F433923

General Info

Members Datasets Scaffolds Average Seq Length
397 329 159 225

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2885350715|2885356233
Length 245
Sequence TSVKPPHREASPAEQTRAALVHAALKLFGRQGFDGTSTREIAAEAKANIGSIAYHFGGKEGLRAAAADYIVDTIQTIAGQALGNQAVSAAQAPAPADAEAARAQLFTALERMVAFIVASPQAGEIVQFVLRELSHPTAALDRIYAGVFEPTHRRLCMIWEQATGEPAESERTRLTVFTLIGQVIYFRIGREAVMRRMGWREIGEAEAAKVVAIASDNLSAMLAARNLAARNPAAGTVAARKEGKS

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
6 2512875024 Mesorhizobium loti R88b Isolate Nodule
7 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
8 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
9 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
10 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
11 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
12 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
13 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
14 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
15 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
16 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
17 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
18 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
19 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
20 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
21 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
22 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
23 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
24 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
25 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
26 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
27 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
28 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
29 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
30 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
31 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
32 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
33 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
34 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
35 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
36 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
37 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
38 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
39 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
40 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
41 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
42 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
43 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
44 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
45 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
46 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
47 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
48 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
49 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
50 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
51 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
52 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
53 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
54 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
55 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
56 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
57 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
58 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
59 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
60 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
61 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
62 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
63 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
64 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
65 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
66 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
67 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
68 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
69 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
70 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
71 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
72 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
73 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
74 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
75 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
76 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
77 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
78 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
79 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
80 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
81 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
82 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
83 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
84 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
85 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
86 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
87 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
88 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
89 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
90 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
91 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
92 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
93 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
94 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
95 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
96 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
97 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
98 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
99 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
100 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
101 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
102 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
103 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
104 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
105 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
106 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
107 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
108 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
109 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
110 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
111 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
112 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
113 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
114 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
115 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
116 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
117 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
118 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
119 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
120 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
121 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
122 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
123 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
124 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
125 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
126 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
127 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
128 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
129 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
130 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
131 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
132 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
133 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
134 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
135 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
136 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
137 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
138 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
139 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
140 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
141 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
142 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
143 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
144 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
145 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
146 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
147 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
148 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
149 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
150 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
151 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
152 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
153 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
154 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
155 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
156 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
157 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
158 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
159 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
160 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
161 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
162 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
163 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
164 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
165 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
166 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
167 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
168 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
169 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
170 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
171 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
172 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
173 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
174 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
175 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
176 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
177 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
178 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
179 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
180 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
181 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
182 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
183 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
184 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
185 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
186 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
187 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
188 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
189 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
190 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
191 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
192 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
193 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
194 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
195 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
196 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
197 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
198 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
199 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
200 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
201 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
202 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
203 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
204 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
205 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
206 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
207 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
208 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
209 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
210 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
211 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
212 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
213 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
214 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
215 3004167301 Mesorhizobium loti 582 Isolate Unclassified
216 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
217 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
218 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
219 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
220 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
221 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
222 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
223 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
224 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
225 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
226 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
227 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
228 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
229 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
230 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
231 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
232 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
233 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
234 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
235 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
236 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
237 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
238 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
239 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
240 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
241 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
242 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
243 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
244 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
245 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
246 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
247 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
248 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
249 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
250 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
251 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
252 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
253 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
263 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
264 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
267 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
268 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
269 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
270 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
273 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
274 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
281 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
293 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
294 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
300 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
301 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
302 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
306 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
307 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
308 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
309 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
310 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
311 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
312 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
313 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
314 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
315 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
318 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
319 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
320 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
321 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
322 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
323 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
324 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
325 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
326 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
327 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
328 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
329 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 40.05
Metatranscriptomes 0
Isolates 59.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.79
Nodule 55.16
Rhizoplane 1.51
Rhizosphere 31.99
Stem 0
Stem Tuber 0
Unclassified 5.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1002326 3300002741 Bacteria 4935
2 JGI25406J46586_10024596 3300003203 Bacteria 2356
3 JGI25165J46597_1000079 3300003214 Bacteria 179163
4 Ga0070670_100998580 3300005331 Bacteria 761
5 Ga0070674_100315163 3300005356 Bacteria 1252
6 Ga0070659_100057793 3300005366 Bacteria 3060
7 Ga0068857_100670072 3300005577 Bacteria 984
8 Ga0068852_100209890 3300005616 Bacteria 1847
9 Ga0081455_10295977 3300005937 Bacteria 1163
10 Ga0081540_1149643 3300005983 Bacteria 923
11 Ga0081539_10008068 3300005985 Bacteria 9322
12 Ga0075365_10071958 3300006038 Bacteria 2328
13 Ga0075365_10414922 3300006038 Bacteria 950
14 Ga0075368_10039012 3300006042 Bacteria 1860
15 Ga0075363_100354394 3300006048 Bacteria 857
16 Ga0075362_10049694 3300006177 Bacteria 1874
17 Ga0075367_10325044 3300006178 Bacteria 969
18 Ga0075369_10037763 3300006186 Bacteria 2058
19 Ga0105240_10115085 3300009093 Bacteria 3247
20 Ga0105240_10580947 3300009093 Bacteria 1236
21 Ga0105240_10625418 3300009093 Bacteria 1183
22 Ga0105241_11141553 3300009174 Bacteria 735
23 Ga0105238_10006361 3300009551 Bacteria 11745
24 Ga0105239_10857208 3300010375 Bacteria 1042
25 Ga0157370_10399418 3300013104 Bacteria 1265
26 Ga0157369_10103857 3300013105 Bacteria 3027
27 Ga0157378_10262148 3300013297 Bacteria 1659
28 Ga0209026_1000141 3300025250 Bacteria 114545
29 Ga0209759_1000554 3300025256 Bacteria 38251
30 Ga0209233_1000247 3300025261 Bacteria 87890
31 Ga0209758_1004711 3300025297 Bacteria 11129
32 Ga0207647_10048553 3300025904 Bacteria 2635
33 Ga0207705_10370876 3300025909 Bacteria 1105
34 Ga0207695_10076880 3300025913 Bacteria 3392
35 Ga0207690_10064636 3300025932 Bacteria 2499
36 Ga0207667_10109287 3300025949 Bacteria 2852
37 Ga0207668_10177548 3300025972 Bacteria 1677
38 Ga0207639_10239292 3300026041 Bacteria 1577
39 Ga0207678_10045026 3300026067 Bacteria 3815
40 Ga0207674_10551527 3300026116 Bacteria 1113
41 Ga0207674_10956172 3300026116 Bacteria 825
42 Ga0307412_10685256 3300031911 Bacteria 878
43 Ga0307412_10865732 3300031911 Bacteria 789
44 Ga0307411_10450477 3300032005 Bacteria 1077
45 Ga0395900_0372398 3300037418 Bacteria 1398
46 Ga0395900_0414928 3300037418 Bacteria 1308
47 Ga0395905_0096245 3300037471 Bacteria 2779
48 Ga0395905_0650324 3300037471 Bacteria 956
49 Ga0395901_0627772 3300038443 Bacteria 1080
50 Ga0436361_0858198 3300039447 Bacteria 8320
51 Ga0439465_0013194 3300041413 Bacteria 2580
52 Ga0439445_0083800 3300042004 Bacteria 893
53 Ga0466972_0168120 3300044658 Bacteria 1029
54 Ga0495638_0186835 3300046460 Bacteria 1178
55 Ga0495668_0036488 3300046616 Bacteria 2754
56 Ga0495625_0008106 3300046660 Bacteria 9004
57 Ga0495625_0424467 3300046660 Bacteria 826
58 Ga0495626_0031871 3300048091 Bacteria 2534
59 Ga0496101_0632186 3300048904 Bacteria 846
60 Ga0496102_0054560 3300048905 Bacteria 3645
61 Ga0496103_0253633 3300048906 Bacteria 1132
62 Ga0496106_0377862 3300048909 Bacteria 1139
63 Ga0496112_0408734 3300048915 Bacteria 1297
64 Ga0496120_0000466 3300048923 Bacteria 63527
65 Ga0496120_0068824 3300048923 Bacteria 1951
66 Ga0501031_0041984 3300049568 Bacteria 2986
67 Ga0501031_0124130 3300049568 Bacteria 1686
68 Ga0501032_0000001 3300049569 Bacteria 422097
69 Ga0501032_0001391 3300049569 Bacteria 19212
70 Ga0501033_0000275 3300049570 Bacteria 49587
71 Ga0501033_0000304 3300049570 Bacteria 46485
72 Ga0501033_0004330 3300049570 Bacteria 11389
73 Ga0501033_0059675 3300049570 Bacteria 2817
74 Ga0501033_0087459 3300049570 Bacteria 2281
75 Ga0501034_0000036 3300049571 Bacteria 239274
76 Ga0501034_0004395 3300049571 Bacteria 15700
77 Ga0501034_0030240 3300049571 Bacteria 5505
78 Ga0501034_0112491 3300049571 Bacteria 2712
79 Ga0501034_0166341 3300049571 Bacteria 2174
80 Ga0501034_0882365 3300049571 Bacteria 783
81 Ga0501034_0935548 3300049571 Bacteria 753
82 Ga0501036_0000358 3300049572 Bacteria 32271
83 Ga0501036_0302294 3300049572 Bacteria 1338
84 Ga0501037_0000091 3300049573 Bacteria 84811
85 Ga0501037_0000154 3300049573 Bacteria 64077
86 Ga0501037_0313552 3300049573 Bacteria 1087
87 Ga0501037_0394233 3300049573 Bacteria 950
88 Ga0501038_0003916 3300049574 Bacteria 13845
89 Ga0501038_0021125 3300049574 Bacteria 5848
90 Ga0501039_0000011 3300049575 Bacteria 245124
91 Ga0501039_0164375 3300049575 Bacteria 1745
92 Ga0501039_0615556 3300049575 Bacteria 851
93 Ga0501043_0000007 3300049579 Bacteria 224595
94 Ga0501043_0000016 3300049579 Bacteria 170869
95 Ga0501043_0029815 3300049579 Bacteria 4287
96 Ga0501043_0128573 3300049579 Bacteria 1986
97 Ga0501043_0343726 3300049579 Bacteria 1134
98 Ga0501046_0093320 3300049580 Bacteria 2314
99 Ga0501046_0500056 3300049580 Bacteria 871
100 Ga0501047_0078162 3300049581 Bacteria 3182
101 Ga0501047_0109180 3300049581 Bacteria 2649
102 Ga0501047_0135357 3300049581 Bacteria 2344
103 Ga0501047_0232741 3300049581 Bacteria 1695
104 Ga0501047_0290110 3300049581 Bacteria 1480
105 Ga0501047_0305352 3300049581 Bacteria 1433
106 Ga0501047_0438765 3300049581 Bacteria 1136
107 Ga0501047_0504851 3300049581 Bacteria 1036
108 Ga0501067_0058436 3300049583 Bacteria 2136
109 Ga0501068_0005949 3300049584 Bacteria 6695
110 Ga0501069_0000027 3300049585 Bacteria 106217
111 Ga0501069_0028850 3300049585 Bacteria 3044
112 Ga0501070_0000650 3300049586 Bacteria 31944
113 Ga0501070_0023230 3300049586 Bacteria 5194
114 Ga0501070_0031603 3300049586 Bacteria 4435
115 Ga0501070_0170962 3300049586 Bacteria 1790
116 Ga0501070_0558283 3300049586 Bacteria 916
117 Ga0501071_0004099 3300049587 Bacteria 9216
118 Ga0501071_0127828 3300049587 Bacteria 1887
119 Ga0501073_0022973 3300049589 Bacteria 4485
120 Ga0501073_0479208 3300049589 Bacteria 860
121 Ga0501074_0000066 3300049590 Bacteria 50258
122 Ga0501074_0079532 3300049590 Bacteria 2352
123 Ga0501075_0436448 3300049591 Bacteria 999
124 Ga0501076_0218089 3300049592 Bacteria 1559
125 Ga0501080_0000667 3300049742 Bacteria 27300
126 Ga0501080_0002747 3300049742 Bacteria 15450
127 Ga0501080_0021270 3300049742 Bacteria 6005
128 Ga0501080_0167488 3300049742 Bacteria 2027
129 Ga0501083_0000012 3300049744 Bacteria 178668
130 Ga0501035_0000073 3300049822 Bacteria 122603
131 Ga0501035_0000806 3300049822 Bacteria 33416
132 Ga0501035_0004944 3300049822 Bacteria 12646
133 Ga0501035_0018465 3300049822 Bacteria 6424
134 Ga0501035_0252654 3300049822 Bacteria 1496
135 Ga0501035_0281877 3300049822 Bacteria 1404
136 Ga0501035_0621941 3300049822 Bacteria 878
137 Ga0501044_0000118 3300049823 Bacteria 95218
138 Ga0501044_0015666 3300049823 Bacteria 8165
139 Ga0501044_0025239 3300049823 Bacteria 6301
140 Ga0501044_0030135 3300049823 Bacteria 5719
141 Ga0501044_0052587 3300049823 Bacteria 4196
142 Ga0501044_0107349 3300049823 Bacteria 2803
143 Ga0501044_0267612 3300049823 Bacteria 1646
144 nmdc:mga03n38_114765_c1 3300050490 Bacteria 949
145 nmdc:mga0yw44_453_c1 3300050492 Bacteria 14505
146 nmdc:mga0yw44_51274_c1 3300050492 Bacteria 2498
147 nmdc:mga0k408_137635_c1 3300050493 Bacteria 1451
148 nmdc:mga04h51_95438_c1 3300050495 Bacteria 1076
149 nmdc:mga0sz30_39435_c1 3300050516 Bacteria 1981
150 Ga0495655_0016637 3300053083 Bacteria 1588
151 Ga0495655_0152776 3300053083 Bacteria 727
152 Ga0500658_0180689 3300053134 Bacteria 960
153 Ga0500604_0073261 3300053151 Bacteria 1095
154 Ga0500620_000218 3300053155 Bacteria 11324
155 Ga0500620_007921 3300053155 Bacteria 2653
156 Ga0500627_0088150 3300053158 Bacteria 1387
157 Ga0500627_0221059 3300053158 Bacteria 845
158 Ga0500611_046698 3300053727 Bacteria 975
159 Ga0501082_0027361 3300060353 Bacteria 4909

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0615556 Ga0501039_0615556_210_803 196
2 3300049823 Ga0501044_0267612 Ga0501044_0267612_1018_1629 199
3 iso_pu_bacteria 2869242130 2869242408 201
4 iso_pu_bacteria 2977907340 2977910786 201
5 iso_pu_bacteria 2906354277 2906354956 202
6 3300009174 Ga0105241_11141553 Ga0105241_111415531 205
7 iso_pu_bacteria 2869169390 2869172365 205
8 iso_pu_bacteria 2869234852 2869235052 205
9 iso_pu_bacteria 2871481445 2871482743 205
10 iso_pu_bacteria 2874109183 2874110183 205
11 iso_pu_bacteria 2874116593 2874117570 205
12 iso_pu_bacteria 2874168670 2874173349 205
13 iso_pu_bacteria 2876386047 2876389970 205
14 iso_pu_bacteria 2876420981 2876424690 205
15 iso_pu_bacteria 2878730984 2878736920 205
16 iso_pu_bacteria 2903513507 2903519805 205
17 iso_pu_bacteria 2906401398 2906402220 205
18 iso_pu_bacteria 2924710171 2924711962 205
19 iso_pu_bacteria 2924741084 2924742642 205
20 iso_pu_bacteria 3004268573 3004272091 205
21 iso_pu_bacteria 2874123672 2874126230 206
22 iso_pu_bacteria 2876377896 2876378410 208
23 iso_pu_bacteria 2938014810 2938017651 208
24 3300049571 Ga0501034_0030240 Ga0501034_0030240_3419_4102 209
25 3300049581 Ga0501047_0438765 Ga0501047_0438765_330_1013 209
26 3300006048 Ga0075363_100354394 Ga0075363_1003543941 210
27 3300006177 Ga0075362_10049694 Ga0075362_100496943 210
28 3300050490 nmdc:mga03n38_114765_c1 nmdc:mga03n38_114765_c1_253_888 210
29 3300050495 nmdc:mga04h51_95438_c1 nmdc:mga04h51_95438_c1_125_760 210
30 3300050516 nmdc:mga0sz30_39435_c1 nmdc:mga0sz30_39435_c1_736_1371 210
31 iso_pu_bacteria 2509276018 2509368848 210
32 iso_pu_bacteria 2687453392 2688596107 210
33 iso_pu_bacteria 2856328259 2856332413 210
34 iso_pu_bacteria 2857367948 2857375634 210
35 iso_pu_bacteria 2869271264 2869277697 210
36 iso_pu_bacteria 2874131515 2874133864 210
37 iso_pu_bacteria 2874162495 2874166031 210
38 iso_pu_bacteria 2876399893 2876404476 210
39 iso_pu_bacteria 2876406927 2876410243 210
40 iso_pu_bacteria 2878781027 2878787627 210
41 iso_pu_bacteria 2906386501 2906389874 210
42 iso_pu_bacteria 2906393657 2906395215 210
43 iso_pu_bacteria 2906408224 2906410488 210
44 iso_pu_bacteria 2922151315 2922154141 210
45 iso_pu_bacteria 2922172374 2922175578 210
46 iso_pu_bacteria 2922178524 2922183550 210
47 iso_pu_bacteria 2924748358 2924752882 210
48 iso_pu_bacteria 2937868953 2937876607 210
49 iso_pu_bacteria 2958122699 2958129952 210
50 iso_pu_bacteria 2958137437 2958139708 210
51 iso_pu_bacteria 2958158011 2958164112 210
52 iso_pu_bacteria 2961136820 2961141584 210
53 iso_pu_bacteria 2965025482 2965029861 210
54 iso_pu_bacteria 2965032056 2965039920 210
55 iso_pu_bacteria 2965047637 2965054186 210
56 iso_pu_bacteria 2965102966 2965107612 210
57 iso_pu_bacteria 2970547951 2970553161 210
58 iso_pu_bacteria 2977935797 2977938729 210
59 iso_pu_bacteria 2987645492 2987649991 210
60 iso_pu_bacteria 2987673487 2987673488 210
61 iso_pu_bacteria 3004239961 3004246400 210
62 iso_pu_bacteria 8004300914 8004303147 210
63 iso_pu_bacteria 8004361976 8004366993 210
64 iso_pu_bacteria 8004695233 8004699106 210
65 3300049580 Ga0501046_0500056 Ga0501046_0500056_198_848 212
66 3300049581 Ga0501047_0504851 Ga0501047_0504851_67_717 212
67 3300049589 Ga0501073_0479208 Ga0501073_0479208_57_707 212
68 3300049591 Ga0501075_0436448 Ga0501075_0436448_270_917 212
69 3300041413 Ga0439465_0013194 Ga0439465_0013194_1315_2007 213
70 3300042004 Ga0439445_0083800 Ga0439445_0083800_35_727 213
71 3300006038 Ga0075365_10414922 Ga0075365_104149222 214
72 3300006042 Ga0075368_10039012 Ga0075368_100390122 214
73 3300006178 Ga0075367_10325044 Ga0075367_103250442 214
74 3300039447 Ga0436361_0858198 Ga0436361_0858198_4846_5529 214
75 3300050492 nmdc:mga0yw44_453_c1 nmdc:mga0yw44_453_c1_13269_14000 214
76 3300053083 Ga0495655_0152776 Ga0495655_0152776_60_713 215
77 3300037418 Ga0395900_0372398 Ga0395900_0372398_51_722 216
78 3300005366 Ga0070659_100057793 Ga0070659_1000577933 217
79 3300005577 Ga0068857_100670072 Ga0068857_1006700722 217
80 3300013104 Ga0157370_10399418 Ga0157370_103994181 217
81 3300025909 Ga0207705_10370876 Ga0207705_103708761 217
82 3300025932 Ga0207690_10064636 Ga0207690_100646363 217
83 3300026067 Ga0207678_10045026 Ga0207678_100450265 217
84 3300026116 Ga0207674_10956172 Ga0207674_109561721 217
85 3300049568 Ga0501031_0041984 Ga0501031_0041984_888_1547 217
86 3300049569 Ga0501032_0001391 Ga0501032_0001391_11758_12417 217
87 3300049570 Ga0501033_0000304 Ga0501033_0000304_24884_25543 217
88 3300049570 Ga0501033_0059675 Ga0501033_0059675_2108_2773 217
89 3300049570 Ga0501033_0087459 Ga0501033_0087459_1111_1776 217
90 3300049571 Ga0501034_0882365 Ga0501034_0882365_50_709 217
91 3300049573 Ga0501037_0000154 Ga0501037_0000154_46287_46982 217
92 3300049574 Ga0501038_0021125 Ga0501038_0021125_2035_2694 217
93 3300049575 Ga0501039_0164375 Ga0501039_0164375_668_1327 217
94 3300049579 Ga0501043_0000007 Ga0501043_0000007_35558_36217 217
95 3300049579 Ga0501043_0029815 Ga0501043_0029815_2213_2914 217
96 3300049581 Ga0501047_0109180 Ga0501047_0109180_1831_2490 217
97 3300049581 Ga0501047_0135357 Ga0501047_0135357_1362_2027 217
98 3300049583 Ga0501067_0058436 Ga0501067_0058436_110_769 217
99 3300049584 Ga0501068_0005949 Ga0501068_0005949_5068_5727 217
100 3300049585 Ga0501069_0000027 Ga0501069_0000027_69996_70655 217
101 3300049585 Ga0501069_0028850 Ga0501069_0028850_273_938 217
102 3300049586 Ga0501070_0000650 Ga0501070_0000650_26263_26922 217
103 3300049586 Ga0501070_0023230 Ga0501070_0023230_2403_3086 217
104 3300049586 Ga0501070_0170962 Ga0501070_0170962_20_685 217
105 3300049587 Ga0501071_0004099 Ga0501071_0004099_486_1145 217
106 3300049587 Ga0501071_0127828 Ga0501071_0127828_749_1414 217
107 3300049589 Ga0501073_0022973 Ga0501073_0022973_867_1562 217
108 3300049590 Ga0501074_0000066 Ga0501074_0000066_20297_20956 217
109 3300049592 Ga0501076_0218089 Ga0501076_0218089_888_1547 217
110 3300049742 Ga0501080_0000667 Ga0501080_0000667_22912_23571 217
111 3300049742 Ga0501080_0021270 Ga0501080_0021270_1276_1941 217
112 3300049742 Ga0501080_0167488 Ga0501080_0167488_1069_1734 217
113 3300049744 Ga0501083_0000012 Ga0501083_0000012_142295_142954 217
114 3300049822 Ga0501035_0000073 Ga0501035_0000073_63057_63716 217
115 3300049822 Ga0501035_0004944 Ga0501035_0004944_9128_9793 217
116 3300049822 Ga0501035_0252654 Ga0501035_0252654_155_820 217
117 3300049822 Ga0501035_0621941 Ga0501035_0621941_56_721 217
118 3300049823 Ga0501044_0000118 Ga0501044_0000118_58974_59633 217
119 3300049823 Ga0501044_0030135 Ga0501044_0030135_3241_3906 217
120 3300049823 Ga0501044_0107349 Ga0501044_0107349_2109_2774 217
121 3300060353 Ga0501082_0027361 Ga0501082_0027361_1103_1762 217
122 iso_pu_bacteria 2922130491 2922130923 217
123 iso_pu_bacteria 2965119406 2965123930 217
124 3300049570 Ga0501033_0004330 Ga0501033_0004330_7804_8466 218
125 3300049571 Ga0501034_0166341 Ga0501034_0166341_578_1240 218
126 3300049571 Ga0501034_0935548 Ga0501034_0935548_24_686 218
127 3300049573 Ga0501037_0313552 Ga0501037_0313552_333_995 218
128 3300049581 Ga0501047_0078162 Ga0501047_0078162_1399_2061 218
129 3300049581 Ga0501047_0305352 Ga0501047_0305352_726_1388 218
130 3300049586 Ga0501070_0031603 Ga0501070_0031603_977_1639 218
131 3300049586 Ga0501070_0558283 Ga0501070_0558283_186_884 218
132 3300049590 Ga0501074_0079532 Ga0501074_0079532_1119_1781 218
133 3300049742 Ga0501080_0002747 Ga0501080_0002747_1847_2509 218
134 3300049822 Ga0501035_0000806 Ga0501035_0000806_14452_15114 218
135 3300049822 Ga0501035_0281877 Ga0501035_0281877_698_1360 218
136 3300049823 Ga0501044_0015666 Ga0501044_0015666_2641_3303 218
137 3300049823 Ga0501044_0025239 Ga0501044_0025239_2876_3538 218
138 3300049579 Ga0501043_0343726 Ga0501043_0343726_41_862 219
139 iso_pu_bacteria 2878035449 2878039344 219
140 3300049571 Ga0501034_0004395 Ga0501034_0004395_8996_9673 220
141 iso_pu_bacteria 2513237351 2514586242 220
142 iso_pu_bacteria 2869278585 2869284860 220
143 iso_pu_bacteria 2937877337 2937878389 220
144 iso_pu_bacteria 2958034702 2958038176 220
145 iso_pu_bacteria 2958041894 2958042259 220
146 iso_pu_bacteria 2958084443 2958085662 220
147 iso_pu_bacteria 2958092219 2958093054 220
148 iso_pu_bacteria 2970593180 2970599471 220
149 iso_pu_bacteria 2996336353 2996341448 220
150 3300049571 Ga0501034_0112491 Ga0501034_0112491_1159_1839 221
151 3300049572 Ga0501036_0302294 Ga0501036_0302294_627_1310 221
152 3300049573 Ga0501037_0394233 Ga0501037_0394233_101_781 221
153 3300049579 Ga0501043_0128573 Ga0501043_0128573_1278_1958 221
154 3300049581 Ga0501047_0232741 Ga0501047_0232741_172_852 221
155 iso_pu_bacteria 2844009547 2844010916 221
156 iso_pu_bacteria 2869256925 2869261561 221
157 iso_pu_bacteria 2871435913 2871436328 221
158 iso_pu_bacteria 2906427513 2906430028 221
159 iso_pu_bacteria 2924726620 2924731390 221
160 iso_pu_bacteria 2958108152 2958109344 221
161 iso_pu_bacteria 2961183825 2961187659 221
162 iso_pu_bacteria 2968138860 2968145158 221
163 iso_pu_bacteria 2970510686 2970510754 221
164 iso_pu_bacteria 2970532167 2970534926 221
165 iso_pu_bacteria 2970619444 2970622411 221
166 iso_pu_bacteria 2970627176 2970632087 221
167 iso_pu_bacteria 2977851361 2977855315 221
168 iso_pu_bacteria 2977898635 2977899947 221
169 iso_pu_bacteria 2979772303 2979776147 221
170 iso_pu_bacteria 2996386984 2996392462 221
171 iso_pu_bacteria 3004232784 3004237235 221
172 iso_pu_bacteria 3004248173 3004251864 221
173 iso_pu_bacteria 8004312739 8004313667 221
174 iso_pu_bacteria 8004727605 8004730567 221
175 3300005983 Ga0081540_1149643 Ga0081540_11496431 222
176 iso_pu_bacteria 2643221564 2643838393 222
177 iso_pu_bacteria 2885312484 2885314027 222
178 iso_pu_bacteria 2888337043 2888343487 222
179 iso_pu_bacteria 2937861824 2937864907 222
180 iso_pu_bacteria 3004167301 3004173418 222
181 3300049568 Ga0501031_0124130 Ga0501031_0124130_390_1091 223
182 3300049569 Ga0501032_0000001 Ga0501032_0000001_188045_188746 223
183 3300049570 Ga0501033_0000275 Ga0501033_0000275_39250_39951 223
184 3300049571 Ga0501034_0000036 Ga0501034_0000036_232363_233064 223
185 3300049572 Ga0501036_0000358 Ga0501036_0000358_18147_18848 223
186 3300049573 Ga0501037_0000091 Ga0501037_0000091_47408_48109 223
187 3300049574 Ga0501038_0003916 Ga0501038_0003916_9740_10441 223
188 3300049575 Ga0501039_0000011 Ga0501039_0000011_234812_235513 223
189 3300049579 Ga0501043_0000016 Ga0501043_0000016_155433_156134 223
190 3300049580 Ga0501046_0093320 Ga0501046_0093320_960_1661 223
191 3300049581 Ga0501047_0290110 Ga0501047_0290110_637_1338 223
192 3300049822 Ga0501035_0018465 Ga0501035_0018465_1572_2273 223
193 3300049823 Ga0501044_0052587 Ga0501044_0052587_352_1053 223
194 iso_pu_bacteria 2503198000 2503198830 223
195 iso_pu_bacteria 2510065059 2510315175 223
196 iso_pu_bacteria 2791355123 2792747314 223
197 iso_pu_bacteria 8055617313 8055618003 223
198 3300032005 Ga0307411_10450477 Ga0307411_104504771 224
199 iso_pu_bacteria 2512875024 2512961953 224
200 iso_pu_bacteria 2856342000 2856348639 224
201 iso_pu_bacteria 2869162929 2869168280 224
202 iso_pu_bacteria 2882632389 2882636805 224
203 iso_pu_bacteria 3000135777 3000137496 224
204 3300031911 Ga0307412_10865732 Ga0307412_108657321 225
205 iso_pu_bacteria 2871488783 2871491522 225
206 iso_pu_bacteria 2878753008 2878754860 225
207 iso_pu_bacteria 2881845957 2881850844 225
208 iso_pu_bacteria 2882912400 2882919725 225
209 iso_pu_bacteria 2885318864 2885324018 225
210 iso_pu_bacteria 2903492973 2903500395 225
211 iso_pu_bacteria 2924784321 2924787337 225
212 iso_pu_bacteria 2937891427 2937898283 225
213 iso_pu_bacteria 2967996073 2967997373 225
214 iso_pu_bacteria 2968003550 2968006375 225
215 iso_pu_bacteria 2977821940 2977824077 225
216 iso_pu_bacteria 2977828996 2977835500 225
217 iso_pu_bacteria 8004374579 8004376442 225
218 3300003203 JGI25406J46586_10024596 JGI25406J46586_100245962 226
219 3300005985 Ga0081539_10008068 Ga0081539_1000806813 226
220 3300037471 Ga0395905_0650324 Ga0395905_0650324_97_801 226
221 iso_pu_bacteria 2508501123 2509118754 226
222 iso_pu_bacteria 2856334872 2856340337 226
223 iso_pu_bacteria 2869249662 2869249829 226
224 iso_pu_bacteria 2869264136 2869267866 226
225 iso_pu_bacteria 2871451962 2871457142 226
226 iso_pu_bacteria 2871459585 2871462863 226
227 iso_pu_bacteria 2878774303 2878776478 226
228 iso_pu_bacteria 2906363423 2906366507 226
229 iso_pu_bacteria 2906370794 2906371239 226
230 iso_pu_bacteria 2965040258 2965046167 226
231 iso_pu_bacteria 2965089291 2965093011 226
232 iso_pu_bacteria 2977872689 2977874504 226
233 iso_pu_bacteria 2977915119 2977920936 226
234 iso_pu_bacteria 2977950692 2977953693 226
235 iso_pu_bacteria 2979793036 2979799479 226
236 iso_pu_bacteria 3004195979 3004200360 226
237 iso_pu_bacteria 649633066 649870667 226
238 3300046616 Ga0495668_0036488 Ga0495668_0036488_1679_2368 227
239 iso_pu_bacteria 2856320880 2856323746 227
240 iso_pu_bacteria 2874139085 2874142821 227
241 iso_pu_bacteria 2878738818 2878741112 227
242 iso_pu_bacteria 2924718760 2924724268 227
243 iso_pu_bacteria 2924776078 2924778713 227
244 iso_pu_bacteria 2937972304 2937975715 227
245 iso_pu_bacteria 2958144490 2958150517 227
246 iso_pu_bacteria 2961170736 2961172051 227
247 iso_pu_bacteria 2968016561 2968017364 227
248 iso_pu_bacteria 2970469710 2970470723 227
249 iso_pu_bacteria 2970503327 2970504648 227
250 iso_pu_bacteria 2979808191 2979809286 227
251 iso_pu_bacteria 8004640170 8004645280 227
252 3300005356 Ga0070674_100315163 Ga0070674_1003151632 228
253 3300009093 Ga0105240_10580947 Ga0105240_105809472 228
254 3300013297 Ga0157378_10262148 Ga0157378_102621481 228
255 3300044658 Ga0466972_0168120 Ga0466972_0168120_64_768 228
256 3300048904 Ga0496101_0632186 Ga0496101_0632186_60_764 228
257 iso_pu_bacteria 2509276022 2509393738 228
258 iso_pu_bacteria 2643221627 2644154390 228
259 iso_pu_bacteria 2756170246 2756675180 228
260 iso_pu_bacteria 2844002411 2844003326 228
261 iso_pu_bacteria 2856349417 2856350643 228
262 iso_pu_bacteria 2871466892 2871471525 228
263 iso_pu_bacteria 2881155292 2881159389 228
264 iso_pu_bacteria 2885342637 2885343844 228
265 iso_pu_bacteria 2906378014 2906383690 228
266 iso_pu_bacteria 2924733363 2924738510 228
267 iso_pu_bacteria 2924762789 2924766096 228
268 iso_pu_bacteria 2937822353 2937822720 228
269 iso_pu_bacteria 2958064165 2958071038 228
270 iso_pu_bacteria 2970489779 2970492866 228
271 iso_pu_bacteria 2987666974 2987667026 228
272 3300048909 Ga0496106_0377862 Ga0496106_0377862_381_1121 229
273 iso_pu_bacteria 2513237164 2514038896 229
274 iso_pu_bacteria 2513237305 2514417553 229
275 iso_pu_bacteria 2599185301 2599938929 229
276 iso_pu_bacteria 2693429783 2694627843 229
277 iso_pu_bacteria 2721755686 2723573205 229
278 iso_pu_bacteria 2847670302 2847673531 229
279 iso_pu_bacteria 2847686936 2847690040 229
280 iso_pu_bacteria 2856314179 2856319000 229
281 iso_pu_bacteria 2856364286 2856367775 229
282 iso_pu_bacteria 2857349434 2857353026 229
283 iso_pu_bacteria 2869285874 2869289905 229
284 iso_pu_bacteria 2871429161 2871432273 229
285 iso_pu_bacteria 2871444079 2871444232 229
286 iso_pu_bacteria 2871495908 2871498757 229
287 iso_pu_bacteria 2874102143 2874107165 229
288 iso_pu_bacteria 2874146452 2874152067 229
289 iso_pu_bacteria 2874155637 2874158743 229
290 iso_pu_bacteria 2876392853 2876396933 229
291 iso_pu_bacteria 2876413966 2876418067 229
292 iso_pu_bacteria 2878745973 2878749050 229
293 iso_pu_bacteria 2878760144 2878762975 229
294 iso_pu_bacteria 2878767105 2878769945 229
295 iso_pu_bacteria 2881147464 2881148309 229
296 iso_pu_bacteria 2881161766 2881165093 229
297 iso_pu_bacteria 2885305155 2885306970 229
298 iso_pu_bacteria 2885326080 2885329587 229
299 iso_pu_bacteria 2885334103 2885340860 229
300 iso_pu_bacteria 2885350715 2885356233 229
301 iso_pu_bacteria 2889010040 2889015015 229
302 iso_pu_bacteria 2889016732 2889019909 229
303 iso_pu_bacteria 2903492973 2903505173 229
304 iso_pu_bacteria 2903540706 2903543559 229
305 iso_pu_bacteria 2904659560 2904663687 229
306 iso_pu_bacteria 2906308376 2906311375 229
307 iso_pu_bacteria 2906321335 2906324137 229
308 iso_pu_bacteria 2906328253 2906334099 229
309 iso_pu_bacteria 2906414383 2906419071 229
310 iso_pu_bacteria 2922158528 2922162059 229
311 iso_pu_bacteria 2937813078 2937816714 229
312 iso_pu_bacteria 2937994558 2937997405 229
313 iso_pu_bacteria 2958100919 2958107185 229
314 iso_pu_bacteria 2958115193 2958120214 229
315 iso_pu_bacteria 2958130278 2958134277 229
316 iso_pu_bacteria 2958165035 2958167879 229
317 iso_pu_bacteria 2958172287 2958176809 229
318 iso_pu_bacteria 2958179912 2958183129 229
319 iso_pu_bacteria 2961077736 2961081084 229
320 iso_pu_bacteria 2961114664 2961119173 229
321 iso_pu_bacteria 2961127735 2961135897 229
322 iso_pu_bacteria 2961163497 2961166347 229
323 iso_pu_bacteria 2965018300 2965021166 229
324 iso_pu_bacteria 2965062239 2965069624 229
325 iso_pu_bacteria 2968091066 2968093321 229
326 iso_pu_bacteria 2968097103 2968100839 229
327 iso_pu_bacteria 2968110612 2968114826 229
328 iso_pu_bacteria 2968171901 2968174748 229
329 iso_pu_bacteria 2970554993 2970557830 229
330 iso_pu_bacteria 2977843712 2977847181 229
331 iso_pu_bacteria 2977858184 2977864015 229
332 iso_pu_bacteria 2977864932 2977869250 229
333 iso_pu_bacteria 2977942078 2977945622 229
334 iso_pu_bacteria 2977971508 2977979713 229
335 iso_pu_bacteria 2979710463 2979710645 229
336 iso_pu_bacteria 2979742915 2979751637 229
337 iso_pu_bacteria 2979779861 2979782327 229
338 iso_pu_bacteria 2987636660 2987641618 229
339 iso_pu_bacteria 2987659509 2987662355 229
340 iso_pu_bacteria 2996341866 2996342651 229
341 iso_pu_bacteria 3004188549 3004191406 229
342 iso_pu_bacteria 3004203850 3004209570 229
343 iso_pu_bacteria 3004334049 3004337151 229
344 iso_pu_bacteria 8004387939 8004392090 229
345 iso_pu_bacteria 8004445564 8004448619 229
346 iso_pu_bacteria 8004703790 8004706631 229
347 iso_pu_bacteria 8004714634 8004717721 229
348 3300048923 Ga0496120_0068824 Ga0496120_0068824_811_1542 230
349 iso_pu_bacteria 2996348954 2996349473 230
350 iso_pu_bacteria 3004275668 3004276181 230
351 3300006038 Ga0075365_10071958 Ga0075365_100719583 231
352 3300037418 Ga0395900_0414928 Ga0395900_0414928_258_953 231
353 3300050492 nmdc:mga0yw44_51274_c1 nmdc:mga0yw44_51274_c1_39_737 231
354 iso_pu_bacteria 2643221595 2643985898 231
355 3300005331 Ga0070670_100998580 Ga0070670_1009985801 232
356 3300006186 Ga0075369_10037763 Ga0075369_100377632 232
357 3300009093 Ga0105240_10115085 Ga0105240_101150853 232
358 3300025913 Ga0207695_10076880 Ga0207695_100768804 232
359 3300031911 Ga0307412_10685256 Ga0307412_106852561 232
360 3300046660 Ga0495625_0008106 Ga0495625_0008106_7005_7703 232
361 3300048091 Ga0495626_0031871 Ga0495626_0031871_1193_1891 232
362 3300048906 Ga0496103_0253633 Ga0496103_0253633_350_1048 232
363 3300050493 nmdc:mga0k408_137635_c1 nmdc:mga0k408_137635_c1_546_1244 232
364 3300053083 Ga0495655_0016637 Ga0495655_0016637_681_1379 232
365 3300053155 Ga0500620_000218 Ga0500620_000218_8819_9553 232
366 iso_pu_bacteria 2968128360 2968134064 232
367 3300002741 JGI25157J39369_1002326 JGI25157J39369_10023262 233
368 3300003214 JGI25165J46597_1000079 JGI25165J46597_10000796 233
369 3300005616 Ga0068852_100209890 Ga0068852_1002098903 233
370 3300005937 Ga0081455_10295977 Ga0081455_102959772 233
371 3300009093 Ga0105240_10625418 Ga0105240_106254182 233
372 3300009551 Ga0105238_10006361 Ga0105238_100063616 233
373 3300010375 Ga0105239_10857208 Ga0105239_108572082 233
374 3300013105 Ga0157369_10103857 Ga0157369_101038573 233
375 3300025250 Ga0209026_1000141 Ga0209026_100014131 233
376 3300025256 Ga0209759_1000554 Ga0209759_100055426 233
377 3300025261 Ga0209233_1000247 Ga0209233_100024782 233
378 3300025297 Ga0209758_1004711 Ga0209758_100471110 233
379 3300025904 Ga0207647_10048553 Ga0207647_100485532 233
380 3300025949 Ga0207667_10109287 Ga0207667_101092872 233
381 3300025972 Ga0207668_10177548 Ga0207668_101775483 233
382 3300026041 Ga0207639_10239292 Ga0207639_102392922 233
383 3300026116 Ga0207674_10551527 Ga0207674_105515272 233
384 3300037471 Ga0395905_0096245 Ga0395905_0096245_1752_2456 233
385 3300038443 Ga0395901_0627772 Ga0395901_0627772_46_750 233
386 3300046460 Ga0495638_0186835 Ga0495638_0186835_409_1116 233
387 3300046660 Ga0495625_0424467 Ga0495625_0424467_34_741 233
388 3300048905 Ga0496102_0054560 Ga0496102_0054560_2048_2752 233
389 3300048915 Ga0496112_0408734 Ga0496112_0408734_160_864 233
390 3300048923 Ga0496120_0000466 Ga0496120_0000466_27129_27833 233
391 3300053134 Ga0500658_0180689 Ga0500658_0180689_102_809 233
392 3300053151 Ga0500604_0073261 Ga0500604_0073261_63_767 233
393 3300053155 Ga0500620_007921 Ga0500620_007921_1860_2567 233
394 3300053158 Ga0500627_0088150 Ga0500627_0088150_325_1032 233
395 3300053158 Ga0500627_0221059 Ga0500627_0221059_108_812 233
396 3300053727 Ga0500611_046698 Ga0500611_046698_164_877 233
397 iso_pu_bacteria 2968117919 2968122562 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09209

CecR_C

HTH-type transcriptional dual regulator CecR, C-terminal domain

101

225

0.98

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

20

66

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t33-assembly1.cif.gz_B structural genomics, the crystal structure of a putative transcriptional repressor (tetr/acrr family) from salmonella typhimurim lt2 0.942 17 225
1t33-assembly1.cif.gz_B structural genomics, the crystal structure of a putative transcriptional repressor (tetr/acrr family) from salmonella typhimurim lt2 0.9165 17 225
3g7r-assembly1.cif.gz_B crystal structure of sco4454, a tetr-family transcriptional regulator from streptomyces coelicolor 0.8064 19 225
7e1n-assembly1.cif.gz_B crystal structure of phlh in complex with 2,4-diacetylphloroglucinol 0.7982 20 222
6o6n-assembly1.cif.gz_A structure of the regulator fasr from mycobacterium tuberculosis in complex with c20-coa 0.7975 19 221
ID Description Score Start End Superfamily
6mj1A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9949 20 62 1.10.10.60
1z77A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9784 20 62 1.10.10.60
1zkgA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9733 20 62 1.10.10.60
2id6A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9731 20 62 1.10.10.60
3bqzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9725 20 66 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A659YHJ7-F1-model_v4 deleted 0.9963 111 224
AF-A0A2P9HIC0-F1-model_v4 Transcriptional regulator YbiH, TetR family 0.9792 23 224 GO:0000976
GO:0003700
AF-A0A4S0JWA0-F1-model_v4 DUF1956 domain-containing protein 0.9789 17 233 GO:0000976
GO:0003700
AF-A0A529I012-F1-model_v4 deleted 0.9785 27 217
AF-A0A7V6ZH76-F1-model_v4 CerR family C-terminal domain-containing protein 0.9764 17 223 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
89.05 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map