F433886

General Info

Members Datasets Scaffolds Average Seq Length
397 250 794 81

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0049822|Ga0501076_0049822_280_579
Length 99
Sequence LPPAARRCGARRVAWMEGAMSEQNLESELARLRAENEALKARGQRSGQIRVSEKGGVSVYGLGRFPVTLYKEQWRRLLDMADEIRAFIRDHESELKSKD

Samples

Sample ID Description Type Environment
1 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
102 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
147 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
148 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
151 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
160 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
161 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
169 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
185 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
223 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
224 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
234 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.27
Nodule 0
Rhizoplane 8.06
Rhizosphere 88.92
Stem 0
Stem Tuber 0
Unclassified 28.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501076_0049822 3300049592 Bacteria 3313
2 JGI25404J52841_10000276 3300003659 Bacteria 6585
3 JGI25405J52794_10091572 3300003911 Unclassified 674
4 Ga0065707_10120694 3300005295 Bacteria 2128
5 Ga0070676_10170934 3300005328 Bacteria 1406
6 Ga0070676_10198239 3300005328 Unclassified 1315
7 Ga0070670_100360313 3300005331 Bacteria 1279
8 Ga0070670_100878402 3300005331 Bacteria 812
9 Ga0070670_101756856 3300005331 Unclassified 571
10 Ga0068869_100137092 3300005334 Bacteria 1886
11 Ga0068869_100603003 3300005334 Unclassified 928
12 Ga0070666_11460879 3300005335 Bacteria 511
13 Ga0070680_101459261 3300005336 Unclassified 592
14 Ga0070680_101861720 3300005336 Unclassified 521
15 Ga0070682_101647627 3300005337 Unclassified 556
16 Ga0068868_101117594 3300005338 Bacteria 726
17 Ga0070660_100167250 3300005339 Bacteria 1774
18 Ga0070689_101810080 3300005340 Unclassified 557
19 Ga0070689_101810439 3300005340 Unclassified 557
20 Ga0070687_100237115 3300005343 Bacteria 1126
21 Ga0070661_100298938 3300005344 Bacteria 1252
22 Ga0070661_100367571 3300005344 Unclassified 1132
23 Ga0070668_100620609 3300005347 Unclassified 947
24 Ga0070669_100115746 3300005353 Bacteria 2040
25 Ga0070675_101051399 3300005354 Bacteria 748
26 Ga0070671_101331865 3300005355 Bacteria 634
27 Ga0070674_100199652 3300005356 Bacteria 1544
28 Ga0070688_100350161 3300005365 Bacteria 1081
29 Ga0070659_100271714 3300005366 Bacteria 1409
30 Ga0070703_10109496 3300005406 Unclassified 986
31 Ga0070710_10325939 3300005437 Bacteria 1010
32 Ga0070705_100404449 3300005440 Bacteria 1012
33 Ga0070700_100163137 3300005441 Bacteria 1536
34 Ga0070700_100435869 3300005441 Bacteria 994
35 Ga0070694_100688245 3300005444 Bacteria 831
36 Ga0070678_100099873 3300005456 Bacteria 2246
37 Ga0070678_101670956 3300005456 Bacteria 599
38 Ga0070662_100580483 3300005457 Unclassified 941
39 Ga0070681_10063819 3300005458 Bacteria 3656
40 Ga0070681_10498899 3300005458 Unclassified 1130
41 Ga0070681_10810674 3300005458 Bacteria 853
42 Ga0070685_10751264 3300005466 Unclassified 715
43 Ga0070698_100606758 3300005471 Bacteria 1035
44 Ga0070699_100331497 3300005518 Bacteria 1369
45 Ga0070672_100443887 3300005543 Bacteria 1117
46 Ga0070695_100679270 3300005545 Bacteria 815
47 Ga0070696_100177091 3300005546 Bacteria 1580
48 Ga0070693_100362646 3300005547 Bacteria 995
49 Ga0070693_101039113 3300005547 Unclassified 622
50 Ga0070693_101610117 3300005547 Unclassified 510
51 Ga0070693_101671822 3300005547 Unclassified 502
52 Ga0070665_101980561 3300005548 Bacteria 588
53 Ga0070704_100417933 3300005549 Bacteria 1148
54 Ga0068855_100243365 3300005563 Bacteria 2009
55 Ga0068857_100853962 3300005577 Unclassified 871
56 Ga0070702_100208423 3300005615 Bacteria 1299
57 Ga0068859_100378746 3300005617 Bacteria 1511
58 Ga0068864_100145691 3300005618 Bacteria 2141
59 Ga0068864_100343821 3300005618 Bacteria 1406
60 Ga0068866_10055256 3300005718 Bacteria 2038
61 Ga0068861_100181508 3300005719 Bacteria 1752
62 Ga0068863_102620268 3300005841 Bacteria 513
63 Ga0068858_100569445 3300005842 Unclassified 1097
64 Ga0068858_101085706 3300005842 Bacteria 785
65 Ga0068860_100260448 3300005843 Bacteria 1690
66 Ga0068860_102583691 3300005843 Unclassified 527
67 Ga0068862_100542913 3300005844 Bacteria 1109
68 Ga0081455_10000893 3300005937 Bacteria 38471
69 Ga0081540_1002281 3300005983 Bacteria 15757
70 Ga0081539_10000009 3300005985 Bacteria 509286
71 Ga0075364_10164942 3300006051 Bacteria 1496
72 Ga0070715_10018443 3300006163 Unclassified 2659
73 Ga0070715_10491619 3300006163 Bacteria 701
74 Ga0070716_100720323 3300006173 Bacteria 764
75 Ga0070716_101576479 3300006173 Unclassified 539
76 Ga0070712_100500718 3300006175 Bacteria 1018
77 Ga0070712_100951710 3300006175 Unclassified 742
78 Ga0075362_10006284 3300006177 Bacteria 4416
79 Ga0075367_10114300 3300006178 Bacteria 1659
80 Ga0075366_10646112 3300006195 Unclassified 656
81 Ga0097621_100665698 3300006237 Unclassified 956
82 Ga0097621_101060753 3300006237 Bacteria 760
83 Ga0068871_100195939 3300006358 Unclassified 1742
84 Ga0068871_100363050 3300006358 Bacteria 1283
85 Ga0075428_100400246 3300006844 Bacteria 1472
86 Ga0075428_101049473 3300006844 Bacteria 862
87 Ga0075430_100492161 3300006846 Bacteria 1012
88 Ga0075431_100039355 3300006847 Bacteria 4870
89 Ga0075431_100494669 3300006847 Bacteria 1215
90 Ga0075431_101113940 3300006847 Bacteria 754
91 Ga0075431_101567687 3300006847 Bacteria 617
92 Ga0075433_10006517 3300006852 Bacteria 9234
93 Ga0075433_10222397 3300006852 Unclassified 1677
94 Ga0075434_100015266 3300006871 Bacteria 7361
95 Ga0075434_100214368 3300006871 Bacteria 1945
96 Ga0075434_102255101 3300006871 Unclassified 548
97 Ga0075429_100078113 3300006880 Bacteria 2884
98 Ga0075429_100305698 3300006880 Bacteria 1392
99 Ga0068865_100048757 3300006881 Bacteria 2916
100 Ga0075436_100003035 3300006914 Bacteria 11502
101 Ga0097620_100378749 3300006931 Bacteria 1511
102 Ga0075435_100147516 3300007076 Bacteria 1976
103 Ga0105250_10115451 3300009092 Bacteria 1101
104 Ga0111539_10962705 3300009094 Bacteria 992
105 Ga0105245_10310687 3300009098 Bacteria 1550
106 Ga0105245_12382805 3300009098 Unclassified 583
107 Ga0105247_10504080 3300009101 Bacteria 882
108 Ga0105247_11159484 3300009101 Unclassified 613
109 Ga0114129_10000439 3300009147 Bacteria 49346
110 Ga0114129_10002794 3300009147 Bacteria 24351
111 Ga0114129_10109670 3300009147 Bacteria 3810
112 Ga0114129_10819411 3300009147 Bacteria 1186
113 Ga0114129_11262976 3300009147 Bacteria 917
114 Ga0114129_13204440 3300009147 Unclassified 532
115 Ga0105243_12979243 3300009148 Unclassified 514
116 Ga0105241_10211135 3300009174 Bacteria 1626
117 Ga0105241_11541158 3300009174 Bacteria 641
118 Ga0105242_10475810 3300009176 Bacteria 1183
119 Ga0105242_11243034 3300009176 Unclassified 766
120 Ga0105248_10426371 3300009177 Bacteria 1494
121 Ga0105248_11287848 3300009177 Unclassified 827
122 Ga0105237_10879422 3300009545 Unclassified 903
123 Ga0105237_11809564 3300009545 Unclassified 618
124 Ga0105238_10007811 3300009551 Bacteria 10698
125 Ga0105238_10351089 3300009551 Unclassified 1464
126 Ga0105238_10866603 3300009551 Unclassified 921
127 Ga0105249_10129702 3300009553 Bacteria 2405
128 Ga0105239_10631844 3300010375 Bacteria 1222
129 Ga0105246_10443576 3300011119 Unclassified 1089
130 Ga0157373_10870744 3300013100 Unclassified 667
131 Ga0157369_11350423 3300013105 Bacteria 726
132 Ga0157374_10450364 3300013296 Bacteria 1288
133 Ga0157374_10643521 3300013296 Unclassified 1072
134 Ga0157374_10737436 3300013296 Bacteria 999
135 Ga0157378_10486933 3300013297 Bacteria 1230
136 Ga0157378_12744781 3300013297 Bacteria 545
137 Ga0163162_10061273 3300013306 Bacteria 3800
138 Ga0163162_10387088 3300013306 Bacteria 1531
139 Ga0163162_10701132 3300013306 Bacteria 1134
140 Ga0157372_11024092 3300013307 Unclassified 956
141 Ga0157372_13016496 3300013307 Unclassified 538
142 Ga0157375_10444909 3300013308 Bacteria 1461
143 Ga0157375_11363001 3300013308 Unclassified 835
144 Ga0157375_11484760 3300013308 Unclassified 800
145 Ga0157375_11996249 3300013308 Bacteria 689
146 Ga0163163_10946249 3300014325 Unclassified 925
147 Ga0157380_10357291 3300014326 Bacteria 1369
148 Ga0157377_10237400 3300014745 Bacteria 1175
149 Ga0157379_10197719 3300014968 Bacteria 1817
150 Ga0157379_10477217 3300014968 Bacteria 1154
151 Ga0157376_10770640 3300014969 Bacteria 973
152 Ga0163161_10232624 3300017792 Bacteria 1431
153 Ga0213876_10749258 3300021384 Bacteria 520
154 Ga0228598_1014928 3300024227 Bacteria 1535
155 Ga0207696_1083274 3300025711 Unclassified 882
156 Ga0207653_10092043 3300025885 Unclassified 1063
157 Ga0207642_10037396 3300025899 Bacteria 2091
158 Ga0207710_10683591 3300025900 Unclassified 538
159 Ga0207680_11357032 3300025903 Bacteria 505
160 Ga0207647_10080398 3300025904 Bacteria 1955
161 Ga0207647_10324975 3300025904 Unclassified 873
162 Ga0207645_10034983 3300025907 Bacteria 3226
163 Ga0207645_10059232 3300025907 Bacteria 2446
164 Ga0207645_10373559 3300025907 Bacteria 956
165 Ga0207643_10326211 3300025908 Bacteria 960
166 Ga0207707_11003938 3300025912 Unclassified 685
167 Ga0207693_11309897 3300025915 Unclassified 541
168 Ga0207663_11730022 3300025916 Bacteria 503
169 Ga0207660_11232324 3300025917 Unclassified 608
170 Ga0207662_10015619 3300025918 Bacteria 4274
171 Ga0207662_10324226 3300025918 Bacteria 1029
172 Ga0207657_10186971 3300025919 Bacteria 1672
173 Ga0207657_10364645 3300025919 Unclassified 1138
174 Ga0207681_11161684 3300025923 Unclassified 648
175 Ga0207694_10300360 3300025924 Unclassified 1322
176 Ga0207650_10683670 3300025925 Unclassified 866
177 Ga0207687_10304938 3300025927 Bacteria 1284
178 Ga0207644_10663558 3300025931 Bacteria 868
179 Ga0207644_10931143 3300025931 Unclassified 729
180 Ga0207644_11329841 3300025931 Bacteria 604
181 Ga0207706_11040531 3300025933 Unclassified 686
182 Ga0207706_11316705 3300025933 Unclassified 596
183 Ga0207686_10465401 3300025934 Unclassified 975
184 Ga0207686_11006916 3300025934 Unclassified 676
185 Ga0207709_10835285 3300025935 Bacteria 745
186 Ga0207670_10255128 3300025936 Bacteria 1357
187 Ga0207691_10195705 3300025940 Bacteria 1761
188 Ga0207711_10068028 3300025941 Bacteria 3084
189 Ga0207711_10470245 3300025941 Unclassified 1171
190 Ga0207689_10033354 3300025942 Bacteria 4279
191 Ga0207689_10152119 3300025942 Bacteria 1907
192 Ga0207679_12128862 3300025945 Unclassified 509
193 Ga0207667_10037763 3300025949 Bacteria 5162
194 Ga0207651_11198069 3300025960 Bacteria 682
195 Ga0207712_10023252 3300025961 Bacteria 4089
196 Ga0207712_12055070 3300025961 Unclassified 511
197 Ga0207668_10116945 3300025972 Bacteria 2011
198 Ga0207668_11658985 3300025972 Bacteria 577
199 Ga0207640_11109065 3300025981 Unclassified 700
200 Ga0207658_10651734 3300025986 Bacteria 949
201 Ga0207658_11440635 3300025986 Unclassified 630
202 Ga0207703_10862464 3300026035 Unclassified 866
203 Ga0207703_10979666 3300026035 Bacteria 811
204 Ga0207708_10269469 3300026075 Bacteria 1377
205 Ga0207648_11576859 3300026089 Bacteria 617
206 Ga0207676_10374442 3300026095 Unclassified 1324
207 Ga0207676_11184286 3300026095 Bacteria 757
208 Ga0207674_10655377 3300026116 Unclassified 1014
209 Ga0207675_100091251 3300026118 Bacteria 2864
210 Ga0207675_100853119 3300026118 Bacteria 926
211 Ga0207683_10108817 3300026121 Unclassified 2480
212 Ga0207683_10960491 3300026121 Bacteria 794
213 Ga0207428_10898594 3300027907 Unclassified 626
214 Ga0268265_10938773 3300028380 Bacteria 851
215 Ga0307509_10250817 3300031507 Bacteria 1554
216 Ga0307411_11981744 3300032005 Viruses 543
217 Ga0373958_0006232 3300034819 Bacteria 1850
218 Ga0373938_0124466 3300034957 Bacteria 667
219 Ga0373952_0030415 3300035092 Bacteria 1195
220 Ga0373939_0115526 3300035114 Bacteria 940
221 Ga0373945_0355613 3300035116 Unclassified 636
222 Ga0373960_0091474 3300035121 Bacteria 973
223 Ga0373955_0382427 3300035172 Bacteria 854
224 Ga0373961_0046694 3300035241 Bacteria 1270
225 Ga0373931_0546899 3300035691 Unclassified 752
226 Ga0373935_1505680 3300035692 Unclassified 504
227 Ga0373927_0472924 3300035695 Unclassified 828
228 Ga0373937_0330910 3300036401 Bacteria 1442
229 Ga0436360_1227581 3300039438 Bacteria 789
230 Ga0439453_0127586 3300041408 Bacteria 588
231 Ga0451798_0622524 3300041458 Bacteria 622
232 Ga0439459_0081768 3300042438 Unclassified 764
233 Ga0451577_0905951 3300042876 Unclassified 794
234 Ga0453684_1970709 3300044712 Unclassified 589
235 Ga0451576_0594469 3300045051 Bacteria 1163
236 Ga0466967_0231837 3300045976 Bacteria 1758
237 Ga0495629_0311014 3300046459 Bacteria 1078
238 Ga0495629_0576300 3300046459 Bacteria 754
239 Ga0495651_0226012 3300046462 Bacteria 1292
240 Ga0495605_0174538 3300046474 Unclassified 948
241 Ga0495584_0195423 3300046491 Bacteria 1028
242 Ga0495631_0353790 3300046518 Bacteria 625
243 Ga0495640_0813300 3300046533 Unclassified 556
244 Ga0495668_0253014 3300046616 Unclassified 964
245 Ga0495634_0546076 3300046642 Unclassified 676
246 Ga0495599_0327033 3300046678 Bacteria 922
247 Ga0495613_0164085 3300046689 Bacteria 1579
248 Ga0495670_0109108 3300046691 Bacteria 1431
249 Ga0495671_0193847 3300046692 Bacteria 986
250 Ga0495649_0216774 3300046694 Bacteria 991
251 Ga0495604_0939003 3300047317 Unclassified 538
252 Ga0495636_0191082 3300047318 Unclassified 932
253 Ga0495674_0519336 3300047319 Bacteria 951
254 Ga0495672_0059466 3300047320 Bacteria 2211
255 Ga0495680_0300425 3300047322 Bacteria 1127
256 Ga0495683_0424361 3300047323 Unclassified 549
257 Ga0495677_0327949 3300047445 Bacteria 603
258 Ga0495602_1055009 3300048088 Unclassified 534
259 Ga0496100_0010328 3300048903 Bacteria 5282
260 Ga0496100_0231117 3300048903 Bacteria 1361
261 Ga0496100_1537125 3300048903 Unclassified 526
262 Ga0496100_1668202 3300048903 Bacteria 504
263 Ga0496101_0450741 3300048904 Bacteria 1015
264 Ga0496101_0809009 3300048904 Unclassified 739
265 Ga0496102_0047399 3300048905 Bacteria 3905
266 Ga0496102_0866446 3300048905 Unclassified 825
267 Ga0496103_0103129 3300048906 Bacteria 1807
268 Ga0496104_0079541 3300048907 Unclassified 3125
269 Ga0496104_0206814 3300048907 Bacteria 1874
270 Ga0496105_0033194 3300048908 Bacteria 4237
271 Ga0496106_0068422 3300048909 Bacteria 2708
272 Ga0496106_0259780 3300048909 Bacteria 1390
273 Ga0496106_0295465 3300048909 Bacteria 1299
274 Ga0496107_0011765 3300048910 Bacteria 6105
275 Ga0496108_0113255 3300048911 Bacteria 2321
276 Ga0496109_0088153 3300048912 Bacteria 2867
277 Ga0496110_0113936 3300048913 Bacteria 2432
278 Ga0496110_1540411 3300048913 Bacteria 575
279 Ga0496111_0247089 3300048914 Bacteria 1325
280 Ga0496112_0015853 3300048915 Bacteria 7043
281 Ga0496112_0022929 3300048915 Bacteria 5956
282 Ga0496112_0402575 3300048915 Bacteria 1308
283 Ga0496112_1588245 3300048915 Bacteria 567
284 Ga0496113_0116813 3300048916 Bacteria 2082
285 Ga0496113_0787245 3300048916 Bacteria 756
286 Ga0496114_0270734 3300048917 Bacteria 1496
287 Ga0496114_1257189 3300048917 Bacteria 627
288 Ga0496115_0076660 3300048918 Bacteria 2717
289 Ga0496115_1292965 3300048918 Unclassified 544
290 Ga0496118_0102158 3300048921 Bacteria 1933
291 Ga0501031_0822043 3300049568 Unclassified 595
292 Ga0501032_1015498 3300049569 Unclassified 521
293 Ga0501036_0007436 3300049572 Bacteria 8923
294 Ga0501036_0186612 3300049572 Bacteria 1745
295 Ga0501036_0190467 3300049572 Unclassified 1726
296 Ga0501036_1435029 3300049572 Bacteria 559
297 Ga0501037_0246293 3300049573 Bacteria 1252
298 Ga0501038_0001025 3300049574 Bacteria 25187
299 Ga0501038_0043937 3300049574 Bacteria 3884
300 Ga0501039_0013432 3300049575 Bacteria 6263
301 Ga0501039_0260415 3300049575 Bacteria 1363
302 Ga0501039_1119682 3300049575 Bacteria 610
303 Ga0501039_1476761 3300049575 Unclassified 523
304 Ga0501040_0009141 3300049576 Bacteria 6453
305 Ga0501040_0011150 3300049576 Bacteria 5876
306 Ga0501040_0061135 3300049576 Bacteria 2590
307 Ga0501040_0086985 3300049576 Bacteria 2170
308 Ga0501041_0401790 3300049577 Unclassified 868
309 Ga0501042_0022034 3300049578 Bacteria 4448
310 Ga0501042_0059682 3300049578 Bacteria 2724
311 Ga0501042_0192391 3300049578 Bacteria 1471
312 Ga0501042_0524568 3300049578 Bacteria 860
313 Ga0501043_0141763 3300049579 Unclassified 1882
314 Ga0501046_0006710 3300049580 Bacteria 10164
315 Ga0501046_0035027 3300049580 Bacteria 4047
316 Ga0501046_0068052 3300049580 Bacteria 2772
317 Ga0501048_0204869 3300049582 Bacteria 1399
318 Ga0501068_0160998 3300049584 Unclassified 1414
319 Ga0501071_0237653 3300049587 Archaea 1373
320 Ga0501072_0010408 3300049588 Bacteria 7087
321 Ga0501072_0058571 3300049588 Unclassified 3036
322 Ga0501072_0144772 3300049588 Bacteria 1895
323 Ga0501072_0677869 3300049588 Bacteria 811
324 Ga0501072_0852819 3300049588 Bacteria 712
325 Ga0501074_0044366 3300049590 Bacteria 3219
326 Ga0501075_0000003 3300049591 Bacteria 173182
327 Ga0501075_0022264 3300049591 Bacteria 4627
328 Ga0501075_0022932 3300049591 Bacteria 4566
329 Ga0501075_0045900 3300049591 Bacteria 3281
330 Ga0501075_0811390 3300049591 Bacteria 712
331 Ga0501076_0000010 3300049592 Bacteria 116774
332 Ga0501076_0986019 3300049592 Bacteria 694
333 Ga0501077_0013600 3300049593 Bacteria 5102
334 Ga0501077_0071731 3300049593 Archaea 2195
335 Ga0501077_0603041 3300049593 Unclassified 705
336 Ga0501077_0890559 3300049593 Unclassified 572
337 Ga0501208_155902 3300049655 Bacteria 519
338 Ga0501209_125751 3300049656 Bacteria 763
339 Ga0501249_003631 3300049679 Bacteria 3106
340 Ga0501079_0002335 3300049741 Bacteria 13757
341 Ga0501079_0077795 3300049741 Unclassified 2566
342 Ga0501079_0088968 3300049741 Bacteria 2391
343 Ga0501079_0236943 3300049741 Bacteria 1426
344 Ga0501079_1310261 3300049741 Unclassified 570
345 Ga0501080_0048129 3300049742 Unclassified 3969
346 Ga0501080_0147531 3300049742 Bacteria 2175
347 Ga0501080_0590834 3300049742 Bacteria 986
348 Ga0501081_0000505 3300049743 Bacteria 21913
349 Ga0501081_1038576 3300049743 Bacteria 620
350 Ga0501083_0273898 3300049744 Archaea 1098
351 Ga0501083_0355837 3300049744 Unclassified 952
352 Ga0501083_0451133 3300049744 Unclassified 837
353 Ga0501268_035982 3300049765 Bacteria 915
354 Ga0501035_0077158 3300049822 Bacteria 2945
355 Ga0501035_0575042 3300049822 Bacteria 921
356 Ga0501045_0025359 3300049824 Bacteria 4262
357 Ga0501045_0038775 3300049824 Bacteria 3466
358 Ga0501045_0661870 3300049824 Unclassified 771
359 nmdc:mga03683_7052_c1 3300050489 Bacteria 3879
360 nmdc:mga00v17_199321_c1 3300050491 Unclassified 1294
361 nmdc:mga0yw44_1246017_c1 3300050492 Unclassified 501
362 nmdc:mga0k408_180063_c1 3300050493 Bacteria 1260
363 nmdc:mga06z11_53405_c1 3300050494 Bacteria 2078
364 nmdc:mga05p37_256003_c1 3300050507 Bacteria 2098
365 nmdc:mga05p37_3855_c1 3300050507 Bacteria 17548
366 nmdc:mga05p37_73293_c1 3300050507 Bacteria 4214
367 nmdc:mga05p37_768614_c1 3300050507 Bacteria 1059
368 nmdc:mga09592_295277_c1 3300050508 Bacteria 1405
369 nmdc:mga09592_542468_c1 3300050508 Bacteria 999
370 nmdc:mga0qj67_270012_c1 3300050509 Bacteria 1379
371 nmdc:mga06r32_281331_c1 3300050510 Bacteria 1650
372 nmdc:mga06r32_58203_c1 3300050510 Bacteria 3714
373 nmdc:mga0n895_1035797_c1 3300050512 Bacteria 800
374 nmdc:mga0n895_2213_c1 3300050512 Bacteria 15039
375 nmdc:mga0rr50_1231449_c1 3300050513 Bacteria 635
376 nmdc:mga0rr50_1267472_c1 3300050513 Bacteria 625
377 nmdc:mga0rr50_2584_c1 3300050513 Bacteria 10252
378 nmdc:mga0rr50_911243_c1 3300050513 Unclassified 749
379 nmdc:mga08x19_26766_c1 3300050514 Bacteria 3601
380 nmdc:mga0a205_16624_c1 3300050515 Bacteria 6891
381 nmdc:mga0a205_238175_c1 3300050515 Bacteria 1701
382 Ga0495601_0040798 3300053077 Bacteria 2908
383 Ga0495601_0581593 3300053077 Unclassified 719
384 Ga0495612_0032202 3300053078 Unclassified 2118
385 Ga0495619_0018997 3300053085 Bacteria 4365
386 Ga0495619_0199869 3300053085 Bacteria 1383
387 Ga0495619_0306642 3300053085 Bacteria 1100
388 Ga0501084_0008460 3300054114 Bacteria 8507
389 Ga0501084_1212116 3300054114 Bacteria 633
390 Ga0501082_0000478 3300060353 Bacteria 35347
391 Ga0501082_0083507 3300060353 Bacteria 2756
392 Ga0501082_0170360 3300060353 Bacteria 1893
393 Ga0501082_0263802 3300060353 Bacteria 1498
394 Ga0501082_0672275 3300060353 Unclassified 906
395 Ga0530510_0000008 3300061734 Bacteria 165671
396 Ga0530510_0019902 3300061734 Bacteria 4769
397 Ga0530510_1167231 3300061734 Bacteria 590
398 Ga0501076_0049822
399 JGI25404J52841_10000276
400 JGI25405J52794_10091572
401 Ga0065707_10120694
402 Ga0070676_10170934
403 Ga0070676_10198239
404 Ga0070670_100360313
405 Ga0070670_100878402
406 Ga0070670_101756856
407 Ga0068869_100137092
408 Ga0068869_100603003
409 Ga0070666_11460879
410 Ga0070680_101459261
411 Ga0070680_101861720
412 Ga0070682_101647627
413 Ga0068868_101117594
414 Ga0070660_100167250
415 Ga0070689_101810080
416 Ga0070689_101810439
417 Ga0070687_100237115
418 Ga0070661_100298938
419 Ga0070661_100367571
420 Ga0070668_100620609
421 Ga0070669_100115746
422 Ga0070675_101051399
423 Ga0070671_101331865
424 Ga0070674_100199652
425 Ga0070688_100350161
426 Ga0070659_100271714
427 Ga0070703_10109496
428 Ga0070710_10325939
429 Ga0070705_100404449
430 Ga0070700_100163137
431 Ga0070700_100435869
432 Ga0070694_100688245
433 Ga0070678_100099873
434 Ga0070678_101670956
435 Ga0070662_100580483
436 Ga0070681_10063819
437 Ga0070681_10498899
438 Ga0070681_10810674
439 Ga0070685_10751264
440 Ga0070698_100606758
441 Ga0070699_100331497
442 Ga0070672_100443887
443 Ga0070695_100679270
444 Ga0070696_100177091
445 Ga0070693_100362646
446 Ga0070693_101039113
447 Ga0070693_101610117
448 Ga0070693_101671822
449 Ga0070665_101980561
450 Ga0070704_100417933
451 Ga0068855_100243365
452 Ga0068857_100853962
453 Ga0070702_100208423
454 Ga0068859_100378746
455 Ga0068864_100145691
456 Ga0068864_100343821
457 Ga0068866_10055256
458 Ga0068861_100181508
459 Ga0068863_102620268
460 Ga0068858_100569445
461 Ga0068858_101085706
462 Ga0068860_100260448
463 Ga0068860_102583691
464 Ga0068862_100542913
465 Ga0081455_10000893
466 Ga0081540_1002281
467 Ga0081539_10000009
468 Ga0075364_10164942
469 Ga0070715_10018443
470 Ga0070715_10491619
471 Ga0070716_100720323
472 Ga0070716_101576479
473 Ga0070712_100500718
474 Ga0070712_100951710
475 Ga0075362_10006284
476 Ga0075367_10114300
477 Ga0075366_10646112
478 Ga0097621_100665698
479 Ga0097621_101060753
480 Ga0068871_100195939
481 Ga0068871_100363050
482 Ga0075428_100400246
483 Ga0075428_101049473
484 Ga0075430_100492161
485 Ga0075431_100039355
486 Ga0075431_100494669
487 Ga0075431_101113940
488 Ga0075431_101567687
489 Ga0075433_10006517
490 Ga0075433_10222397
491 Ga0075434_100015266
492 Ga0075434_100214368
493 Ga0075434_102255101
494 Ga0075429_100078113
495 Ga0075429_100305698
496 Ga0068865_100048757
497 Ga0075436_100003035
498 Ga0097620_100378749
499 Ga0075435_100147516
500 Ga0105250_10115451
501 Ga0111539_10962705
502 Ga0105245_10310687
503 Ga0105245_12382805
504 Ga0105247_10504080
505 Ga0105247_11159484
506 Ga0114129_10000439
507 Ga0114129_10002794
508 Ga0114129_10109670
509 Ga0114129_10819411
510 Ga0114129_11262976
511 Ga0114129_13204440
512 Ga0105243_12979243
513 Ga0105241_10211135
514 Ga0105241_11541158
515 Ga0105242_10475810
516 Ga0105242_11243034
517 Ga0105248_10426371
518 Ga0105248_11287848
519 Ga0105237_10879422
520 Ga0105237_11809564
521 Ga0105238_10007811
522 Ga0105238_10351089
523 Ga0105238_10866603
524 Ga0105249_10129702
525 Ga0105239_10631844
526 Ga0105246_10443576
527 Ga0157373_10870744
528 Ga0157369_11350423
529 Ga0157374_10450364
530 Ga0157374_10643521
531 Ga0157374_10737436
532 Ga0157378_10486933
533 Ga0157378_12744781
534 Ga0163162_10061273
535 Ga0163162_10387088
536 Ga0163162_10701132
537 Ga0157372_11024092
538 Ga0157372_13016496
539 Ga0157375_10444909
540 Ga0157375_11363001
541 Ga0157375_11484760
542 Ga0157375_11996249
543 Ga0163163_10946249
544 Ga0157380_10357291
545 Ga0157377_10237400
546 Ga0157379_10197719
547 Ga0157379_10477217
548 Ga0157376_10770640
549 Ga0163161_10232624
550 Ga0213876_10749258
551 Ga0228598_1014928
552 Ga0207696_1083274
553 Ga0207653_10092043
554 Ga0207642_10037396
555 Ga0207710_10683591
556 Ga0207680_11357032
557 Ga0207647_10080398
558 Ga0207647_10324975
559 Ga0207645_10034983
560 Ga0207645_10059232
561 Ga0207645_10373559
562 Ga0207643_10326211
563 Ga0207707_11003938
564 Ga0207693_11309897
565 Ga0207663_11730022
566 Ga0207660_11232324
567 Ga0207662_10015619
568 Ga0207662_10324226
569 Ga0207657_10186971
570 Ga0207657_10364645
571 Ga0207681_11161684
572 Ga0207694_10300360
573 Ga0207650_10683670
574 Ga0207687_10304938
575 Ga0207644_10663558
576 Ga0207644_10931143
577 Ga0207644_11329841
578 Ga0207706_11040531
579 Ga0207706_11316705
580 Ga0207686_10465401
581 Ga0207686_11006916
582 Ga0207709_10835285
583 Ga0207670_10255128
584 Ga0207691_10195705
585 Ga0207711_10068028
586 Ga0207711_10470245
587 Ga0207689_10033354
588 Ga0207689_10152119
589 Ga0207679_12128862
590 Ga0207667_10037763
591 Ga0207651_11198069
592 Ga0207712_10023252
593 Ga0207712_12055070
594 Ga0207668_10116945
595 Ga0207668_11658985
596 Ga0207640_11109065
597 Ga0207658_10651734
598 Ga0207658_11440635
599 Ga0207703_10862464
600 Ga0207703_10979666
601 Ga0207708_10269469
602 Ga0207648_11576859
603 Ga0207676_10374442
604 Ga0207676_11184286
605 Ga0207674_10655377
606 Ga0207675_100091251
607 Ga0207675_100853119
608 Ga0207683_10108817
609 Ga0207683_10960491
610 Ga0207428_10898594
611 Ga0268265_10938773
612 Ga0307509_10250817
613 Ga0307411_11981744
614 Ga0373958_0006232
615 Ga0373938_0124466
616 Ga0373952_0030415
617 Ga0373939_0115526
618 Ga0373945_0355613
619 Ga0373960_0091474
620 Ga0373955_0382427
621 Ga0373961_0046694
622 Ga0373931_0546899
623 Ga0373935_1505680
624 Ga0373927_0472924
625 Ga0373937_0330910
626 Ga0436360_1227581
627 Ga0439453_0127586
628 Ga0451798_0622524
629 Ga0439459_0081768
630 Ga0451577_0905951
631 Ga0453684_1970709
632 Ga0451576_0594469
633 Ga0466967_0231837
634 Ga0495629_0311014
635 Ga0495629_0576300
636 Ga0495651_0226012
637 Ga0495605_0174538
638 Ga0495584_0195423
639 Ga0495631_0353790
640 Ga0495640_0813300
641 Ga0495668_0253014
642 Ga0495634_0546076
643 Ga0495599_0327033
644 Ga0495613_0164085
645 Ga0495670_0109108
646 Ga0495671_0193847
647 Ga0495649_0216774
648 Ga0495604_0939003
649 Ga0495636_0191082
650 Ga0495674_0519336
651 Ga0495672_0059466
652 Ga0495680_0300425
653 Ga0495683_0424361
654 Ga0495677_0327949
655 Ga0495602_1055009
656 Ga0496100_0010328
657 Ga0496100_0231117
658 Ga0496100_1537125
659 Ga0496100_1668202
660 Ga0496101_0450741
661 Ga0496101_0809009
662 Ga0496102_0047399
663 Ga0496102_0866446
664 Ga0496103_0103129
665 Ga0496104_0079541
666 Ga0496104_0206814
667 Ga0496105_0033194
668 Ga0496106_0068422
669 Ga0496106_0259780
670 Ga0496106_0295465
671 Ga0496107_0011765
672 Ga0496108_0113255
673 Ga0496109_0088153
674 Ga0496110_0113936
675 Ga0496110_1540411
676 Ga0496111_0247089
677 Ga0496112_0015853
678 Ga0496112_0022929
679 Ga0496112_0402575
680 Ga0496112_1588245
681 Ga0496113_0116813
682 Ga0496113_0787245
683 Ga0496114_0270734
684 Ga0496114_1257189
685 Ga0496115_0076660
686 Ga0496115_1292965
687 Ga0496118_0102158
688 Ga0501031_0822043
689 Ga0501032_1015498
690 Ga0501036_0007436
691 Ga0501036_0186612
692 Ga0501036_0190467
693 Ga0501036_1435029
694 Ga0501037_0246293
695 Ga0501038_0001025
696 Ga0501038_0043937
697 Ga0501039_0013432
698 Ga0501039_0260415
699 Ga0501039_1119682
700 Ga0501039_1476761
701 Ga0501040_0009141
702 Ga0501040_0011150
703 Ga0501040_0061135
704 Ga0501040_0086985
705 Ga0501041_0401790
706 Ga0501042_0022034
707 Ga0501042_0059682
708 Ga0501042_0192391
709 Ga0501042_0524568
710 Ga0501043_0141763
711 Ga0501046_0006710
712 Ga0501046_0035027
713 Ga0501046_0068052
714 Ga0501048_0204869
715 Ga0501068_0160998
716 Ga0501071_0237653
717 Ga0501072_0010408
718 Ga0501072_0058571
719 Ga0501072_0144772
720 Ga0501072_0677869
721 Ga0501072_0852819
722 Ga0501074_0044366
723 Ga0501075_0000003
724 Ga0501075_0022264
725 Ga0501075_0022932
726 Ga0501075_0045900
727 Ga0501075_0811390
728 Ga0501076_0000010
729 Ga0501076_0986019
730 Ga0501077_0013600
731 Ga0501077_0071731
732 Ga0501077_0603041
733 Ga0501077_0890559
734 Ga0501208_155902
735 Ga0501209_125751
736 Ga0501249_003631
737 Ga0501079_0002335
738 Ga0501079_0077795
739 Ga0501079_0088968
740 Ga0501079_0236943
741 Ga0501079_1310261
742 Ga0501080_0048129
743 Ga0501080_0147531
744 Ga0501080_0590834
745 Ga0501081_0000505
746 Ga0501081_1038576
747 Ga0501083_0273898
748 Ga0501083_0355837
749 Ga0501083_0451133
750 Ga0501268_035982
751 Ga0501035_0077158
752 Ga0501035_0575042
753 Ga0501045_0025359
754 Ga0501045_0038775
755 Ga0501045_0661870
756 nmdc:mga03683_7052_c1
757 nmdc:mga00v17_199321_c1
758 nmdc:mga0yw44_1246017_c1
759 nmdc:mga0k408_180063_c1
760 nmdc:mga06z11_53405_c1
761 nmdc:mga05p37_256003_c1
762 nmdc:mga05p37_3855_c1
763 nmdc:mga05p37_73293_c1
764 nmdc:mga05p37_768614_c1
765 nmdc:mga09592_295277_c1
766 nmdc:mga09592_542468_c1
767 nmdc:mga0qj67_270012_c1
768 nmdc:mga06r32_281331_c1
769 nmdc:mga06r32_58203_c1
770 nmdc:mga0n895_1035797_c1
771 nmdc:mga0n895_2213_c1
772 nmdc:mga0rr50_1231449_c1
773 nmdc:mga0rr50_1267472_c1
774 nmdc:mga0rr50_2584_c1
775 nmdc:mga0rr50_911243_c1
776 nmdc:mga08x19_26766_c1
777 nmdc:mga0a205_16624_c1
778 nmdc:mga0a205_238175_c1
779 Ga0495601_0040798
780 Ga0495601_0581593
781 Ga0495612_0032202
782 Ga0495619_0018997
783 Ga0495619_0199869
784 Ga0495619_0306642
785 Ga0501084_0008460
786 Ga0501084_1212116
787 Ga0501082_0000478
788 Ga0501082_0083507
789 Ga0501082_0170360
790 Ga0501082_0263802
791 Ga0501082_0672275
792 Ga0530510_0000008
793 Ga0530510_0019902
794 Ga0530510_1167231

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nhn-assembly1.cif.gz_K vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.7332 24 50
5vdn-assembly1.cif.gz_B 1.55 angstrom resolution crystal structure of glutathione reductase from yersinia pestis in complex with fad 0.7311 29 49
1u8r-assembly2.cif.gz_J crystal structure of an ider-dna complex reveals a conformational change in activated ider for base-specific interactions 0.7158 27 52
2avt-assembly1.cif.gz_B crystal structure of the beta subunit from dna polymerase of streptococcus pyogenes 0.7158 27 50
1u8r-assembly1.cif.gz_A crystal structure of an ider-dna complex reveals a conformational change in activated ider for base-specific interactions 0.7152 27 52
ID Description Score Start End Superfamily
af_E9QFL0_666_819_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.7617 26 39 1.10.443.10
af_E9PVG8_2411_2565_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7578 25 51 2.60.120.200
af_Q6NP69_153_239_2.20.25.240 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.7425 26 49 2.20.25.240
af_Q5Z991_134_284_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.741 23 51 2.130.10.10
af_P96399_42_298_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7347 24 39 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A847GXX1-F1-model_v4 Uncharacterized protein 0.9354 23 79
AF-A0A847GXX1-F1-model_v4 Uncharacterized protein 0.8241 23 79
AF-A0A3N5IAS0-F1-model_v4 Uncharacterized protein 0.8093 14 78
AF-A0A1F4QDR0-F1-model_v4 Uncharacterized protein 0.787 12 79
AF-A0A7Y5NVQ1-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 0.7763 22 48

Map