F433920

General Info

Members Datasets Scaffolds Average Seq Length
397 247 794 189

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2873151551|2873153338
Length 191
Sequence VTTWSLEQTSPRDLLPAVVPEGDVRVVRADVPSPEFSRFLYASVGGDIRWTDRLPLTYAEWEKLLGRPGVETWVAYDRGTPAGYVELAARGENGDGPEGVVEIVYFGLLPAFRGRRIGGHLLSQGVARAWDLAERWPGLAPTERVWLHTCSKDGEHAMDNYLRRGFRLFDTKVEQEPDVPNPGPWPGAARD

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
8 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
10 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
11 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
12 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
13 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
14 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
15 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
16 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
17 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
18 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
19 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
20 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
21 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
27 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
28 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
29 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
30 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
31 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
32 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
33 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
34 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
35 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
36 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
37 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
38 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
39 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
40 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
41 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
42 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
43 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
44 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
45 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
46 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
47 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
48 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
49 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
50 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
51 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
52 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
53 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
54 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
55 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
56 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
57 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
58 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
59 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
60 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
61 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
62 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
63 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
64 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
65 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
66 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
67 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
68 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
69 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
70 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
71 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
72 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
73 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
74 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
75 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
76 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
77 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
78 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
79 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
80 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
81 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
84 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
85 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
86 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
87 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
88 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
89 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
90 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
96 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
97 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
98 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
99 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
100 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
104 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
105 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
133 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
134 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
140 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
168 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
169 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
170 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
174 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
175 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
176 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
177 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
178 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
179 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
180 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
181 2643221548 Streptomyces sp. Root55 Isolate Unclassified
182 2643221578 Streptomyces sp. Root63 Isolate Unclassified
183 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
184 2643221647 Streptomyces sp. Root369 Isolate Unclassified
185 2643221670 Streptomyces sp. Root431 Isolate Unclassified
186 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
187 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
188 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
189 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
190 2643221714 Streptomyces sp. Root264 Isolate Unclassified
191 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
192 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
193 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
194 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
195 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
196 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
197 2808606448 Streptomyces sp. 193411 Isolate Unclassified
198 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
199 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
200 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
201 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
202 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
203 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
204 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
205 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
206 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
207 2862574272 Streptomyces sp. AcE210 Isolate Nodule
208 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
209 2867428634 Streptomyces sp. RP5T Isolate Unclassified
210 2867475112 Streptomyces sp. TM32 Isolate Unclassified
211 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
212 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
213 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
214 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
215 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
216 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
217 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
218 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
219 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
220 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
221 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
222 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
223 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
224 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
225 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
226 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
227 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
228 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
229 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
230 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
231 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
232 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
233 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
234 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
235 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
236 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
237 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
238 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
239 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
240 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
241 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
242 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
243 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
244 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
245 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
246 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
247 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.11
Metatranscriptomes 0
Isolates 18.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.78
Nodule 0.25
Rhizoplane 1.51
Rhizosphere 80.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10015380 3300002067 Bacteria 2388
2 rootH2_10057447 3300003320 Bacteria 4492
3 rootL2_10027667 3300003322 Bacteria 5550
4 rootH1_10003304 3300003323 Bacteria 9323
5 rootH1_10043361 3300003323 Bacteria 2197
6 JGI25160J50197_1015504 3300003354 Bacteria 2497
7 JGI25160J50197_1038805 3300003354 Bacteria 1122
8 Ga0068853_100008483 3300005539 Bacteria 8260
9 Ga0068854_100061946 3300005578 Bacteria 2710
10 Ga0068854_100203492 3300005578 Bacteria 1558
11 Ga0081455_10055290 3300005937 Bacteria 3377
12 Ga0075363_100019281 3300006048 Bacteria 3409
13 Ga0075363_100036191 3300006048 Bacteria 2588
14 Ga0075367_10001257 3300006178 Bacteria 10700
15 Ga0075370_10029841 3300006353 Bacteria 3039
16 Ga0105238_10162497 3300009551 Bacteria 2209
17 Ga0105239_11068747 3300010375 Bacteria 929
18 Ga0105246_10085847 3300011119 Bacteria 2255
19 Ga0157375_12176771 3300013308 Bacteria 660
20 Ga0182008_10000638 3300014497 Bacteria 25605
21 Ga0182006_1006525 3300015261 Bacteria 5414
22 Ga0182007_10002397 3300015262 Bacteria 9368
23 Ga0183367_1001 3300015688 Bacteria 1225545
24 Ga0207426_1001177 3300025302 Bacteria 23399
25 Ga0207426_1012102 3300025302 Bacteria 3256
26 Ga0207647_10044129 3300025904 Bacteria 2787
27 Ga0207694_10328177 3300025924 Bacteria 1264
28 Ga0207667_10266066 3300025949 Bacteria 1753
29 Ga0207640_10196836 3300025981 Bacteria 1524
30 Ga0207639_10038344 3300026041 Bacteria 3564
31 Ga0307515_10000501 3300028794 Bacteria 93663
32 Ga0307511_10000220 3300030521 Bacteria 57569
33 Ga0307511_10051255 3300030521 Bacteria 3312
34 Ga0307512_10009999 3300030522 Bacteria 9086
35 Ga0307512_10028984 3300030522 Bacteria 4842
36 Ga0316180_1027328 3300030736 Bacteria 1091
37 Ga0307513_10079370 3300031456 Bacteria 3390
38 Ga0307509_10037698 3300031507 Bacteria 5282
39 Ga0307509_10057200 3300031507 Bacteria 4136
40 Ga0307508_10002146 3300031616 Bacteria 21136
41 Ga0307508_10037243 3300031616 Bacteria 4377
42 Ga0307508_10353734 3300031616 Bacteria 1060
43 Ga0307514_10049401 3300031649 Bacteria 3271
44 Ga0307516_10005325 3300031730 Bacteria 15470
45 Ga0307516_10059849 3300031730 Bacteria 3703
46 Ga0307518_10138721 3300031838 Bacteria 1698
47 Ga0307409_101052354 3300031995 Bacteria 834
48 Ga0307416_100534367 3300032002 Bacteria 1243
49 Ga0307411_10559471 3300032005 Bacteria 977
50 Ga0307507_10010364 3300033179 Bacteria 12066
51 Ga0307507_10241978 3300033179 Bacteria 1179
52 Ga0307510_10005152 3300033180 Bacteria 15533
53 Ga0307510_10019886 3300033180 Bacteria 7865
54 Ga0307510_10072620 3300033180 Bacteria 3417
55 Ga0395898_0007762 3300037466 Bacteria 11392
56 Ga0395898_0066106 3300037466 Bacteria 3504
57 Ga0395901_0295408 3300038443 Bacteria 1680
58 Ga0439436_0001518 3300041404 Bacteria 6746
59 Ga0439439_0001471 3300041406 Bacteria 4703
60 Ga0451853_0046542 3300041512 Bacteria 3957
61 Ga0451853_1896320 3300041512 Bacteria 1894
62 Ga0439433_0004372 3300041999 Bacteria 3047
63 Ga0439432_120034 3300042006 Bacteria 779
64 Ga0439449_0000414 3300042007 Bacteria 15761
65 Ga0439449_0025180 3300042007 Bacteria 2224
66 Ga0439449_0037485 3300042007 Bacteria 1803
67 Ga0439450_007033 3300042008 Bacteria 2047
68 Ga0439450_057306 3300042008 Bacteria 936
69 Ga0439457_000296 3300042014 Bacteria 13769
70 Ga0450899_000196 3300042135 Bacteria 6172
71 Ga0450903_000091 3300042138 Bacteria 18828
72 Ga0439458_0011045 3300042157 Bacteria 2017
73 Ga0439458_0105907 3300042157 Bacteria 733
74 Ga0466969_0117468 3300044656 Bacteria 1240
75 Ga0466972_0004935 3300044658 Bacteria 6696
76 Ga0466972_0005119 3300044658 Bacteria 6565
77 Ga0466972_0007916 3300044658 Bacteria 5329
78 Ga0466965_0000530 3300044683 Bacteria 13704
79 Ga0466965_0063028 3300044683 Bacteria 1855
80 Ga0466966_0000480 3300044684 Bacteria 25684
81 Ga0466961_0000749 3300044693 Bacteria 20317
82 Ga0466961_0015009 3300044693 Bacteria 4974
83 Ga0466961_0019177 3300044693 Bacteria 4402
84 Ga0466963_0000053 3300044694 Bacteria 38770
85 Ga0466964_0001852 3300044706 Bacteria 7367
86 Ga0466964_0029121 3300044706 Bacteria 2179
87 Ga0466971_0019455 3300044719 Bacteria 3016
88 Ga0466968_0006128 3300044735 Bacteria 4519
89 Ga0466970_0000077 3300044765 Bacteria 40147
90 Ga0466970_0034155 3300044765 Bacteria 2691
91 Ga0466970_0138542 3300044765 Bacteria 1339
92 Ga0466957_0000461 3300044842 Bacteria 20154
93 Ga0466957_0134124 3300044842 Bacteria 1590
94 Ga0466957_0329775 3300044842 Bacteria 1031
95 Ga0466957_0389521 3300044842 Bacteria 951
96 Ga0466960_0001743 3300044901 Bacteria 7995
97 Ga0466959_0008491 3300045049 Bacteria 7268
98 Ga0466959_0034452 3300045049 Bacteria 3745
99 Ga0466958_0000820 3300045836 Bacteria 13725
100 Ga0466967_0007988 3300045976 Bacteria 7703
101 Ga0466967_0471949 3300045976 Bacteria 1228
102 Ga0466967_1114356 3300045976 Bacteria 786
103 Ga0495617_005272 3300046452 Bacteria 4601
104 Ga0495627_025342 3300046453 Bacteria 1924
105 Ga0495592_0001940 3300046454 Bacteria 14585
106 Ga0495592_0005101 3300046454 Bacteria 9674
107 Ga0495603_0000293 3300046455 Bacteria 26615
108 Ga0495603_0002239 3300046455 Bacteria 11368
109 Ga0495603_0005975 3300046455 Bacteria 7277
110 Ga0495603_0012777 3300046455 Bacteria 5077
111 Ga0495629_0000865 3300046459 Bacteria 24384
112 Ga0495629_0005993 3300046459 Bacteria 9041
113 Ga0495629_0007924 3300046459 Bacteria 7814
114 Ga0495629_0008671 3300046459 Bacteria 7488
115 Ga0495629_0010169 3300046459 Bacteria 6855
116 Ga0495629_0059584 3300046459 Bacteria 2669
117 Ga0495629_0064871 3300046459 Bacteria 2549
118 Ga0495629_0376438 3300046459 Bacteria 966
119 Ga0495629_0786491 3300046459 Bacteria 628
120 Ga0495638_0044748 3300046460 Bacteria 2788
121 Ga0495638_0227446 3300046460 Bacteria 1039
122 Ga0495638_0337522 3300046460 Bacteria 800
123 Ga0495651_0004704 3300046462 Bacteria 10446
124 Ga0495651_0022295 3300046462 Bacteria 4922
125 Ga0495653_0430217 3300046463 Bacteria 834
126 Ga0495580_0145731 3300046472 Bacteria 1641
127 Ga0495582_0188837 3300046473 Bacteria 1175
128 Ga0495582_0194686 3300046473 Bacteria 1157
129 Ga0495582_0302126 3300046473 Bacteria 920
130 Ga0495605_0018027 3300046474 Bacteria 3791
131 Ga0495605_0167004 3300046474 Bacteria 974
132 Ga0495639_0039720 3300046475 Bacteria 2116
133 Ga0495662_0001881 3300046476 Bacteria 10518
134 Ga0495662_0005459 3300046476 Bacteria 6364
135 Ga0495664_0002987 3300046477 Bacteria 9139
136 Ga0495585_0018500 3300046492 Bacteria 4017
137 Ga0495594_0001577 3300046499 Bacteria 11844
138 Ga0495594_0096372 3300046499 Bacteria 1662
139 Ga0495594_0099743 3300046499 Bacteria 1633
140 Ga0495594_0123352 3300046499 Bacteria 1465
141 Ga0495594_0187950 3300046499 Bacteria 1176
142 Ga0495596_0264127 3300046500 Bacteria 668
143 Ga0495607_0052480 3300046501 Bacteria 2361
144 Ga0495583_0030768 3300046506 Bacteria 2610
145 Ga0495583_0038007 3300046506 Bacteria 2277
146 Ga0495583_0102269 3300046506 Bacteria 1222
147 Ga0495606_0005351 3300046507 Bacteria 12324
148 Ga0495606_0229837 3300046507 Bacteria 1040
149 Ga0495610_0081814 3300046512 Bacteria 1481
150 Ga0495616_0009418 3300046513 Bacteria 5713
151 Ga0495618_0029599 3300046514 Bacteria 3417
152 Ga0495618_0347467 3300046514 Bacteria 914
153 Ga0495620_0013205 3300046515 Bacteria 4236
154 Ga0495620_0016291 3300046515 Bacteria 3733
155 Ga0495628_0028906 3300046516 Bacteria 4499
156 Ga0495630_0013847 3300046517 Bacteria 5866
157 Ga0495630_0066211 3300046517 Bacteria 2715
158 Ga0495631_0039033 3300046518 Bacteria 2108
159 Ga0495637_0232273 3300046520 Bacteria 668
160 Ga0495643_0019071 3300046522 Bacteria 3971
161 Ga0495643_0143939 3300046522 Bacteria 1186
162 Ga0495643_0216253 3300046522 Bacteria 912
163 Ga0495648_0089565 3300046524 Bacteria 1726
164 Ga0495666_0078539 3300046526 Bacteria 1563
165 Ga0495642_0208694 3300046528 Bacteria 852
166 Ga0495652_0018685 3300046529 Bacteria 6179
167 Ga0495652_0037915 3300046529 Bacteria 4179
168 Ga0495652_0476871 3300046529 Bacteria 869
169 Ga0495640_0041223 3300046533 Bacteria 3227
170 Ga0495640_0147274 3300046533 Bacteria 1514
171 Ga0495640_0663012 3300046533 Bacteria 627
172 Ga0495609_0111071 3300046538 Bacteria 1183
173 Ga0495597_0075759 3300046542 Bacteria 1443
174 Ga0495597_0083811 3300046542 Bacteria 1360
175 Ga0495645_0011013 3300046543 Bacteria 6355
176 Ga0495645_0090635 3300046543 Bacteria 2185
177 Ga0495622_0005304 3300046557 Bacteria 5981
178 Ga0495622_0029754 3300046557 Bacteria 2551
179 Ga0495622_0036666 3300046557 Bacteria 2286
180 Ga0495633_0123424 3300046558 Bacteria 1199
181 Ga0495633_0212097 3300046558 Bacteria 887
182 Ga0495667_0088660 3300046559 Bacteria 2005
183 Ga0495668_0233822 3300046616 Bacteria 1006
184 Ga0495668_0279573 3300046616 Bacteria 914
185 Ga0495634_0017728 3300046642 Bacteria 5077
186 Ga0495634_0054372 3300046642 Bacteria 2680
187 Ga0495611_0226887 3300046648 Bacteria 868
188 Ga0495611_0245196 3300046648 Bacteria 831
189 Ga0495625_0010567 3300046660 Bacteria 7623
190 Ga0495625_0032246 3300046660 Bacteria 3888
191 Ga0495625_0135282 3300046660 Bacteria 1666
192 Ga0495635_0002380 3300046663 Bacteria 12808
193 Ga0495635_0037129 3300046663 Bacteria 3373
194 Ga0495661_0135714 3300046665 Bacteria 1343
195 Ga0495588_0001000 3300046674 Bacteria 12321
196 Ga0495657_0002647 3300046675 Bacteria 14972
197 Ga0495657_0005644 3300046675 Bacteria 9870
198 Ga0495657_0033812 3300046675 Bacteria 3555
199 Ga0495657_0069575 3300046675 Bacteria 2302
200 Ga0495623_0025290 3300046679 Bacteria 3824
201 Ga0495646_0004259 3300046680 Bacteria 9002
202 Ga0495613_0000824 3300046689 Bacteria 24009
203 Ga0495613_0001245 3300046689 Bacteria 19433
204 Ga0495613_0017112 3300046689 Bacteria 5397
205 Ga0495613_0022952 3300046689 Bacteria 4649
206 Ga0495613_0052441 3300046689 Bacteria 3004
207 Ga0495613_0053767 3300046689 Bacteria 2961
208 Ga0495671_0014074 3300046692 Bacteria 4313
209 Ga0495671_0365525 3300046692 Bacteria 692
210 Ga0495649_0145051 3300046694 Bacteria 1248
211 Ga0495649_0324760 3300046694 Bacteria 780
212 Ga0495589_0029513 3300046794 Bacteria 2764
213 Ga0495589_0056956 3300046794 Bacteria 1923
214 Ga0495589_0110822 3300046794 Bacteria 1324
215 Ga0495581_0028623 3300047315 Bacteria 3230
216 Ga0495581_0239359 3300047315 Bacteria 1061
217 Ga0495604_0000222 3300047317 Bacteria 51967
218 Ga0495604_0284687 3300047317 Bacteria 1115
219 Ga0495636_0004745 3300047318 Bacteria 5333
220 Ga0495636_0094968 3300047318 Bacteria 1298
221 Ga0495636_0138351 3300047318 Bacteria 1086
222 Ga0495674_0035220 3300047319 Bacteria 4518
223 Ga0495672_0239182 3300047320 Bacteria 887
224 Ga0495676_0003837 3300047321 Bacteria 13668
225 Ga0495676_0004683 3300047321 Bacteria 12526
226 Ga0495676_0009172 3300047321 Bacteria 9018
227 Ga0495676_0088487 3300047321 Bacteria 2322
228 Ga0495676_0774449 3300047321 Bacteria 618
229 Ga0495680_0046269 3300047322 Bacteria 3431
230 Ga0495687_046516 3300047443 Bacteria 1873
231 Ga0495687_112547 3300047443 Bacteria 997
232 Ga0495687_117135 3300047443 Bacteria 967
233 Ga0495675_0011071 3300047444 Bacteria 5655
234 Ga0495675_0017130 3300047444 Bacteria 4587
235 Ga0495675_0235361 3300047444 Bacteria 1104
236 Ga0495677_0079234 3300047445 Bacteria 1230
237 Ga0495685_016519 3300047447 Bacteria 2521
238 Ga0495685_017680 3300047447 Bacteria 2443
239 Ga0495685_038862 3300047447 Bacteria 1629
240 Ga0495685_071164 3300047447 Bacteria 1164
241 Ga0495681_0002006 3300047470 Bacteria 14881
242 Ga0495681_0030180 3300047470 Bacteria 2764
243 Ga0495681_0112723 3300047470 Bacteria 1176
244 Ga0495681_0245400 3300047470 Bacteria 709
245 Ga0495684_0060514 3300047471 Bacteria 2883
246 Ga0495686_0090975 3300047472 Bacteria 1852
247 Ga0495686_0252117 3300047472 Bacteria 991
248 Ga0495593_0001957 3300047673 Bacteria 12286
249 Ga0495593_0063790 3300047673 Bacteria 1923
250 Ga0495593_0086510 3300047673 Bacteria 1616
251 Ga0495602_0054327 3300048088 Bacteria 3537
252 Ga0495614_0004211 3300048089 Bacteria 6482
253 Ga0495614_0020224 3300048089 Bacteria 2879
254 Ga0495614_0084113 3300048089 Bacteria 1380
255 Ga0495614_0403363 3300048089 Bacteria 642
256 Ga0495626_0142799 3300048091 Bacteria 1014
257 Ga0496106_0136886 3300048909 Bacteria 1924
258 Ga0496108_0379728 3300048911 Bacteria 1234
259 Ga0496108_1291254 3300048911 Bacteria 614
260 Ga0496109_0030060 3300048912 Bacteria 4869
261 Ga0496113_0234427 3300048916 Bacteria 1464
262 Ga0495682_0017161 3300049460 Bacteria 2736
263 Ga0501031_0067292 3300049568 Bacteria 2334
264 Ga0501031_0180489 3300049568 Bacteria 1379
265 Ga0501032_0123683 3300049569 Bacteria 1709
266 Ga0501032_0475486 3300049569 Bacteria 799
267 Ga0501033_0002047 3300049570 Bacteria 17529
268 Ga0501033_0025704 3300049570 Bacteria 4436
269 Ga0501033_0075208 3300049570 Bacteria 2479
270 Ga0501034_0006937 3300049571 Bacteria 12107
271 Ga0501034_0097536 3300049571 Bacteria 2935
272 Ga0501034_0305888 3300049571 Bacteria 1525
273 Ga0501034_0467107 3300049571 Bacteria 1178
274 Ga0501036_0042730 3300049572 Bacteria 3837
275 Ga0501036_0078692 3300049572 Bacteria 2789
276 Ga0501036_0124349 3300049572 Bacteria 2178
277 Ga0501037_0011190 3300049573 Bacteria 6603
278 Ga0501037_0111142 3300049573 Bacteria 1974
279 Ga0501038_0030890 3300049574 Bacteria 4735
280 Ga0501038_0088844 3300049574 Bacteria 2593
281 Ga0501038_0327883 3300049574 Bacteria 1196
282 Ga0501039_0009139 3300049575 Bacteria 7550
283 Ga0501042_0052379 3300049578 Bacteria 2911
284 Ga0501043_0022611 3300049579 Bacteria 4929
285 Ga0501043_0044876 3300049579 Bacteria 3476
286 Ga0501046_0011869 3300049580 Bacteria 7434
287 Ga0501046_0078736 3300049580 Bacteria 2549
288 Ga0501046_0174147 3300049580 Bacteria 1613
289 Ga0501046_0280524 3300049580 Bacteria 1221
290 Ga0501047_0195609 3300049581 Bacteria 1884
291 Ga0501047_0237629 3300049581 Bacteria 1673
292 Ga0501047_0254306 3300049581 Bacteria 1605
293 Ga0501047_0327552 3300049581 Bacteria 1370
294 Ga0501047_0441425 3300049581 Bacteria 1131
295 Ga0501048_0004173 3300049582 Bacteria 11012
296 Ga0501048_0119621 3300049582 Bacteria 1861
297 Ga0501070_0010803 3300049586 Bacteria 7713
298 Ga0501074_0114920 3300049590 Bacteria 1926
299 Ga0501080_0087319 3300049742 Bacteria 2898
300 Ga0501035_0028492 3300049822 Bacteria 5096
301 Ga0501035_0042310 3300049822 Bacteria 4109
302 Ga0501035_0074762 3300049822 Bacteria 2997
303 Ga0501035_0096818 3300049822 Bacteria 2592
304 Ga0501035_0196319 3300049822 Bacteria 1733
305 Ga0501044_0002714 3300049823 Bacteria 20128
306 Ga0501044_0005423 3300049823 Bacteria 14168
307 Ga0501044_0016489 3300049823 Bacteria 7929
308 Ga0501044_0027946 3300049823 Bacteria 5953
309 Ga0501044_0076301 3300049823 Bacteria 3402
310 Ga0501044_0178885 3300049823 Bacteria 2089
311 Ga0501045_0058040 3300049824 Bacteria 2833
312 nmdc:mga03n38_5292_c1 3300050490 Bacteria 4378
313 nmdc:mga03n38_63382_c1 3300050490 Bacteria 1689
314 nmdc:mga06z11_447_c1 3300050494 Bacteria 15396
315 nmdc:mga04h51_231704_c1 3300050495 Bacteria 735
316 Ga0500640_004935 3300053095 Bacteria 4908
317 Ga0500553_041487 3300053101 Bacteria 2254
318 Ga0500634_0048478 3300053161 Bacteria 2292
319 Ga0501084_0564305 3300054114 Bacteria 962
320 Ga0466962_0000217 3300061719 Bacteria 23834
321 Ga0466962_0007099 3300061719 Bacteria 5370
322 Ga0466962_0145918 3300061719 Bacteria 1147
323 2873153338 2873151551 Bacteria 8625867
324 2547407545 2547132111 Bacteria 8013147
325 2554260500 2554235005 Bacteria 6457341
326 2585298725 2582581312 Bacteria 7308206
327 2585309287 2582581313 Bacteria 10042643
328 2585316654 2582581314 Bacteria 11452267
329 2616699800 2616644814 Bacteria 11555299
330 2616902482 2616644941 Bacteria 8510691
331 2643761860 2643221548 Bacteria 8053412
332 2643904060 2643221578 Bacteria 9213798
333 2643943270 2643221587 Bacteria 7586415
334 2644264733 2643221647 Bacteria 10741251
335 2644388251 2643221670 Bacteria 6497041
336 2644402415 2643221673 Bacteria 9196637
337 2644430738 2643221677 Bacteria 7584031
338 2644442599 2643221678 Bacteria 9540101
339 2644460713 2643221682 Bacteria 6743283
340 2644626744 2643221714 Bacteria 9015452
341 2784591262 2784132148 Bacteria 8627943
342 2785372340 2784746768 Bacteria 10036182
343 2786673477 2786546132 Bacteria 10419719
344 2804848679 2802429296 Bacteria 7227771
345 2808844775 2808606359 Bacteria 9866990
346 2808914351 2808606375 Bacteria 9466072
347 2809234834 2808606448 Bacteria 8656184
348 2811843744 2808606982 Bacteria 7791042
349 2812355174 2811994879 Bacteria 9313447
350 2812477908 2811994917 Bacteria 7761064
351 2819699848 2818991463 Bacteria 7948711
352 2852638679 2852635781 Bacteria 8251373
353 2862182438 2862178590 Bacteria 8583590
354 2862283736 2862281513 Bacteria 9621493
355 2862291893 2862290372 Bacteria 7471434
356 2862511084 2862507626 Bacteria 9425308
357 2862576716 2862574272 Bacteria 10567477
358 2867353054 2867346516 Bacteria 7608576
359 2867432183 2867428634 Bacteria 9590268
360 2867476549 2867475112 Bacteria 6909112
361 2875397453 2875391855 Bacteria 7600475
362 2877678310 2877676314 Bacteria 9512378
363 2912716822 2912715099 Bacteria 9460473
364 2912729426 2912723979 Bacteria 8557534
365 2912763675 2912757875 Bacteria 7940295
366 2918507272 2918501144 Bacteria 8668083
367 2919472728 2919468124 Bacteria 9133025
368 2946047055 2946045630 Bacteria 8527308
369 2946070718 2946064051 Bacteria 8957905
370 2946078435 2946072368 Bacteria 8999607
371 2947226078 2947224130 Bacteria 9938529
372 2954383223 2954380949 Bacteria 10050426
373 2954679782 2954673503 Bacteria 9685905
374 2954684371 2954682443 Bacteria 9862841
375 2954693933 2954691527 Bacteria 10720516
376 2954709039 2954701450 Bacteria 10834262
377 2954713544 2954711539 Bacteria 10867210
378 2954723507 2954721474 Bacteria 10456478
379 2954738323 2954731030 Bacteria 10243860
380 2954742411 2954740390 Bacteria 10229294
381 2954757183 2954749733 Bacteria 10366972
382 2954761380 2954759201 Bacteria 9358192
383 2966600084 2966598605 Bacteria 7676064
384 2997459425 2997451912 Bacteria 8492419
385 2997602028 2997600082 Bacteria 9896405
386 3006393652 3006393351 Bacteria 6615579
387 3006500640 3006493962 Bacteria 8825450
388 8008576427 8008574985 Bacteria 7815457
389 8023630238 8023623736 Bacteria 8593882
390 8025417642 8025413630 Bacteria 7014048
391 8025532857 8025530807 Bacteria 8495698
392 8047895438 8047893842 Bacteria 11723082
393 8048363516 8048356638 Bacteria 11044339
394 8048372463 8048369669 Bacteria 11666822
395 8048381397 8048379754 Bacteria 11877923
396 8054163085 8054160619 Bacteria 7783213
397 8056829807 8056829672 Bacteria 9045328
398 JGI24735J21928_10015380
399 rootH2_10057447
400 rootL2_10027667
401 rootH1_10003304
402 rootH1_10043361
403 JGI25160J50197_1015504
404 JGI25160J50197_1038805
405 Ga0068853_100008483
406 Ga0068854_100061946
407 Ga0068854_100203492
408 Ga0081455_10055290
409 Ga0075363_100019281
410 Ga0075363_100036191
411 Ga0075367_10001257
412 Ga0075370_10029841
413 Ga0105238_10162497
414 Ga0105239_11068747
415 Ga0105246_10085847
416 Ga0157375_12176771
417 Ga0182008_10000638
418 Ga0182006_1006525
419 Ga0182007_10002397
420 Ga0183367_1001
421 Ga0207426_1001177
422 Ga0207426_1012102
423 Ga0207647_10044129
424 Ga0207694_10328177
425 Ga0207667_10266066
426 Ga0207640_10196836
427 Ga0207639_10038344
428 Ga0307515_10000501
429 Ga0307511_10000220
430 Ga0307511_10051255
431 Ga0307512_10009999
432 Ga0307512_10028984
433 Ga0316180_1027328
434 Ga0307513_10079370
435 Ga0307509_10037698
436 Ga0307509_10057200
437 Ga0307508_10002146
438 Ga0307508_10037243
439 Ga0307508_10353734
440 Ga0307514_10049401
441 Ga0307516_10005325
442 Ga0307516_10059849
443 Ga0307518_10138721
444 Ga0307409_101052354
445 Ga0307416_100534367
446 Ga0307411_10559471
447 Ga0307507_10010364
448 Ga0307507_10241978
449 Ga0307510_10005152
450 Ga0307510_10019886
451 Ga0307510_10072620
452 Ga0395898_0007762
453 Ga0395898_0066106
454 Ga0395901_0295408
455 Ga0439436_0001518
456 Ga0439439_0001471
457 Ga0451853_0046542
458 Ga0451853_1896320
459 Ga0439433_0004372
460 Ga0439432_120034
461 Ga0439449_0000414
462 Ga0439449_0025180
463 Ga0439449_0037485
464 Ga0439450_007033
465 Ga0439450_057306
466 Ga0439457_000296
467 Ga0450899_000196
468 Ga0450903_000091
469 Ga0439458_0011045
470 Ga0439458_0105907
471 Ga0466969_0117468
472 Ga0466972_0004935
473 Ga0466972_0005119
474 Ga0466972_0007916
475 Ga0466965_0000530
476 Ga0466965_0063028
477 Ga0466966_0000480
478 Ga0466961_0000749
479 Ga0466961_0015009
480 Ga0466961_0019177
481 Ga0466963_0000053
482 Ga0466964_0001852
483 Ga0466964_0029121
484 Ga0466971_0019455
485 Ga0466968_0006128
486 Ga0466970_0000077
487 Ga0466970_0034155
488 Ga0466970_0138542
489 Ga0466957_0000461
490 Ga0466957_0134124
491 Ga0466957_0329775
492 Ga0466957_0389521
493 Ga0466960_0001743
494 Ga0466959_0008491
495 Ga0466959_0034452
496 Ga0466958_0000820
497 Ga0466967_0007988
498 Ga0466967_0471949
499 Ga0466967_1114356
500 Ga0495617_005272
501 Ga0495627_025342
502 Ga0495592_0001940
503 Ga0495592_0005101
504 Ga0495603_0000293
505 Ga0495603_0002239
506 Ga0495603_0005975
507 Ga0495603_0012777
508 Ga0495629_0000865
509 Ga0495629_0005993
510 Ga0495629_0007924
511 Ga0495629_0008671
512 Ga0495629_0010169
513 Ga0495629_0059584
514 Ga0495629_0064871
515 Ga0495629_0376438
516 Ga0495629_0786491
517 Ga0495638_0044748
518 Ga0495638_0227446
519 Ga0495638_0337522
520 Ga0495651_0004704
521 Ga0495651_0022295
522 Ga0495653_0430217
523 Ga0495580_0145731
524 Ga0495582_0188837
525 Ga0495582_0194686
526 Ga0495582_0302126
527 Ga0495605_0018027
528 Ga0495605_0167004
529 Ga0495639_0039720
530 Ga0495662_0001881
531 Ga0495662_0005459
532 Ga0495664_0002987
533 Ga0495585_0018500
534 Ga0495594_0001577
535 Ga0495594_0096372
536 Ga0495594_0099743
537 Ga0495594_0123352
538 Ga0495594_0187950
539 Ga0495596_0264127
540 Ga0495607_0052480
541 Ga0495583_0030768
542 Ga0495583_0038007
543 Ga0495583_0102269
544 Ga0495606_0005351
545 Ga0495606_0229837
546 Ga0495610_0081814
547 Ga0495616_0009418
548 Ga0495618_0029599
549 Ga0495618_0347467
550 Ga0495620_0013205
551 Ga0495620_0016291
552 Ga0495628_0028906
553 Ga0495630_0013847
554 Ga0495630_0066211
555 Ga0495631_0039033
556 Ga0495637_0232273
557 Ga0495643_0019071
558 Ga0495643_0143939
559 Ga0495643_0216253
560 Ga0495648_0089565
561 Ga0495666_0078539
562 Ga0495642_0208694
563 Ga0495652_0018685
564 Ga0495652_0037915
565 Ga0495652_0476871
566 Ga0495640_0041223
567 Ga0495640_0147274
568 Ga0495640_0663012
569 Ga0495609_0111071
570 Ga0495597_0075759
571 Ga0495597_0083811
572 Ga0495645_0011013
573 Ga0495645_0090635
574 Ga0495622_0005304
575 Ga0495622_0029754
576 Ga0495622_0036666
577 Ga0495633_0123424
578 Ga0495633_0212097
579 Ga0495667_0088660
580 Ga0495668_0233822
581 Ga0495668_0279573
582 Ga0495634_0017728
583 Ga0495634_0054372
584 Ga0495611_0226887
585 Ga0495611_0245196
586 Ga0495625_0010567
587 Ga0495625_0032246
588 Ga0495625_0135282
589 Ga0495635_0002380
590 Ga0495635_0037129
591 Ga0495661_0135714
592 Ga0495588_0001000
593 Ga0495657_0002647
594 Ga0495657_0005644
595 Ga0495657_0033812
596 Ga0495657_0069575
597 Ga0495623_0025290
598 Ga0495646_0004259
599 Ga0495613_0000824
600 Ga0495613_0001245
601 Ga0495613_0017112
602 Ga0495613_0022952
603 Ga0495613_0052441
604 Ga0495613_0053767
605 Ga0495671_0014074
606 Ga0495671_0365525
607 Ga0495649_0145051
608 Ga0495649_0324760
609 Ga0495589_0029513
610 Ga0495589_0056956
611 Ga0495589_0110822
612 Ga0495581_0028623
613 Ga0495581_0239359
614 Ga0495604_0000222
615 Ga0495604_0284687
616 Ga0495636_0004745
617 Ga0495636_0094968
618 Ga0495636_0138351
619 Ga0495674_0035220
620 Ga0495672_0239182
621 Ga0495676_0003837
622 Ga0495676_0004683
623 Ga0495676_0009172
624 Ga0495676_0088487
625 Ga0495676_0774449
626 Ga0495680_0046269
627 Ga0495687_046516
628 Ga0495687_112547
629 Ga0495687_117135
630 Ga0495675_0011071
631 Ga0495675_0017130
632 Ga0495675_0235361
633 Ga0495677_0079234
634 Ga0495685_016519
635 Ga0495685_017680
636 Ga0495685_038862
637 Ga0495685_071164
638 Ga0495681_0002006
639 Ga0495681_0030180
640 Ga0495681_0112723
641 Ga0495681_0245400
642 Ga0495684_0060514
643 Ga0495686_0090975
644 Ga0495686_0252117
645 Ga0495593_0001957
646 Ga0495593_0063790
647 Ga0495593_0086510
648 Ga0495602_0054327
649 Ga0495614_0004211
650 Ga0495614_0020224
651 Ga0495614_0084113
652 Ga0495614_0403363
653 Ga0495626_0142799
654 Ga0496106_0136886
655 Ga0496108_0379728
656 Ga0496108_1291254
657 Ga0496109_0030060
658 Ga0496113_0234427
659 Ga0495682_0017161
660 Ga0501031_0067292
661 Ga0501031_0180489
662 Ga0501032_0123683
663 Ga0501032_0475486
664 Ga0501033_0002047
665 Ga0501033_0025704
666 Ga0501033_0075208
667 Ga0501034_0006937
668 Ga0501034_0097536
669 Ga0501034_0305888
670 Ga0501034_0467107
671 Ga0501036_0042730
672 Ga0501036_0078692
673 Ga0501036_0124349
674 Ga0501037_0011190
675 Ga0501037_0111142
676 Ga0501038_0030890
677 Ga0501038_0088844
678 Ga0501038_0327883
679 Ga0501039_0009139
680 Ga0501042_0052379
681 Ga0501043_0022611
682 Ga0501043_0044876
683 Ga0501046_0011869
684 Ga0501046_0078736
685 Ga0501046_0174147
686 Ga0501046_0280524
687 Ga0501047_0195609
688 Ga0501047_0237629
689 Ga0501047_0254306
690 Ga0501047_0327552
691 Ga0501047_0441425
692 Ga0501048_0004173
693 Ga0501048_0119621
694 Ga0501070_0010803
695 Ga0501074_0114920
696 Ga0501080_0087319
697 Ga0501035_0028492
698 Ga0501035_0042310
699 Ga0501035_0074762
700 Ga0501035_0096818
701 Ga0501035_0196319
702 Ga0501044_0002714
703 Ga0501044_0005423
704 Ga0501044_0016489
705 Ga0501044_0027946
706 Ga0501044_0076301
707 Ga0501044_0178885
708 Ga0501045_0058040
709 nmdc:mga03n38_5292_c1
710 nmdc:mga03n38_63382_c1
711 nmdc:mga06z11_447_c1
712 nmdc:mga04h51_231704_c1
713 Ga0500640_004935
714 Ga0500553_041487
715 Ga0500634_0048478
716 Ga0501084_0564305
717 Ga0466962_0000217
718 Ga0466962_0007099
719 Ga0466962_0145918
720 2873153338
721 2547407545
722 2554260500
723 2585298725
724 2585309287
725 2585316654
726 2616699800
727 2616902482
728 2643761860
729 2643904060
730 2643943270
731 2644264733
732 2644388251
733 2644402415
734 2644430738
735 2644442599
736 2644460713
737 2644626744
738 2784591262
739 2785372340
740 2786673477
741 2804848679
742 2808844775
743 2808914351
744 2809234834
745 2811843744
746 2812355174
747 2812477908
748 2819699848
749 2852638679
750 2862182438
751 2862283736
752 2862291893
753 2862511084
754 2862576716
755 2867353054
756 2867432183
757 2867476549
758 2875397453
759 2877678310
760 2912716822
761 2912729426
762 2912763675
763 2918507272
764 2919472728
765 2946047055
766 2946070718
767 2946078435
768 2947226078
769 2954383223
770 2954679782
771 2954684371
772 2954693933
773 2954709039
774 2954713544
775 2954723507
776 2954738323
777 2954742411
778 2954757183
779 2954761380
780 2966600084
781 2997459425
782 2997602028
783 3006393652
784 3006500640
785 8008576427
786 8023630238
787 8025417642
788 8025532857
789 8047895438
790 8048363516
791 8048372463
792 8048381397
793 8054163085
794 8056829807

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

40

166

0.8

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

68

168

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6add-assembly1.cif.gz_B the crystal structure of rv2747 from mycobacterium tuberculosis in complex with coa and nlq 0.8895 77 131
3c26-assembly1.cif.gz_A-2 crystal structure of a putative acetyltransferase (np_394282.1) from thermoplasma acidophilum at 2.00 a resolution 0.8423 77 125
7wx5-assembly1.cif.gz_A a legionella acetyltransferase effector vipf 0.8235 2 172
2atr-assembly1.cif.gz_A acetyltransferase, gnat family protein sp0256 from streptococcus pneumoniae tigr4 0.8122 28 161
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8023 67 128
ID Description Score Start End Superfamily
3d2pB02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9189 77 128 3.40.630.30
af_I1KF23_15_150_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9012 64 169 3.40.630.30
af_P9WQG5_1_155_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8497 64 130 3.40.630.30
af_A4HVJ0_163_269_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8367 86 130 3.40.630.30
af_Q9SI32_150_379_2.40.160.200 Mainly Beta;Beta Barrel;Porin;LURP1-related 0.8349 75 96 2.40.160.200
ID Description Score Start End GO Terms
AF-A0A6G3WKW0-F1-model_v4 GNAT family N-acetyltransferase 0.9953 9 146 GO:0016747
AF-A0A2T7TBA2-F1-model_v4 Acetyltransferase 0.9883 2 176 GO:0016747
AF-A0A069JZ79-F1-model_v4 deleted 0.9825 2 190
AF-A0A426UVD7-F1-model_v4 N-acetyltransferase 0.9822 4 173 GO:0016747
AF-A0A1Q4XJR1-F1-model_v4 Acetyltransferase 0.981 4 173 GO:0016747

Map