:mga03n38_114765_c1 | 3300050490 | Bacteria | 949 |
| 145 | nmdc:mga0yw44_453_c1 | 3300050492 | Bacteria | 14505 |
| 146 | nmdc:mga0yw44_51274_c1 | 3300050492 | Bacteria | 2498 |
| 147 | nmdc:mga0k408_137635_c1 | 3300050493 | Bacteria | 1451 |
| 148 | nmdc:mga04h51_95438_c1 | 3300050495 | Bacteria | 1076 |
| 149 | nmdc:mga0sz30_39435_c1 | 3300050516 | Bacteria | 1981 |
| 150 | Ga0495655_0016637 | 3300053083 | Bacteria | 1588 |
| 151 | Ga0495655_0152776 | 3300053083 | Bacteria | 727 |
| 152 | Ga0500658_0180689 | 3300053134 | Bacteria | 960 |
| 153 | Ga0500604_0073261 | 3300053151 | Bacteria | 1095 |
| 154 | Ga0500620_000218 | 3300053155 | Bacteria | 11324 |
| 155 | Ga0500620_007921 | 3300053155 | Bacteria | 2653 |
| 156 | Ga0500627_0088150 | 3300053158 | Bacteria | 1387 |
| 157 | Ga0500627_0221059 | 3300053158 | Bacteria | 845 |
| 158 | Ga0500611_046698 | 3300053727 | Bacteria | 975 |
| 159 | Ga0501082_0027361 | 3300060353 | Bacteria | 4909 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049575 | Ga0501039_0615556 | Ga0501039_0615556_210_803 | 196 |
| 2 | 3300049823 | Ga0501044_0267612 | Ga0501044_0267612_1018_1629 | 199 |
| 3 | iso_pu_bacteria | 2869242130 | 2869242408 | 201 |
| 4 | iso_pu_bacteria | 2977907340 | 2977910786 | 201 |
| 5 | iso_pu_bacteria | 2906354277 | 2906354956 | 202 |
| 6 | 3300009174 | Ga0105241_11141553 | Ga0105241_111415531 | 205 |
| 7 | iso_pu_bacteria | 2869169390 | 2869172365 | 205 |
| 8 | iso_pu_bacteria | 2869234852 | 2869235052 | 205 |
| 9 | iso_pu_bacteria | 2871481445 | 2871482743 | 205 |
| 10 | iso_pu_bacteria | 2874109183 | 2874110183 | 205 |
| 11 | iso_pu_bacteria | 2874116593 | 2874117570 | 205 |
| 12 | iso_pu_bacteria | 2874168670 | 2874173349 | 205 |
| 13 | iso_pu_bacteria | 2876386047 | 2876389970 | 205 |
| 14 | iso_pu_bacteria | 2876420981 | 2876424690 | 205 |
| 15 | iso_pu_bacteria | 2878730984 | 2878736920 | 205 |
| 16 | iso_pu_bacteria | 2903513507 | 2903519805 | 205 |
| 17 | iso_pu_bacteria | 2906401398 | 2906402220 | 205 |
| 18 | iso_pu_bacteria | 2924710171 | 2924711962 | 205 |
| 19 | iso_pu_bacteria | 2924741084 | 2924742642 | 205 |
| 20 | iso_pu_bacteria | 3004268573 | 3004272091 | 205 |
| 21 | iso_pu_bacteria | 2874123672 | 2874126230 | 206 |
| 22 | iso_pu_bacteria | 2876377896 | 2876378410 | 208 |
| 23 | iso_pu_bacteria | 2938014810 | 2938017651 | 208 |
| 24 | 3300049571 | Ga0501034_0030240 | Ga0501034_0030240_3419_4102 | 209 |
| 25 | 3300049581 | Ga0501047_0438765 | Ga0501047_0438765_330_1013 | 209 |
| 26 | 3300006048 | Ga0075363_100354394 | Ga0075363_1003543941 | 210 |
| 27 | 3300006177 | Ga0075362_10049694 | Ga0075362_100496943 | 210 |
| 28 | 3300050490 | nmdc:mga03n38_114765_c1 | nmdc:mga03n38_114765_c1_253_888 | 210 |
| 29 | 3300050495 | nmdc:mga04h51_95438_c1 | nmdc:mga04h51_95438_c1_125_760 | 210 |
| 30 | 3300050516 | nmdc:mga0sz30_39435_c1 | nmdc:mga0sz30_39435_c1_736_1371 | 210 |
| 31 | iso_pu_bacteria | 2509276018 | 2509368848 | 210 |
| 32 | iso_pu_bacteria | 2687453392 | 2688596107 | 210 |
| 33 | iso_pu_bacteria | 2856328259 | 2856332413 | 210 |
| 34 | iso_pu_bacteria | 2857367948 | 2857375634 | 210 |
| 35 | iso_pu_bacteria | 2869271264 | 2869277697 | 210 |
| 36 | iso_pu_bacteria | 2874131515 | 2874133864 | 210 |
| 37 | iso_pu_bacteria | 2874162495 | 2874166031 | 210 |
| 38 | iso_pu_bacteria | 2876399893 | 2876404476 | 210 |
| 39 | iso_pu_bacteria | 2876406927 | 2876410243 | 210 |
| 40 | iso_pu_bacteria | 2878781027 | 2878787627 | 210 |
| 41 | iso_pu_bacteria | 2906386501 | 2906389874 | 210 |
| 42 | iso_pu_bacteria | 2906393657 | 2906395215 | 210 |
| 43 | iso_pu_bacteria | 2906408224 | 2906410488 | 210 |
| 44 | iso_pu_bacteria | 2922151315 | 2922154141 | 210 |
| 45 | iso_pu_bacteria | 2922172374 | 2922175578 | 210 |
| 46 | iso_pu_bacteria | 2922178524 | 2922183550 | 210 |
| 47 | iso_pu_bacteria | 2924748358 | 2924752882 | 210 |
| 48 | iso_pu_bacteria | 2937868953 | 2937876607 | 210 |
| 49 | iso_pu_bacteria | 2958122699 | 2958129952 | 210 |
| 50 | iso_pu_bacteria | 2958137437 | 2958139708 | 210 |
| 51 | iso_pu_bacteria | 2958158011 | 2958164112 | 210 |
| 52 | iso_pu_bacteria | 2961136820 | 2961141584 | 210 |
| 53 | iso_pu_bacteria | 2965025482 | 2965029861 | 210 |
| 54 | iso_pu_bacteria | 2965032056 | 2965039920 | 210 |
| 55 | iso_pu_bacteria | 2965047637 | 2965054186 | 210 |
| 56 | iso_pu_bacteria | 2965102966 | 2965107612 | 210 |
| 57 | iso_pu_bacteria | 2970547951 | 2970553161 | 210 |
| 58 | iso_pu_bacteria | 2977935797 | 2977938729 | 210 |
| 59 | iso_pu_bacteria | 2987645492 | 2987649991 | 210 |
| 60 | iso_pu_bacteria | 2987673487 | 2987673488 | 210 |
| 61 | iso_pu_bacteria | 3004239961 | 3004246400 | 210 |
| 62 | iso_pu_bacteria | 8004300914 | 8004303147 | 210 |
| 63 | iso_pu_bacteria | 8004361976 | 8004366993 | 210 |
| 64 | iso_pu_bacteria | 8004695233 | 8004699106 | 210 |
| 65 | 3300049580 | Ga0501046_0500056 | Ga0501046_0500056_198_848 | 212 |
| 66 | 3300049581 | Ga0501047_0504851 | Ga0501047_0504851_67_717 | 212 |
| 67 | 3300049589 | Ga0501073_0479208 | Ga0501073_0479208_57_707 | 212 |
| 68 | 3300049591 | Ga0501075_0436448 | Ga0501075_0436448_270_917 | 212 |
| 69 | 3300041413 | Ga0439465_0013194 | Ga0439465_0013194_1315_2007 | 213 |
| 70 | 3300042004 | Ga0439445_0083800 | Ga0439445_0083800_35_727 | 213 |
| 71 | 3300006038 | Ga0075365_10414922 | Ga0075365_104149222 | 214 |
| 72 | 3300006042 | Ga0075368_10039012 | Ga0075368_100390122 | 214 |
| 73 | 3300006178 | Ga0075367_10325044 | Ga0075367_103250442 | 214 |
| 74 | 3300039447 | Ga0436361_0858198 | Ga0436361_0858198_4846_5529 | 214 |
| 75 | 3300050492 | nmdc:mga0yw44_453_c1 | nmdc:mga0yw44_453_c1_13269_14000 | 214 |
| 76 | 3300053083 | Ga0495655_0152776 | Ga0495655_0152776_60_713 | 215 |
| 77 | 3300037418 | Ga0395900_0372398 | Ga0395900_0372398_51_722 | 216 |
| 78 | 3300005366 | Ga0070659_100057793 | Ga0070659_1000577933 | 217 |
| 79 | 3300005577 | Ga0068857_100670072 | Ga0068857_1006700722 | 217 |
| 80 | 3300013104 | Ga0157370_10399418 | Ga0157370_103994181 | 217 |
| 81 | 3300025909 | Ga0207705_10370876 | Ga0207705_103708761 | 217 |
| 82 | 3300025932 | Ga0207690_10064636 | Ga0207690_100646363 | 217 |
| 83 | 3300026067 | Ga0207678_10045026 | Ga0207678_100450265 | 217 |
| 84 | 3300026116 | Ga0207674_10956172 | Ga0207674_109561721 | 217 |
| 85 | 3300049568 | Ga0501031_0041984 | Ga0501031_0041984_888_1547 | 217 |
| 86 | 3300049569 | Ga0501032_0001391 | Ga0501032_0001391_11758_12417 | 217 |
| 87 | 3300049570 | Ga0501033_0000304 | Ga0501033_0000304_24884_25543 | 217 |
| 88 | 3300049570 | Ga0501033_0059675 | Ga0501033_0059675_2108_2773 | 217 |
| 89 | 3300049570 | Ga0501033_0087459 | Ga0501033_0087459_1111_1776 | 217 |
| 90 | 3300049571 | Ga0501034_0882365 | Ga0501034_0882365_50_709 | 217 |
| 91 | 3300049573 | Ga0501037_0000154 | Ga0501037_0000154_46287_46982 | 217 |
| 92 | 3300049574 | Ga0501038_0021125 | Ga0501038_0021125_2035_2694 | 217 |
| 93 | 3300049575 | Ga0501039_0164375 | Ga0501039_0164375_668_1327 | 217 |
| 94 | 3300049579 | Ga0501043_0000007 | Ga0501043_0000007_35558_36217 | 217 |
| 95 | 3300049579 | Ga0501043_0029815 | Ga0501043_0029815_2213_2914 | 217 |
| 96 | 3300049581 | Ga0501047_0109180 | Ga0501047_0109180_1831_2490 | 217 |
| 97 | 3300049581 | Ga0501047_0135357 | Ga0501047_0135357_1362_2027 | 217 |
| 98 | 3300049583 | Ga0501067_0058436 | Ga0501067_0058436_110_769 | 217 |
| 99 | 3300049584 | Ga0501068_0005949 | Ga0501068_0005949_5068_5727 | 217 |
| 100 | 3300049585 | Ga0501069_0000027 | Ga0501069_0000027_69996_70655 | 217 |
| 101 | 3300049585 | Ga0501069_0028850 | Ga0501069_0028850_273_938 | 217 |
| 102 | 3300049586 | Ga0501070_0000650 | Ga0501070_0000650_26263_26922 | 217 |
| 103 | 3300049586 | Ga0501070_0023230 | Ga0501070_0023230_2403_3086 | 217 |
| 104 | 3300049586 | Ga0501070_0170962 | Ga0501070_0170962_20_685 | 217 |
| 105 | 3300049587 | Ga0501071_0004099 | Ga0501071_0004099_486_1145 | 217 |
| 106 | 3300049587 | Ga0501071_0127828 | Ga0501071_0127828_749_1414 | 217 |
| 107 | 3300049589 | Ga0501073_0022973 | Ga0501073_0022973_867_1562 | 217 |
| 108 | 3300049590 | Ga0501074_0000066 | Ga0501074_0000066_20297_20956 | 217 |
| 109 | 3300049592 | Ga0501076_0218089 | Ga0501076_0218089_888_1547 | 217 |
| 110 | 3300049742 | Ga0501080_0000667 | Ga0501080_0000667_22912_23571 | 217 |
| 111 | 3300049742 | Ga0501080_0021270 | Ga0501080_0021270_1276_1941 | 217 |
| 112 | 3300049742 | Ga0501080_0167488 | Ga0501080_0167488_1069_1734 | 217 |
| 113 | 3300049744 | Ga0501083_0000012 | Ga0501083_0000012_142295_142954 | 217 |
| 114 | 3300049822 | Ga0501035_0000073 | Ga0501035_0000073_63057_63716 | 217 |
| 115 | 3300049822 | Ga0501035_0004944 | Ga0501035_0004944_9128_9793 | 217 |
| 116 | 3300049822 | Ga0501035_0252654 | Ga0501035_0252654_155_820 | 217 |
| 117 | 3300049822 | Ga0501035_0621941 | Ga0501035_0621941_56_721 | 217 |
| 118 | 3300049823 | Ga0501044_0000118 | Ga0501044_0000118_58974_59633 | 217 |
| 119 | 3300049823 | Ga0501044_0030135 | Ga0501044_0030135_3241_3906 | 217 |
| 120 | 3300049823 | Ga0501044_0107349 | Ga0501044_0107349_2109_2774 | 217 |
| 121 | 3300060353 | Ga0501082_0027361 | Ga0501082_0027361_1103_1762 | 217 |
| 122 | iso_pu_bacteria | 2922130491 | 2922130923 | 217 |
| 123 | iso_pu_bacteria | 2965119406 | 2965123930 | 217 |
| 124 | 3300049570 | Ga0501033_0004330 | Ga0501033_0004330_7804_8466 | 218 |
| 125 | 3300049571 | Ga0501034_0166341 | Ga0501034_0166341_578_1240 | 218 |
| 126 | 3300049571 | Ga0501034_0935548 | Ga0501034_0935548_24_686 | 218 |
| 127 | 3300049573 | Ga0501037_0313552 | Ga0501037_0313552_333_995 | 218 |
| 128 | 3300049581 | Ga0501047_0078162 | Ga0501047_0078162_1399_2061 | 218 |
| 129 | 3300049581 | Ga0501047_0305352 | Ga0501047_0305352_726_1388 | 218 |
| 130 | 3300049586 | Ga0501070_0031603 | Ga0501070_0031603_977_1639 | 218 |
| 131 | 3300049586 | Ga0501070_0558283 | Ga0501070_0558283_186_884 | 218 |
| 132 | 3300049590 | Ga0501074_0079532 | Ga0501074_0079532_1119_1781 | 218 |
| 133 | 3300049742 | Ga0501080_0002747 | Ga0501080_0002747_1847_2509 | 218 |
| 134 | 3300049822 | Ga0501035_0000806 | Ga0501035_0000806_14452_15114 | 218 |
| 135 | 3300049822 | Ga0501035_0281877 | Ga0501035_0281877_698_1360 | 218 |
| 136 | 3300049823 | Ga0501044_0015666 | Ga0501044_0015666_2641_3303 | 218 |
| 137 | 3300049823 | Ga0501044_0025239 | Ga0501044_0025239_2876_3538 | 218 |
| 138 | 3300049579 | Ga0501043_0343726 | Ga0501043_0343726_41_862 | 219 |
| 139 | iso_pu_bacteria | 2878035449 | 2878039344 | 219 |
| 140 | 3300049571 | Ga0501034_0004395 | Ga0501034_0004395_8996_9673 | 220 |
| 141 | iso_pu_bacteria | 2513237351 | 2514586242 | 220 |
| 142 | iso_pu_bacteria | 2869278585 | 2869284860 | 220 |
| 143 | iso_pu_bacteria | 2937877337 | 2937878389 | 220 |
| 144 | iso_pu_bacteria | 2958034702 | 2958038176 | 220 |
| 145 | iso_pu_bacteria | 2958041894 | 2958042259 | 220 |
| 146 | iso_pu_bacteria | 2958084443 | 2958085662 | 220 |
| 147 | iso_pu_bacteria | 2958092219 | 2958093054 | 220 |
| 148 | iso_pu_bacteria | 2970593180 | 2970599471 | 220 |
| 149 | iso_pu_bacteria | 2996336353 | 2996341448 | 220 |
| 150 | 3300049571 | Ga0501034_0112491 | Ga0501034_0112491_1159_1839 | 221 |
| 151 | 3300049572 | Ga0501036_0302294 | Ga0501036_0302294_627_1310 | 221 |
| 152 | 3300049573 | Ga0501037_0394233 | Ga0501037_0394233_101_781 | 221 |
| 153 | 3300049579 | Ga0501043_0128573 | Ga0501043_0128573_1278_1958 | 221 |
| 154 | 3300049581 | Ga0501047_0232741 | Ga0501047_0232741_172_852 | 221 |
| 155 | iso_pu_bacteria | 2844009547 | 2844010916 | 221 |
| 156 | iso_pu_bacteria | 2869256925 | 2869261561 | 221 |
| 157 | iso_pu_bacteria | 2871435913 | 2871436328 | 221 |
| 158 | iso_pu_bacteria | 2906427513 | 2906430028 | 221 |
| 159 | iso_pu_bacteria | 2924726620 | 2924731390 | 221 |
| 160 | iso_pu_bacteria | 2958108152 | 2958109344 | 221 |
| 161 | iso_pu_bacteria | 2961183825 | 2961187659 | 221 |
| 162 | iso_pu_bacteria | 2968138860 | 2968145158 | 221 |
| 163 | iso_pu_bacteria | 2970510686 | 2970510754 | 221 |
| 164 | iso_pu_bacteria | 2970532167 | 2970534926 | 221 |
| 165 | iso_pu_bacteria | 2970619444 | 2970622411 | 221 |
| 166 | iso_pu_bacteria | 2970627176 | 2970632087 | 221 |
| 167 | iso_pu_bacteria | 2977851361 | 2977855315 | 221 |
| 168 | iso_pu_bacteria | 2977898635 | 2977899947 | 221 |
| 169 | iso_pu_bacteria | 2979772303 | 2979776147 | 221 |
| 170 | iso_pu_bacteria | 2996386984 | 2996392462 | 221 |
| 171 | iso_pu_bacteria | 3004232784 | 3004237235 | 221 |
| 172 | iso_pu_bacteria | 3004248173 | 3004251864 | 221 |
| 173 | iso_pu_bacteria | 8004312739 | 8004313667 | 221 |
| 174 | iso_pu_bacteria | 8004727605 | 8004730567 | 221 |
| 175 | 3300005983 | Ga0081540_1149643 | Ga0081540_11496431 | 222 |
| 176 | iso_pu_bacteria | 2643221564 | 2643838393 | 222 |
| 177 | iso_pu_bacteria | 2885312484 | 2885314027 | 222 |
| 178 | iso_pu_bacteria | 2888337043 | 2888343487 | 222 |
| 179 | iso_pu_bacteria | 2937861824 | 2937864907 | 222 |
| 180 | iso_pu_bacteria | 3004167301 | 3004173418 | 222 |
| 181 | 3300049568 | Ga0501031_0124130 | Ga0501031_0124130_390_1091 | 223 |
| 182 | 3300049569 | Ga0501032_0000001 | Ga0501032_0000001_188045_188746 | 223 |
| 183 | 3300049570 | Ga0501033_0000275 | Ga0501033_0000275_39250_39951 | 223 |
| 184 | 3300049571 | Ga0501034_0000036 | Ga0501034_0000036_232363_233064 | 223 |
| 185 | 3300049572 | Ga0501036_0000358 | Ga0501036_0000358_18147_18848 | 223 |
| 186 | 3300049573 | Ga0501037_0000091 | Ga0501037_0000091_47408_48109 | 223 |
| 187 | 3300049574 | Ga0501038_0003916 | Ga0501038_0003916_9740_10441 | 223 |
| 188 | 3300049575 | Ga0501039_0000011 | Ga0501039_0000011_234812_235513 | 223 |
| 189 | 3300049579 | Ga0501043_0000016 | Ga0501043_0000016_155433_156134 | 223 |
| 190 | 3300049580 | Ga0501046_0093320 | Ga0501046_0093320_960_1661 | 223 |
| 191 | 3300049581 | Ga0501047_0290110 | Ga0501047_0290110_637_1338 | 223 |
| 192 | 3300049822 | Ga0501035_0018465 | Ga0501035_0018465_1572_2273 | 223 |
| 193 | 3300049823 | Ga0501044_0052587 | Ga0501044_0052587_352_1053 | 223 |
| 194 | iso_pu_bacteria | 2503198000 | 2503198830 | 223 |
| 195 | iso_pu_bacteria | 2510065059 | 2510315175 | 223 |
| 196 | iso_pu_bacteria | 2791355123 | 2792747314 | 223 |
| 197 | iso_pu_bacteria | 8055617313 | 8055618003 | 223 |
| 198 | 3300032005 | Ga0307411_10450477 | Ga0307411_104504771 | 224 |
| 199 | iso_pu_bacteria | 2512875024 | 2512961953 | 224 |
| 200 | iso_pu_bacteria | 2856342000 | 2856348639 | 224 |
| 201 | iso_pu_bacteria | 2869162929 | 2869168280 | 224 |
| 202 | iso_pu_bacteria | 2882632389 | 2882636805 | 224 |
| 203 | iso_pu_bacteria | 3000135777 | 3000137496 | 224 |
| 204 | 3300031911 | Ga0307412_10865732 | Ga0307412_108657321 | 225 |
| 205 | iso_pu_bacteria | 2871488783 | 2871491522 | 225 |
| 206 | iso_pu_bacteria | 2878753008 | 2878754860 | 225 |
| 207 | iso_pu_bacteria | 2881845957 | 2881850844 | 225 |
| 208 | iso_pu_bacteria | 2882912400 | 2882919725 | 225 |
| 209 | iso_pu_bacteria | 2885318864 | 2885324018 | 225 |
| 210 | iso_pu_bacteria | 2903492973 | 2903500395 | 225 |
| 211 | iso_pu_bacteria | 2924784321 | 2924787337 | 225 |
| 212 | iso_pu_bacteria | 2937891427 | 2937898283 | 225 |
| 213 | iso_pu_bacteria | 2967996073 | 2967997373 | 225 |
| 214 | iso_pu_bacteria | 2968003550 | 2968006375 | 225 |
| 215 | iso_pu_bacteria | 2977821940 | 2977824077 | 225 |
| 216 | iso_pu_bacteria | 2977828996 | 2977835500 | 225 |
| 217 | iso_pu_bacteria | 8004374579 | 8004376442 | 225 |
| 218 | 3300003203 | JGI25406J46586_10024596 | JGI25406J46586_100245962 | 226 |
| 219 | 3300005985 | Ga0081539_10008068 | Ga0081539_1000806813 | 226 |
| 220 | 3300037471 | Ga0395905_0650324 | Ga0395905_0650324_97_801 | 226 |
| 221 | iso_pu_bacteria | 2508501123 | 2509118754 | 226 |
| 222 | iso_pu_bacteria | 2856334872 | 2856340337 | 226 |
| 223 | iso_pu_bacteria | 2869249662 | 2869249829 | 226 |
| 224 | iso_pu_bacteria | 2869264136 | 2869267866 | 226 |
| 225 | iso_pu_bacteria | 2871451962 | 2871457142 | 226 |
| 226 | iso_pu_bacteria | 2871459585 | 2871462863 | 226 |
| 227 | iso_pu_bacteria | 2878774303 | 2878776478 | 226 |
| 228 | iso_pu_bacteria | 2906363423 | 2906366507 | 226 |
| 229 | iso_pu_bacteria | 2906370794 | 2906371239 | 226 |
| 230 | iso_pu_bacteria | 2965040258 | 2965046167 | 226 |
| 231 | iso_pu_bacteria | 2965089291 | 2965093011 | 226 |
| 232 | iso_pu_bacteria | 2977872689 | 2977874504 | 226 |
| 233 | iso_pu_bacteria | 2977915119 | 2977920936 | 226 |
| 234 | iso_pu_bacteria | 2977950692 | 2977953693 | 226 |
| 235 | iso_pu_bacteria | 2979793036 | 2979799479 | 226 |
| 236 | iso_pu_bacteria | 3004195979 | 3004200360 | 226 |
| 237 | iso_pu_bacteria | 649633066 | 649870667 | 226 |
| 238 | 3300046616 | Ga0495668_0036488 | Ga0495668_0036488_1679_2368 | 227 |
| 239 | iso_pu_bacteria | 2856320880 | 2856323746 | 227 |
| 240 | iso_pu_bacteria | 2874139085 | 2874142821 | 227 |
| 241 | iso_pu_bacteria | 2878738818 | 2878741112 | 227 |
| 242 | iso_pu_bacteria | 2924718760 | 2924724268 | 227 |
| 243 | iso_pu_bacteria | 2924776078 | 2924778713 | 227 |
| 244 | iso_pu_bacteria | 2937972304 | 2937975715 | 227 |
| 245 | iso_pu_bacteria | 2958144490 | 2958150517 | 227 |
| 246 | iso_pu_bacteria | 2961170736 | 2961172051 | 227 |
| 247 | iso_pu_bacteria | 2968016561 | 2968017364 | 227 |
| 248 | iso_pu_bacteria | 2970469710 | 2970470723 | 227 |
| 249 | iso_pu_bacteria | 2970503327 | 2970504648 | 227 |
| 250 | iso_pu_bacteria | 2979808191 | 2979809286 | 227 |
| 251 | iso_pu_bacteria | 8004640170 | 8004645280 | 227 |
| 252 | 3300005356 | Ga0070674_100315163 | Ga0070674_1003151632 | 228 |
| 253 | 3300009093 | Ga0105240_10580947 | Ga0105240_105809472 | 228 |
| 254 | 3300013297 | Ga0157378_10262148 | Ga0157378_102621481 | 228 |
| 255 | 3300044658 | Ga0466972_0168120 | Ga0466972_0168120_64_768 | 228 |
| 256 | 3300048904 | Ga0496101_0632186 | Ga0496101_0632186_60_764 | 228 |
| 257 | iso_pu_bacteria | 2509276022 | 2509393738 | 228 |
| 258 | iso_pu_bacteria | 2643221627 | 2644154390 | 228 |
| 259 | iso_pu_bacteria | 2756170246 | 2756675180 | 228 |
| 260 | iso_pu_bacteria | 2844002411 | 2844003326 | 228 |
| 261 | iso_pu_bacteria | 2856349417 | 2856350643 | 228 |
| 262 | iso_pu_bacteria | 2871466892 | 2871471525 | 228 |
| 263 | iso_pu_bacteria | 2881155292 | 2881159389 | 228 |
| 264 | iso_pu_bacteria | 2885342637 | 2885343844 | 228 |
| 265 | iso_pu_bacteria | 2906378014 | 2906383690 | 228 |
| 266 | iso_pu_bacteria | 2924733363 | 2924738510 | 228 |
| 267 | iso_pu_bacteria | 2924762789 | 2924766096 | 228 |
| 268 | iso_pu_bacteria | 2937822353 | 2937822720 | 228 |
| 269 | iso_pu_bacteria | 2958064165 | 2958071038 | 228 |
| 270 | iso_pu_bacteria | 2970489779 | 2970492866 | 228 |
| 271 | iso_pu_bacteria | 2987666974 | 2987667026 | 228 |
| 272 | 3300048909 | Ga0496106_0377862 | Ga0496106_0377862_381_1121 | 229 |
| 273 | iso_pu_bacteria | 2513237164 | 2514038896 | 229 |
| 274 | iso_pu_bacteria | 2513237305 | 2514417553 | 229 |
| 275 | iso_pu_bacteria | 2599185301 | 2599938929 | 229 |
| 276 | iso_pu_bacteria | 2693429783 | 2694627843 | 229 |
| 277 | iso_pu_bacteria | 2721755686 | 2723573205 | 229 |
| 278 | iso_pu_bacteria | 2847670302 | 2847673531 | 229 |
| 279 | iso_pu_bacteria | 2847686936 | 2847690040 | 229 |
| 280 | iso_pu_bacteria | 2856314179 | 2856319000 | 229 |
| 281 | iso_pu_bacteria | 2856364286 | 2856367775 | 229 |
| 282 | iso_pu_bacteria | 2857349434 | 2857353026 | 229 |
| 283 | iso_pu_bacteria | 2869285874 | 2869289905 | 229 |
| 284 | iso_pu_bacteria | 2871429161 | 2871432273 | 229 |
| 285 | iso_pu_bacteria | 2871444079 | 2871444232 | 229 |
| 286 | iso_pu_bacteria | 2871495908 | 2871498757 | 229 |
| 287 | iso_pu_bacteria | 2874102143 | 2874107165 | 229 |
| 288 | iso_pu_bacteria | 2874146452 | 2874152067 | 229 |
| 289 | iso_pu_bacteria | 2874155637 | 2874158743 | 229 |
| 290 | iso_pu_bacteria | 2876392853 | 2876396933 | 229 |
| 291 | iso_pu_bacteria | 2876413966 | 2876418067 | 229 |
| 292 | iso_pu_bacteria | 2878745973 | 2878749050 | 229 |
| 293 | iso_pu_bacteria | 2878760144 | 2878762975 | 229 |
| 294 | iso_pu_bacteria | 2878767105 | 2878769945 | 229 |
| 295 | iso_pu_bacteria | 2881147464 | 2881148309 | 229 |
| 296 | iso_pu_bacteria | 2881161766 | 2881165093 | 229 |
| 297 | iso_pu_bacteria | 2885305155 | 2885306970 | 229 |
| 298 | iso_pu_bacteria | 2885326080 | 2885329587 | 229 |
| 299 | iso_pu_bacteria | 2885334103 | 2885340860 | 229 |
| 300 | iso_pu_bacteria | 2885350715 | 2885356233 | 229 |
| 301 | iso_pu_bacteria | 2889010040 | 2889015015 | 229 |
| 302 | iso_pu_bacteria | 2889016732 | 2889019909 | 229 |
| 303 | iso_pu_bacteria | 2903492973 | 2903505173 | 229 |
| 304 | iso_pu_bacteria | 2903540706 | 2903543559 | 229 |
| 305 | iso_pu_bacteria | 2904659560 | 2904663687 | 229 |
| 306 | iso_pu_bacteria | 2906308376 | 2906311375 | 229 |
| 307 | iso_pu_bacteria | 2906321335 | 2906324137 | 229 |
| 308 | iso_pu_bacteria | 2906328253 | 2906334099 | 229 |
| 309 | iso_pu_bacteria | 2906414383 | 2906419071 | 229 |
| 310 | iso_pu_bacteria | 2922158528 | 2922162059 | 229 |
| 311 | iso_pu_bacteria | 2937813078 | 2937816714 | 229 |
| 312 | iso_pu_bacteria | 2937994558 | 2937997405 | 229 |
| 313 | iso_pu_bacteria | 2958100919 | 2958107185 | 229 |
| 314 | iso_pu_bacteria | 2958115193 | 2958120214 | 229 |
| 315 | iso_pu_bacteria | 2958130278 | 2958134277 | 229 |
| 316 | iso_pu_bacteria | 2958165035 | 2958167879 | 229 |
| 317 | iso_pu_bacteria | 2958172287 | 2958176809 | 229 |
| 318 | iso_pu_bacteria | 2958179912 | 2958183129 | 229 |
| 319 | iso_pu_bacteria | 2961077736 | 2961081084 | 229 |
| 320 | iso_pu_bacteria | 2961114664 | 2961119173 | 229 |
| 321 | iso_pu_bacteria | 2961127735 | 2961135897 | 229 |
| 322 | iso_pu_bacteria | 2961163497 | 2961166347 | 229 |
| 323 | iso_pu_bacteria | 2965018300 | 2965021166 | 229 |
| 324 | iso_pu_bacteria | 2965062239 | 2965069624 | 229 |
| 325 | iso_pu_bacteria | 2968091066 | 2968093321 | 229 |
| 326 | iso_pu_bacteria | 2968097103 | 2968100839 | 229 |
| 327 | iso_pu_bacteria | 2968110612 | 2968114826 | 229 |
| 328 | iso_pu_bacteria | 2968171901 | 2968174748 | 229 |
| 329 | iso_pu_bacteria | 2970554993 | 2970557830 | 229 |
| 330 | iso_pu_bacteria | 2977843712 | 2977847181 | 229 |
| 331 | iso_pu_bacteria | 2977858184 | 2977864015 | 229 |
| 332 | iso_pu_bacteria | 2977864932 | 2977869250 | 229 |
| 333 | iso_pu_bacteria | 2977942078 | 2977945622 | 229 |
| 334 | iso_pu_bacteria | 2977971508 | 2977979713 | 229 |
| 335 | iso_pu_bacteria | 2979710463 | 2979710645 | 229 |
| 336 | iso_pu_bacteria | 2979742915 | 2979751637 | 229 |
| 337 | iso_pu_bacteria | 2979779861 | 2979782327 | 229 |
| 338 | iso_pu_bacteria | 2987636660 | 2987641618 | 229 |
| 339 | iso_pu_bacteria | 2987659509 | 2987662355 | 229 |
| 340 | iso_pu_bacteria | 2996341866 | 2996342651 | 229 |
| 341 | iso_pu_bacteria | 3004188549 | 3004191406 | 229 |
| 342 | iso_pu_bacteria | 3004203850 | 3004209570 | 229 |
| 343 | iso_pu_bacteria | 3004334049 | 3004337151 | 229 |
| 344 | iso_pu_bacteria | 8004387939 | 8004392090 | 229 |
| 345 | iso_pu_bacteria | 8004445564 | 8004448619 | 229 |
| 346 | iso_pu_bacteria | 8004703790 | 8004706631 | 229 |
| 347 | iso_pu_bacteria | 8004714634 | 8004717721 | 229 |
| 348 | 3300048923 | Ga0496120_0068824 | Ga0496120_0068824_811_1542 | 230 |
| 349 | iso_pu_bacteria | 2996348954 | 2996349473 | 230 |
| 350 | iso_pu_bacteria | 3004275668 | 3004276181 | 230 |
| 351 | 3300006038 | Ga0075365_10071958 | Ga0075365_100719583 | 231 |
| 352 | 3300037418 | Ga0395900_0414928 | Ga0395900_0414928_258_953 | 231 |
| 353 | 3300050492 | nmdc:mga0yw44_51274_c1 | nmdc:mga0yw44_51274_c1_39_737 | 231 |
| 354 | iso_pu_bacteria | 2643221595 | 2643985898 | 231 |
| 355 | 3300005331 | Ga0070670_100998580 | Ga0070670_1009985801 | 232 |
| 356 | 3300006186 | Ga0075369_10037763 | Ga0075369_100377632 | 232 |
| 357 | 3300009093 | Ga0105240_10115085 | Ga0105240_101150853 | 232 |
| 358 | 3300025913 | Ga0207695_10076880 | Ga0207695_100768804 | 232 |
| 359 | 3300031911 | Ga0307412_10685256 | Ga0307412_106852561 | 232 |
| 360 | 3300046660 | Ga0495625_0008106 | Ga0495625_0008106_7005_7703 | 232 |
| 361 | 3300048091 | Ga0495626_0031871 | Ga0495626_0031871_1193_1891 | 232 |
| 362 | 3300048906 | Ga0496103_0253633 | Ga0496103_0253633_350_1048 | 232 |
| 363 | 3300050493 | nmdc:mga0k408_137635_c1 | nmdc:mga0k408_137635_c1_546_1244 | 232 |
| 364 | 3300053083 | Ga0495655_0016637 | Ga0495655_0016637_681_1379 | 232 |
| 365 | 3300053155 | Ga0500620_000218 | Ga0500620_000218_8819_9553 | 232 |
| 366 | iso_pu_bacteria | 2968128360 | 2968134064 | 232 |
| 367 | 3300002741 | JGI25157J39369_1002326 | JGI25157J39369_10023262 | 233 |
| 368 | 3300003214 | JGI25165J46597_1000079 | JGI25165J46597_10000796 | 233 |
| 369 | 3300005616 | Ga0068852_100209890 | Ga0068852_1002098903 | 233 |
| 370 | 3300005937 | Ga0081455_10295977 | Ga0081455_102959772 | 233 |
| 371 | 3300009093 | Ga0105240_10625418 | Ga0105240_106254182 | 233 |
| 372 | 3300009551 | Ga0105238_10006361 | Ga0105238_100063616 | 233 |
| 373 | 3300010375 | Ga0105239_10857208 | Ga0105239_108572082 | 233 |
| 374 | 3300013105 | Ga0157369_10103857 | Ga0157369_101038573 | 233 |
| 375 | 3300025250 | Ga0209026_1000141 | Ga0209026_100014131 | 233 |
| 376 | 3300025256 | Ga0209759_1000554 | Ga0209759_100055426 | 233 |
| 377 | 3300025261 | Ga0209233_1000247 | Ga0209233_100024782 | 233 |
| 378 | 3300025297 | Ga0209758_1004711 | Ga0209758_100471110 | 233 |
| 379 | 3300025904 | Ga0207647_10048553 | Ga0207647_100485532 | 233 |
| 380 | 3300025949 | Ga0207667_10109287 | Ga0207667_101092872 | 233 |
| 381 | 3300025972 | Ga0207668_10177548 | Ga0207668_101775483 | 233 |
| 382 | 3300026041 | Ga0207639_10239292 | Ga0207639_102392922 | 233 |
| 383 | 3300026116 | Ga0207674_10551527 | Ga0207674_105515272 | 233 |
| 384 | 3300037471 | Ga0395905_0096245 | Ga0395905_0096245_1752_2456 | 233 |
| 385 | 3300038443 | Ga0395901_0627772 | Ga0395901_0627772_46_750 | 233 |
| 386 | 3300046460 | Ga0495638_0186835 | Ga0495638_0186835_409_1116 | 233 |
| 387 | 3300046660 | Ga0495625_0424467 | Ga0495625_0424467_34_741 | 233 |
| 388 | 3300048905 | Ga0496102_0054560 | Ga0496102_0054560_2048_2752 | 233 |
| 389 | 3300048915 | Ga0496112_0408734 | Ga0496112_0408734_160_864 | 233 |
| 390 | 3300048923 | Ga0496120_0000466 | Ga0496120_0000466_27129_27833 | 233 |
| 391 | 3300053134 | Ga0500658_0180689 | Ga0500658_0180689_102_809 | 233 |
| 392 | 3300053151 | Ga0500604_0073261 | Ga0500604_0073261_63_767 | 233 |
| 393 | 3300053155 | Ga0500620_007921 | Ga0500620_007921_1860_2567 | 233 |
| 394 | 3300053158 | Ga0500627_0088150 | Ga0500627_0088150_325_1032 | 233 |
| 395 | 3300053158 | Ga0500627_0221059 | Ga0500627_0221059_108_812 | 233 |
| 396 | 3300053727 | Ga0500611_046698 | Ga0500611_046698_164_877 | 233 |
| 397 | iso_pu_bacteria | 2968117919 | 2968122562 | 233 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1t33-assembly1.cif.gz_B | structural genomics, the crystal structure of a putative transcriptional repressor (tetr/acrr family) from salmonella typhimurim lt2 | 0.942 | 17 | 225 |
| 1t33-assembly1.cif.gz_B | structural genomics, the crystal structure of a putative transcriptional repressor (tetr/acrr family) from salmonella typhimurim lt2 | 0.9165 | 17 | 225 |
| 3g7r-assembly1.cif.gz_B | crystal structure of sco4454, a tetr-family transcriptional regulator from streptomyces coelicolor | 0.8064 | 19 | 225 |
| 7e1n-assembly1.cif.gz_B | crystal structure of phlh in complex with 2,4-diacetylphloroglucinol | 0.7982 | 20 | 222 |
| 6o6n-assembly1.cif.gz_A | structure of the regulator fasr from mycobacterium tuberculosis in complex with c20-coa | 0.7975 | 19 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6mj1A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9949 | 20 | 62 | 1.10.10.60 |
| 1z77A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9784 | 20 | 62 | 1.10.10.60 |
| 1zkgA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9733 | 20 | 62 | 1.10.10.60 |
| 2id6A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9731 | 20 | 62 | 1.10.10.60 |
| 3bqzA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9725 | 20 | 66 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A659YHJ7-F1-model_v4 | deleted | 0.9963 | 111 | 224 |
|
| AF-A0A2P9HIC0-F1-model_v4 | Transcriptional regulator YbiH, TetR family | 0.9792 | 23 | 224 |
GO:0000976
GO:0003700 |
| AF-A0A4S0JWA0-F1-model_v4 | DUF1956 domain-containing protein | 0.9789 | 17 | 233 |
GO:0000976
GO:0003700 |
| AF-A0A529I012-F1-model_v4 | deleted | 0.9785 | 27 | 217 |
|
| AF-A0A7V6ZH76-F1-model_v4 | CerR family C-terminal domain-containing protein | 0.9764 | 17 | 223 |
GO:0000976
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar