F433863

General Info

Members Datasets Scaffolds Average Seq Length
397 195 368 443

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0047553|Ga0495672_0047553_27_1364
Length 436
Sequence MPILSKDEAQALLKKVLAYSKSNECEANLSGSDGGNIRYARNAVSTSGGISQNTLVVSSAYGKKLGTATINEFDDASLEKVVRRSEELAQLAPENPEFVPFLGPQQYAADSKTFEPRTAAIDPKFRTDAVAQSLQISKDNDLVAAGYLENTAGFAAMMNSKGLFAYNTSTNVNFNVTLRTKDGKGSGYASKGYTDVAKLDXVTAGSSGARALEPGKYTVILEPTAAIVLLETIFFGMDARSADEGRSFLSKPDGKTKLGEKLVDERVNIYSDPQNPDLPTSSWNSDGRPQEKINWIEKGVMKNLYYSRYWAQKKNVKAIPGPDGIIMEGGNASLEDLIKGTEKGVLVTRLWYIRPVDPQTLLYTGLTRDGTFYIENGQIKFPIKNFRFNESAIIMLNNLDALGKPERTVSGESGTQALIPPLKIRDFTFSSLSDAI

Samples

Sample ID Description Type Environment
1 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
2 2738541302 Pedobacter sp. CF074 Isolate Unclassified
3 2739367651 Pedobacter sp. OK291 Isolate Unclassified
4 2818991437 Pedobacter terrae 518 Isolate Unclassified
5 2818991444 Filimonas endophytica 3197 Isolate Unclassified
6 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
7 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
8 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
9 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
10 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
11 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
12 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
13 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
97 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
166 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
167 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
168 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
169 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
190 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
191 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
192 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
193 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
194 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
195 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.96
Metatranscriptomes 0
Isolates 5.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.06
Nodule 0
Rhizoplane 0
Rhizosphere 81.36
Stem 0
Stem Tuber 0
Unclassified 10.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10001144 3300001989 Bacteria 9897
2 JGI25154J39366_1000078 3300002738 Bacteria 90241
3 JGI25153J46596_10004809 3300003215 Bacteria 7194
4 rootH1_10038647 3300003316 Bacteria 3892
5 rootH2_10004814 3300003320 Bacteria 18173
6 rootH2_10055726 3300003320 Bacteria 1929
7 rootL2_10143320 3300003322 Bacteria 2708
8 rootH1_10086427 3300003323 Bacteria 16741
9 rootH1_10366573 3300003323 Bacteria 1956
10 JGI25160J50197_1002111 3300003354 Bacteria 9446
11 JGI25160J50197_1002797 3300003354 Bacteria 7989
12 JGI25160J50197_1008990 3300003354 Bacteria 3748
13 Ga0055526_1019603 3300003771 Bacteria 2456
14 Ga0055528_1003716 3300003790 Bacteria 7548
15 Ga0055530_10005011 3300003791 Bacteria 6532
16 Ga0065165_1000333 3300005262 Bacteria 77078
17 Ga0065165_1001407 3300005262 Bacteria 26218
18 Ga0065165_1023839 3300005262 Bacteria 2067
19 Ga0065714_10010088 3300005288 Bacteria 2413
20 Ga0065714_10064459 3300005288 Bacteria 66711
21 Ga0070676_10001440 3300005328 Bacteria 12023
22 Ga0070676_10007742 3300005328 Bacteria 5768
23 Ga0070670_100063328 3300005331 Bacteria 3174
24 Ga0070670_100110579 3300005331 Unclassified 2367
25 Ga0070670_100165655 3300005331 Bacteria 1916
26 Ga0070677_10045321 3300005333 Bacteria 1754
27 Ga0068869_100035056 3300005334 Bacteria 3555
28 Ga0068869_100079513 3300005334 Bacteria 2443
29 Ga0070666_10000072 3300005335 Bacteria 75356
30 Ga0070666_10007252 3300005335 Bacteria 6836
31 Ga0070666_10020400 3300005335 Bacteria 4284
32 Ga0070666_10139013 3300005335 Bacteria 1691
33 Ga0068868_100021866 3300005338 Bacteria 4821
34 Ga0068868_100047483 3300005338 Bacteria 3365
35 Ga0068868_100048754 3300005338 Bacteria 3323
36 Ga0068868_100152246 3300005338 Bacteria 1905
37 Ga0070661_100104474 3300005344 Unclassified 2110
38 Ga0070668_100146171 3300005347 Bacteria 1908
39 Ga0070669_100012772 3300005353 Bacteria 5963
40 Ga0070675_100017150 3300005354 Bacteria 5754
41 Ga0070675_100045260 3300005354 Bacteria 3601
42 Ga0070671_100017180 3300005355 Bacteria 5856
43 Ga0070671_100024497 3300005355 Bacteria 4941
44 Ga0070674_100047872 3300005356 Bacteria 2932
45 Ga0070674_100078741 3300005356 Bacteria 2349
46 Ga0070673_100012764 3300005364 Bacteria 5780
47 Ga0070673_100045071 3300005364 Bacteria 3418
48 Ga0070673_100073801 3300005364 Bacteria 2747
49 Ga0070667_100006188 3300005367 Bacteria 9955
50 Ga0070667_100014577 3300005367 Bacteria 6496
51 Ga0070667_100060170 3300005367 Bacteria 3214
52 Ga0070678_100007159 3300005456 Bacteria 6597
53 Ga0070678_100047159 3300005456 Bacteria 3094
54 Ga0070662_100000013 3300005457 Bacteria 125019
55 Ga0070662_100103105 3300005457 Bacteria 2163
56 Ga0068867_100003509 3300005459 Bacteria 11026
57 Ga0070698_100039590 3300005471 Bacteria 4850
58 Ga0070684_100061617 3300005535 Bacteria 3284
59 Ga0068853_100030965 3300005539 Bacteria 4522
60 Ga0068853_100053384 3300005539 Bacteria 3481
61 Ga0070672_100004660 3300005543 Bacteria 8991
62 Ga0070672_100051257 3300005543 Bacteria 3217
63 Ga0070672_100093608 3300005543 Bacteria 2428
64 Ga0070672_100099610 3300005543 Bacteria 2356
65 Ga0070665_100000010 3300005548 Bacteria 529545
66 Ga0070665_100000052 3300005548 Bacteria 245694
67 Ga0070665_100011887 3300005548 Bacteria 8791
68 Ga0070665_100088390 3300005548 Unclassified 3104
69 Ga0070704_100002073 3300005549 Bacteria 11137
70 Ga0068855_100006150 3300005563 Bacteria 14635
71 Ga0068855_100013413 3300005563 Bacteria 9881
72 Ga0068855_100047795 3300005563 Bacteria 5054
73 Ga0068855_100060168 3300005563 Bacteria 4443
74 Ga0070664_100037363 3300005564 Bacteria 4083
75 Ga0068857_100116503 3300005577 Bacteria 2404
76 Ga0068854_100017841 3300005578 Bacteria 4757
77 Ga0068852_100001694 3300005616 Bacteria 15026
78 Ga0068852_100002433 3300005616 Bacteria 12817
79 Ga0068852_100006679 3300005616 Bacteria 8361
80 Ga0068859_100000006 3300005617 Bacteria 421509
81 Ga0068859_100027257 3300005617 Bacteria 5731
82 Ga0068864_100008852 3300005618 Bacteria 8297
83 Ga0068864_100030220 3300005618 Bacteria 4592
84 Ga0068866_10019966 3300005718 Bacteria 3061
85 Ga0068866_10026258 3300005718 Bacteria 2748
86 Ga0068861_100005802 3300005719 Bacteria 8381
87 Ga0068870_10010474 3300005840 Bacteria 4265
88 Ga0068870_10020608 3300005840 Unclassified 3213
89 Ga0068863_100006997 3300005841 Bacteria 11057
90 Ga0068863_100022248 3300005841 Bacteria 6053
91 Ga0068860_100000004 3300005843 Bacteria 506126
92 Ga0068860_100001096 3300005843 Bacteria 29818
93 Ga0068860_100002117 3300005843 Bacteria 20935
94 Ga0068860_100002430 3300005843 Bacteria 19567
95 Ga0068862_100139709 3300005844 Bacteria 2149
96 Ga0075366_10001148 3300006195 Bacteria 13098
97 Ga0097621_100000146 3300006237 Bacteria 42998
98 Ga0097621_100000639 3300006237 Bacteria 24750
99 Ga0097621_100015728 3300006237 Bacteria 5701
100 Ga0068871_100000477 3300006358 Bacteria 27401
101 Ga0068871_100002101 3300006358 Bacteria 13481
102 Ga0068871_100004512 3300006358 Bacteria 9700
103 Ga0068871_100016612 3300006358 Bacteria 5550
104 Ga0068871_100064633 3300006358 Bacteria 2996
105 Ga0068865_100000079 3300006881 Bacteria 51370
106 Ga0068865_100003508 3300006881 Bacteria 9402
107 Ga0097620_100000006 3300006931 Bacteria 421509
108 Ga0097620_100027257 3300006931 Bacteria 5731
109 Ga0105240_10002508 3300009093 Bacteria 29504
110 Ga0105240_10011523 3300009093 Bacteria 12306
111 Ga0105240_10014577 3300009093 Bacteria 10725
112 Ga0105240_10113108 3300009093 Bacteria 3280
113 Ga0105240_10156082 3300009093 Bacteria 2714
114 Ga0105240_10201246 3300009093 Bacteria 2334
115 Ga0105241_10000888 3300009174 Bacteria 22590
116 Ga0105241_10002798 3300009174 Bacteria 13057
117 Ga0105241_10003043 3300009174 Bacteria 12512
118 Ga0105241_10195856 3300009174 Bacteria 1685
119 Ga0105242_10012932 3300009176 Bacteria 6435
120 Ga0105248_10037014 3300009177 Bacteria 5457
121 Ga0105237_10000157 3300009545 Bacteria 96235
122 Ga0105237_10000683 3300009545 Bacteria 46945
123 Ga0105237_10000886 3300009545 Bacteria 40329
124 Ga0105237_10001875 3300009545 Bacteria 26830
125 Ga0105237_10003344 3300009545 Bacteria 19091
126 Ga0105237_10011599 3300009545 Bacteria 9322
127 Ga0105237_10025060 3300009545 Bacteria 6101
128 Ga0105237_10056463 3300009545 Bacteria 3930
129 Ga0105238_10000980 3300009551 Bacteria 29183
130 Ga0105238_10001237 3300009551 Bacteria 25698
131 Ga0105238_10002843 3300009551 Bacteria 17277
132 Ga0105249_10005209 3300009553 Bacteria 11220
133 Ga0105249_10023107 3300009553 Bacteria 5576
134 Ga0105249_10055256 3300009553 Bacteria 3631
135 Ga0105239_10000029 3300010375 Bacteria 234749
136 Ga0105239_10004206 3300010375 Bacteria 17283
137 Ga0105239_10009224 3300010375 Bacteria 11160
138 Ga0105239_10042568 3300010375 Bacteria 4976
139 Ga0105239_10050076 3300010375 Bacteria 4582
140 Ga0105246_10007350 3300011119 Bacteria 6749
141 Ga0105246_10024473 3300011119 Bacteria 3924
142 Ga0105246_10028746 3300011119 Bacteria 3654
143 Ga0105246_10039992 3300011119 Bacteria 3162
144 Ga0157371_10000016 3300013102 Bacteria 330495
145 Ga0157371_10004224 3300013102 Bacteria 12634
146 Ga0157371_10004404 3300013102 Bacteria 12310
147 Ga0157370_10019477 3300013104 Bacteria 6806
148 Ga0157370_10178882 3300013104 Bacteria 1971
149 Ga0157369_10000008 3300013105 Bacteria 309315
150 Ga0157369_10026797 3300013105 Bacteria 6391
151 Ga0157369_10217798 3300013105 Bacteria 1999
152 Ga0157374_10000001 3300013296 Bacteria 1077351
153 Ga0157374_10000258 3300013296 Bacteria 48926
154 Ga0157374_10001763 3300013296 Bacteria 18206
155 Ga0157374_10014360 3300013296 Bacteria 6931
156 Ga0157374_10169566 3300013296 Unclassified 2128
157 Ga0157378_10003682 3300013297 Bacteria 13587
158 Ga0157378_10083361 3300013297 Bacteria 2893
159 Ga0157378_10212656 3300013297 Bacteria 1834
160 Ga0163162_10000005 3300013306 Bacteria 447195
161 Ga0163162_10000528 3300013306 Bacteria 35474
162 Ga0163162_10002184 3300013306 Bacteria 18347
163 Ga0163162_10016486 3300013306 Bacteria 7218
164 Ga0163162_10325931 3300013306 Bacteria 1668
165 Ga0157372_10000305 3300013307 Bacteria 54763
166 Ga0157372_10013020 3300013307 Bacteria 8870
167 Ga0157372_10058774 3300013307 Bacteria 4299
168 Ga0157372_10101679 3300013307 Bacteria 3282
169 Ga0157372_10117096 3300013307 Bacteria 3056
170 Ga0157375_10000207 3300013308 Bacteria 54636
171 Ga0157375_10035206 3300013308 Bacteria 4777
172 Ga0157375_10104158 3300013308 Bacteria 2926
173 Ga0163163_10000553 3300014325 Bacteria 32772
174 Ga0163163_10064759 3300014325 Bacteria 3627
175 Ga0163163_10078327 3300014325 Bacteria 3302
176 Ga0163163_10143652 3300014325 Bacteria 2429
177 Ga0182008_10000391 3300014497 Bacteria 34009
178 Ga0157377_10013129 3300014745 Bacteria 4185
179 Ga0157379_10028678 3300014968 Bacteria 4950
180 Ga0157379_10040875 3300014968 Bacteria 4139
181 Ga0157376_10000555 3300014969 Bacteria 24024
182 Ga0157376_10001344 3300014969 Bacteria 16206
183 Ga0157376_10084534 3300014969 Bacteria 2733
184 Ga0182006_1000146 3300015261 Bacteria 75345
185 Ga0182006_1001004 3300015261 Bacteria 18475
186 Ga0182007_10000003 3300015262 Bacteria 548244
187 Ga0183373_1001 3300015682 Bacteria 1410374
188 Ga0163161_10001075 3300017792 Bacteria 20677
189 Ga0163161_10001303 3300017792 Bacteria 18557
190 Ga0163161_10002039 3300017792 Bacteria 14629
191 Ga0163161_10003175 3300017792 Bacteria 11590
192 Ga0163161_10060206 3300017792 Bacteria 2763
193 Ga0163161_10123655 3300017792 Bacteria 1946
194 Ga0163161_10226468 3300017792 Bacteria 1449
195 Ga0213872_10003022 3300021361 Bacteria 9501
196 Ga0213876_10021968 3300021384 Bacteria 3374
197 Ga0213876_10037242 3300021384 Bacteria 2566
198 Ga0209646_1000004 3300025246 Bacteria 786587
199 Ga0209026_1000136 3300025250 Bacteria 116507
200 Ga0209026_1000842 3300025250 Bacteria 16208
201 Ga0209673_1000519 3300025273 Bacteria 63063
202 Ga0209025_1000005 3300025294 Bacteria 1272149
203 Ga0209564_1003135 3300025295 Bacteria 11670
204 Ga0209564_1005021 3300025295 Bacteria 7760
205 Ga0209758_1002710 3300025297 Bacteria 17456
206 Ga0209758_1009141 3300025297 Bacteria 6237
207 Ga0209758_1010338 3300025297 Bacteria 5600
208 Ga0209050_1000276 3300025298 Bacteria 109997
209 Ga0207426_1000032 3300025302 Bacteria 457997
210 Ga0207426_1000089 3300025302 Bacteria 281224
211 Ga0207426_1000367 3300025302 Bacteria 80232
212 Ga0207426_1001395 3300025302 Bacteria 20376
213 Ga0209257_1000931 3300025304 Bacteria 40523
214 Ga0207682_10014039 3300025893 Bacteria 3121
215 Ga0207682_10014550 3300025893 Bacteria 3067
216 Ga0207680_10000024 3300025903 Bacteria 82106
217 Ga0207680_10078657 3300025903 Bacteria 2066
218 Ga0207647_10000044 3300025904 Bacteria 90491
219 Ga0207645_10000219 3300025907 Bacteria 47364
220 Ga0207645_10000558 3300025907 Bacteria 30976
221 Ga0207643_10025264 3300025908 Bacteria 3282
222 Ga0207654_10001733 3300025911 Bacteria 11338
223 Ga0207654_10001873 3300025911 Bacteria 10898
224 Ga0207654_10050827 3300025911 Bacteria 2384
225 Ga0207695_10001521 3300025913 Bacteria 38468
226 Ga0207695_10014747 3300025913 Bacteria 9239
227 Ga0207695_10077767 3300025913 Bacteria 3369
228 Ga0207671_10000450 3300025914 Bacteria 56924
229 Ga0207671_10002380 3300025914 Bacteria 20199
230 Ga0207671_10002525 3300025914 Bacteria 19503
231 Ga0207671_10005345 3300025914 Bacteria 11881
232 Ga0207671_10006651 3300025914 Bacteria 10247
233 Ga0207671_10015022 3300025914 Bacteria 6087
234 Ga0207671_10057245 3300025914 Bacteria 2889
235 Ga0207681_10102020 3300025923 Bacteria 2071
236 Ga0207694_10002932 3300025924 Bacteria 13705
237 Ga0207694_10020187 3300025924 Bacteria 5040
238 Ga0207694_10030683 3300025924 Bacteria 4104
239 Ga0207694_10035316 3300025924 Bacteria 3834
240 Ga0207650_10015363 3300025925 Bacteria 5331
241 Ga0207650_10023987 3300025925 Bacteria 4331
242 Ga0207650_10142350 3300025925 Bacteria 1886
243 Ga0207659_10040039 3300025926 Bacteria 3274
244 Ga0207687_10043871 3300025927 Bacteria 3083
245 Ga0207644_10006227 3300025931 Bacteria 7779
246 Ga0207706_10000173 3300025933 Bacteria 71958
247 Ga0207706_10031779 3300025933 Bacteria 4702
248 Ga0207706_10089187 3300025933 Bacteria 2711
249 Ga0207669_10102922 3300025937 Bacteria 1893
250 Ga0207704_10000019 3300025938 Bacteria 152734
251 Ga0207691_10014563 3300025940 Bacteria 7496
252 Ga0207691_10019389 3300025940 Bacteria 6437
253 Ga0207689_10001199 3300025942 Bacteria 24909
254 Ga0207689_10001505 3300025942 Bacteria 22204
255 Ga0207689_10026945 3300025942 Bacteria 4811
256 Ga0207689_10066632 3300025942 Bacteria 2960
257 Ga0207667_10000968 3300025949 Bacteria 36617
258 Ga0207667_10007266 3300025949 Bacteria 13358
259 Ga0207667_10016309 3300025949 Bacteria 8397
260 Ga0207667_10244504 3300025949 Bacteria 1836
261 Ga0207712_10069522 3300025961 Bacteria 2526
262 Ga0207668_10043026 3300025972 Bacteria 3062
263 Ga0207668_10093180 3300025972 Bacteria 2219
264 Ga0207658_10008008 3300025986 Bacteria 7197
265 Ga0207658_10043905 3300025986 Bacteria 3252
266 Ga0207677_10017494 3300026023 Bacteria 4276
267 Ga0207677_10044355 3300026023 Bacteria 2962
268 Ga0207677_10086033 3300026023 Bacteria 2271
269 Ga0207677_10087160 3300026023 Bacteria 2259
270 Ga0207639_10004313 3300026041 Bacteria 9582
271 Ga0207641_10000058 3300026088 Bacteria 166385
272 Ga0207641_10020384 3300026088 Bacteria 5445
273 Ga0207641_10218483 3300026088 Unclassified 1766
274 Ga0207648_10002523 3300026089 Bacteria 19646
275 Ga0207648_10002973 3300026089 Bacteria 17907
276 Ga0207674_10000629 3300026116 Bacteria 46056
277 Ga0207675_100006970 3300026118 Bacteria 10691
278 Ga0207675_100026719 3300026118 Bacteria 5373
279 Ga0207683_10000730 3300026121 Bacteria 29877
280 Ga0207698_10001840 3300026142 Bacteria 12395
281 Ga0207698_10004648 3300026142 Bacteria 8389
282 Ga0207698_10042478 3300026142 Bacteria 3397
283 Ga0268266_10000032 3300028379 Bacteria 395079
284 Ga0268266_10000070 3300028379 Bacteria 235423
285 Ga0268266_10102248 3300028379 Bacteria 2527
286 Ga0268265_10127216 3300028380 Bacteria 2111
287 Ga0268265_10162706 3300028380 Bacteria 1898
288 Ga0268264_10000011 3300028381 Bacteria 580884
289 Ga0268264_10002040 3300028381 Bacteria 18038
290 Ga0268264_10002921 3300028381 Bacteria 14854
291 Ga0268264_10003791 3300028381 Bacteria 12967
292 Ga0307517_10000640 3300028786 Bacteria 59989
293 Ga0307515_10000059 3300028794 Bacteria 257520
294 Ga0307515_10004635 3300028794 Bacteria 28227
295 Ga0307515_10026520 3300028794 Bacteria 9970
296 Ga0307515_10034128 3300028794 Bacteria 8346
297 Ga0307515_10052539 3300028794 Bacteria 6041
298 Ga0307511_10001201 3300030521 Bacteria 27539
299 Ga0265327_10000168 3300031251 Bacteria 141392
300 Ga0265327_10024826 3300031251 Bacteria 3510
301 Ga0307509_10012028 3300031507 Bacteria 10390
302 Ga0307509_10096204 3300031507 Bacteria 3014
303 Ga0307516_10031082 3300031730 Bacteria 5384
304 Ga0307405_10000032 3300031731 Bacteria 98354
305 Ga0307407_10000151 3300031903 Bacteria 21356
306 Ga0307416_100000009 3300032002 Bacteria 374271
307 Ga0307414_10002186 3300032004 Bacteria 10202
308 Ga0307414_10032338 3300032004 Bacteria 3443
309 Ga0307414_10099782 3300032004 Bacteria 2182
310 Ga0307507_10000010 3300033179 Bacteria 265208
311 Ga0307510_10000062 3300033180 Bacteria 81920
312 Ga0307510_10004416 3300033180 Bacteria 16557
313 Ga0395899_0000563 3300037312 Bacteria 39619
314 Ga0395900_0000173 3300037418 Bacteria 103767
315 Ga0395898_0018685 3300037466 Bacteria 7067
316 Ga0395905_0000641 3300037471 Bacteria 46724
317 Ga0395901_0000294 3300038443 Bacteria 61869
318 Ga0436365_0935453 3300039437 Bacteria 8337
319 Ga0436361_0123021 3300039447 Bacteria 13910
320 Ga0466972_0000001 3300044658 Bacteria 412457
321 Ga0466972_0024963 3300044658 Bacteria 2965
322 Ga0466968_0064866 3300044735 Bacteria 1580
323 Ga0466970_0000065 3300044765 Bacteria 41709
324 Ga0466970_0001560 3300044765 Bacteria 11058
325 Ga0495627_038802 3300046453 Bacteria 1471
326 Ga0495638_0011610 3300046460 Bacteria 6066
327 Ga0495585_0006676 3300046492 Bacteria 7128
328 Ga0495606_0003716 3300046507 Bacteria 15924
329 Ga0495606_0029107 3300046507 Bacteria 3884
330 Ga0495610_0000150 3300046512 Bacteria 76876
331 Ga0495610_0000519 3300046512 Bacteria 38756
332 Ga0495616_0007790 3300046513 Bacteria 6392
333 Ga0495631_0007677 3300046518 Bacteria 5476
334 Ga0495637_0026159 3300046520 Bacteria 2623
335 Ga0495648_0005100 3300046524 Bacteria 11018
336 Ga0495648_0070368 3300046524 Bacteria 2033
337 Ga0495648_0078157 3300046524 Bacteria 1893
338 Ga0495609_0013557 3300046538 Bacteria 3847
339 Ga0495633_0000322 3300046558 Bacteria 54099
340 Ga0495668_0000044 3300046616 Bacteria 227585
341 Ga0495611_0001630 3300046648 Bacteria 10893
342 Ga0495625_0001984 3300046660 Bacteria 23086
343 Ga0495625_0003910 3300046660 Bacteria 14358
344 Ga0495625_0051693 3300046660 Bacteria 2945
345 Ga0495625_0154709 3300046660 Bacteria 1539
346 Ga0495661_0003287 3300046665 Bacteria 12000
347 Ga0495661_0037652 3300046665 Bacteria 3018
348 Ga0495658_0105319 3300046683 Bacteria 1689
349 Ga0495649_0027183 3300046694 Bacteria 3176
350 Ga0495600_0134920 3300046809 Bacteria 1604
351 Ga0495672_0047553 3300047320 Bacteria 2550
352 Ga0495687_000006 3300047443 Bacteria 571936
353 Ga0495687_002515 3300047443 Bacteria 14572
354 Ga0495686_0000078 3300047472 Bacteria 203927
355 Ga0495614_0004553 3300048089 Bacteria 6252
356 Ga0496117_0002637 3300048920 Bacteria 22245
357 Ga0496118_0006062 3300048921 Bacteria 13466
358 Ga0496124_0058418 3300048927 Bacteria 3244
359 Ga0496125_0026821 3300048928 Bacteria 5235
360 Ga0501076_0071776 3300049592 Bacteria 2770
361 nmdc:mga0k408_116_c3 3300050493 Bacteria 24401
362 Ga0500647_0058781 3300053091 Bacteria 1849
363 Ga0500583_0001914 3300053092 Bacteria 6098
364 Ga0500608_000346 3300053122 Bacteria 17925
365 Ga0500608_001862 3300053122 Bacteria 7525
366 Ga0500622_0001084 3300053156 Bacteria 22666
367 Ga0500624_000800 3300053157 Bacteria 7339
368 Ga0500637_0045894 3300053178 Bacteria 2480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046809 Ga0495600_0134920 Ga0495600_0134920_373_1548 390
2 3300003322 rootL2_10143320 rootL2_101433201 428
3 3300028794 Ga0307515_10000059 Ga0307515_10000059164 430
4 3300046665 Ga0495661_0003287 Ga0495661_0003287_12_1349 432
5 3300048089 Ga0495614_0004553 Ga0495614_0004553_1624_2961 432
6 3300053122 Ga0500608_000346 Ga0500608_000346_1570_2874 432
7 iso_pu_bacteria 2738541302 2738855713 434
8 iso_pu_bacteria 2739367651 2739590627 434
9 iso_pu_bacteria 2818991437 2819550015 434
10 iso_pu_bacteria 2842722452 2842724928 434
11 iso_pu_bacteria 2842909656 2842913051 434
12 iso_pu_bacteria 2849281842 2849284595 434
13 iso_pu_bacteria 2904445276 2904449384 434
14 iso_pu_bacteria 2945997725 2946001900 434
15 iso_pu_bacteria 2954016120 2954018753 434
16 3300005355 Ga0070671_100024497 Ga0070671_1000244972 435
17 3300013307 Ga0157372_10117096 Ga0157372_101170962 435
18 3300025931 Ga0207644_10006227 Ga0207644_100062274 435
19 3300047320 Ga0495672_0047553 Ga0495672_0047553_27_1364 435
20 3300003323 rootH1_10086427 rootH1_1008642712 436
21 3300005262 Ga0065165_1001407 Ga0065165_10014074 437
22 3300005288 Ga0065714_10010088 Ga0065714_100100882 438
23 3300005288 Ga0065714_10064459 Ga0065714_100644593 438
24 3300005331 Ga0070670_100110579 Ga0070670_1001105792 438
25 3300005344 Ga0070661_100104474 Ga0070661_1001044743 438
26 3300005356 Ga0070674_100078741 Ga0070674_1000787412 438
27 3300005364 Ga0070673_100045071 Ga0070673_1000450712 438
28 3300005471 Ga0070698_100039590 Ga0070698_1000395904 438
29 3300005535 Ga0070684_100061617 Ga0070684_1000616171 438
30 3300005543 Ga0070672_100051257 Ga0070672_1000512573 438
31 3300005549 Ga0070704_100002073 Ga0070704_1000020737 438
32 3300005564 Ga0070664_100037363 Ga0070664_1000373632 438
33 3300013102 Ga0157371_10000016 Ga0157371_10000016277 438
34 3300013102 Ga0157371_10004224 Ga0157371_1000422410 438
35 3300013104 Ga0157370_10178882 Ga0157370_101788822 438
36 3300013105 Ga0157369_10000008 Ga0157369_1000000864 438
37 3300013296 Ga0157374_10169566 Ga0157374_101695662 438
38 3300014325 Ga0163163_10064759 Ga0163163_100647592 438
39 3300015261 Ga0182006_1000146 Ga0182006_100014627 438
40 3300015261 Ga0182006_1001004 Ga0182006_10010041 438
41 3300015262 Ga0182007_10000003 Ga0182007_10000003209 438
42 3300015682 Ga0183373_1001 Ga0183373_1001769 438
43 3300017792 Ga0163161_10001075 Ga0163161_100010754 438
44 3300017792 Ga0163161_10002039 Ga0163161_100020395 438
45 3300017792 Ga0163161_10060206 Ga0163161_100602062 438
46 3300017792 Ga0163161_10123655 Ga0163161_101236552 438
47 3300021384 Ga0213876_10021968 Ga0213876_100219682 438
48 3300025893 Ga0207682_10014039 Ga0207682_100140392 438
49 3300025925 Ga0207650_10023987 Ga0207650_100239874 438
50 3300025940 Ga0207691_10014563 Ga0207691_100145633 438
51 3300025972 Ga0207668_10043026 Ga0207668_100430262 438
52 3300028794 Ga0307515_10034128 Ga0307515_100341284 438
53 3300031731 Ga0307405_10000032 Ga0307405_1000003246 438
54 3300031903 Ga0307407_10000151 Ga0307407_1000015117 438
55 3300032002 Ga0307416_100000009 Ga0307416_1000000092 438
56 3300032004 Ga0307414_10002186 Ga0307414_100021866 438
57 3300032004 Ga0307414_10032338 Ga0307414_100323382 438
58 3300032004 Ga0307414_10099782 Ga0307414_100997822 438
59 3300039437 Ga0436365_0935453 Ga0436365_0935453_3033_4349 438
60 3300046453 Ga0495627_038802 Ga0495627_038802_101_1417 438
61 3300046512 Ga0495610_0000150 Ga0495610_0000150_16465_17781 438
62 3300046512 Ga0495610_0000519 Ga0495610_0000519_8999_10315 438
63 3300046520 Ga0495637_0026159 Ga0495637_0026159_958_2274 438
64 3300053122 Ga0500608_001862 Ga0500608_001862_5065_6402 438
65 iso_pu_bacteria 2576861471 2578460243 440
66 iso_pu_bacteria 2818991437 2819546561 440
67 iso_pu_bacteria 2818991444 2819586017 440
68 iso_pu_bacteria 2842722452 2842725258 440
69 iso_pu_bacteria 2842909656 2842912530 440
70 iso_pu_bacteria 2849281842 2849286257 440
71 iso_pu_bacteria 2904445276 2904446708 440
72 iso_pu_bacteria 2939622612 2939623323 440
73 iso_pu_bacteria 2954016120 2954019072 440
74 iso_pu_bacteria 2977232053 2977235809 440
75 iso_pu_bacteria 8003151029 8003157156 440
76 3300049592 Ga0501076_0071776 Ga0501076_0071776_106_1437 443
77 3300001989 JGI24739J22299_10001144 JGI24739J22299_1000114411 444
78 3300002738 JGI25154J39366_1000078 JGI25154J39366_100007842 444
79 3300003215 JGI25153J46596_10004809 JGI25153J46596_100048096 444
80 3300003316 rootH1_10038647 rootH1_100386472 444
81 3300003320 rootH2_10004814 rootH2_100048146 444
82 3300003320 rootH2_10055726 rootH2_100557262 444
83 3300003323 rootH1_10366573 rootH1_103665732 444
84 3300003354 JGI25160J50197_1002111 JGI25160J50197_10021115 444
85 3300003354 JGI25160J50197_1002797 JGI25160J50197_10027972 444
86 3300003354 JGI25160J50197_1008990 JGI25160J50197_10089901 444
87 3300003771 Ga0055526_1019603 Ga0055526_10196033 444
88 3300003790 Ga0055528_1003716 Ga0055528_10037162 444
89 3300003791 Ga0055530_10005011 Ga0055530_100050114 444
90 3300005262 Ga0065165_1000333 Ga0065165_10003338 444
91 3300005262 Ga0065165_1023839 Ga0065165_10238392 444
92 3300005328 Ga0070676_10001440 Ga0070676_100014409 444
93 3300005328 Ga0070676_10007742 Ga0070676_100077422 444
94 3300005331 Ga0070670_100063328 Ga0070670_1000633282 444
95 3300005331 Ga0070670_100165655 Ga0070670_1001656551 444
96 3300005333 Ga0070677_10045321 Ga0070677_100453212 444
97 3300005334 Ga0068869_100035056 Ga0068869_1000350562 444
98 3300005334 Ga0068869_100079513 Ga0068869_1000795131 444
99 3300005335 Ga0070666_10000072 Ga0070666_1000007215 444
100 3300005335 Ga0070666_10007252 Ga0070666_100072523 444
101 3300005335 Ga0070666_10020400 Ga0070666_100204002 444
102 3300005335 Ga0070666_10139013 Ga0070666_101390131 444
103 3300005338 Ga0068868_100021866 Ga0068868_1000218662 444
104 3300005338 Ga0068868_100047483 Ga0068868_1000474832 444
105 3300005338 Ga0068868_100048754 Ga0068868_1000487542 444
106 3300005338 Ga0068868_100152246 Ga0068868_1001522462 444
107 3300005347 Ga0070668_100146171 Ga0070668_1001461712 444
108 3300005353 Ga0070669_100012772 Ga0070669_1000127722 444
109 3300005354 Ga0070675_100017150 Ga0070675_1000171501 444
110 3300005354 Ga0070675_100045260 Ga0070675_1000452604 444
111 3300005355 Ga0070671_100017180 Ga0070671_1000171803 444
112 3300005356 Ga0070674_100047872 Ga0070674_1000478722 444
113 3300005364 Ga0070673_100012764 Ga0070673_1000127644 444
114 3300005364 Ga0070673_100073801 Ga0070673_1000738012 444
115 3300005367 Ga0070667_100006188 Ga0070667_1000061882 444
116 3300005367 Ga0070667_100014577 Ga0070667_1000145774 444
117 3300005367 Ga0070667_100060170 Ga0070667_1000601703 444
118 3300005456 Ga0070678_100007159 Ga0070678_1000071595 444
119 3300005456 Ga0070678_100047159 Ga0070678_1000471592 444
120 3300005457 Ga0070662_100000013 Ga0070662_10000001324 444
121 3300005457 Ga0070662_100103105 Ga0070662_1001031052 444
122 3300005459 Ga0068867_100003509 Ga0068867_1000035099 444
123 3300005539 Ga0068853_100030965 Ga0068853_1000309653 444
124 3300005539 Ga0068853_100053384 Ga0068853_1000533843 444
125 3300005543 Ga0070672_100004660 Ga0070672_1000046604 444
126 3300005543 Ga0070672_100093608 Ga0070672_1000936082 444
127 3300005543 Ga0070672_100099610 Ga0070672_1000996102 444
128 3300005548 Ga0070665_100000010 Ga0070665_100000010462 444
129 3300005548 Ga0070665_100000052 Ga0070665_10000005232 444
130 3300005548 Ga0070665_100011887 Ga0070665_1000118877 444
131 3300005548 Ga0070665_100088390 Ga0070665_1000883902 444
132 3300005563 Ga0068855_100006150 Ga0068855_10000615010 444
133 3300005563 Ga0068855_100013413 Ga0068855_1000134138 444
134 3300005563 Ga0068855_100047795 Ga0068855_1000477954 444
135 3300005563 Ga0068855_100060168 Ga0068855_1000601683 444
136 3300005577 Ga0068857_100116503 Ga0068857_1001165032 444
137 3300005578 Ga0068854_100017841 Ga0068854_1000178413 444
138 3300005616 Ga0068852_100001694 Ga0068852_10000169412 444
139 3300005616 Ga0068852_100002433 Ga0068852_1000024334 444
140 3300005616 Ga0068852_100006679 Ga0068852_1000066792 444
141 3300005617 Ga0068859_100000006 Ga0068859_10000000615 444
142 3300005617 Ga0068859_100027257 Ga0068859_1000272573 444
143 3300005618 Ga0068864_100008852 Ga0068864_1000088525 444
144 3300005618 Ga0068864_100030220 Ga0068864_1000302203 444
145 3300005718 Ga0068866_10019966 Ga0068866_100199661 444
146 3300005718 Ga0068866_10026258 Ga0068866_100262582 444
147 3300005719 Ga0068861_100005802 Ga0068861_1000058024 444
148 3300005840 Ga0068870_10010474 Ga0068870_100104742 444
149 3300005840 Ga0068870_10020608 Ga0068870_100206082 444
150 3300005841 Ga0068863_100006997 Ga0068863_1000069977 444
151 3300005841 Ga0068863_100022248 Ga0068863_1000222483 444
152 3300005843 Ga0068860_100000004 Ga0068860_100000004288 444
153 3300005843 Ga0068860_100001096 Ga0068860_1000010965 444
154 3300005843 Ga0068860_100002117 Ga0068860_1000021174 444
155 3300005843 Ga0068860_100002430 Ga0068860_1000024303 444
156 3300005844 Ga0068862_100139709 Ga0068862_1001397091 444
157 3300006195 Ga0075366_10001148 Ga0075366_100011484 444
158 3300006237 Ga0097621_100000146 Ga0097621_10000014611 444
159 3300006237 Ga0097621_100000639 Ga0097621_1000006394 444
160 3300006237 Ga0097621_100015728 Ga0097621_1000157282 444
161 3300006358 Ga0068871_100000477 Ga0068871_10000047716 444
162 3300006358 Ga0068871_100002101 Ga0068871_1000021013 444
163 3300006358 Ga0068871_100004512 Ga0068871_1000045122 444
164 3300006358 Ga0068871_100016612 Ga0068871_1000166122 444
165 3300006358 Ga0068871_100064633 Ga0068871_1000646332 444
166 3300006881 Ga0068865_100000079 Ga0068865_10000007937 444
167 3300006881 Ga0068865_100003508 Ga0068865_1000035086 444
168 3300006931 Ga0097620_100000006 Ga0097620_10000000615 444
169 3300006931 Ga0097620_100027257 Ga0097620_1000272573 444
170 3300009093 Ga0105240_10002508 Ga0105240_1000250812 444
171 3300009093 Ga0105240_10011523 Ga0105240_100115235 444
172 3300009093 Ga0105240_10014577 Ga0105240_100145776 444
173 3300009093 Ga0105240_10113108 Ga0105240_101131081 444
174 3300009093 Ga0105240_10156082 Ga0105240_101560822 444
175 3300009093 Ga0105240_10201246 Ga0105240_102012462 444
176 3300009174 Ga0105241_10000888 Ga0105241_100008884 444
177 3300009174 Ga0105241_10002798 Ga0105241_100027988 444
178 3300009174 Ga0105241_10003043 Ga0105241_100030438 444
179 3300009174 Ga0105241_10195856 Ga0105241_101958562 444
180 3300009176 Ga0105242_10012932 Ga0105242_100129323 444
181 3300009176 Ga0105242_10012932 Ga0105242_100129325 444
182 3300009177 Ga0105248_10037014 Ga0105248_100370141 444
183 3300009545 Ga0105237_10000157 Ga0105237_100001574 444
184 3300009545 Ga0105237_10000683 Ga0105237_1000068324 444
185 3300009545 Ga0105237_10000886 Ga0105237_1000088625 444
186 3300009545 Ga0105237_10001875 Ga0105237_1000187516 444
187 3300009545 Ga0105237_10003344 Ga0105237_1000334411 444
188 3300009545 Ga0105237_10011599 Ga0105237_100115992 444
189 3300009545 Ga0105237_10025060 Ga0105237_100250604 444
190 3300009545 Ga0105237_10056463 Ga0105237_100564631 444
191 3300009551 Ga0105238_10000980 Ga0105238_100009802 444
192 3300009551 Ga0105238_10001237 Ga0105238_1000123714 444
193 3300009551 Ga0105238_10002843 Ga0105238_100028438 444
194 3300009553 Ga0105249_10005209 Ga0105249_100052095 444
195 3300009553 Ga0105249_10023107 Ga0105249_100231073 444
196 3300009553 Ga0105249_10055256 Ga0105249_100552562 444
197 3300010375 Ga0105239_10000029 Ga0105239_10000029159 444
198 3300010375 Ga0105239_10004206 Ga0105239_1000420613 444
199 3300010375 Ga0105239_10009224 Ga0105239_100092242 444
200 3300010375 Ga0105239_10042568 Ga0105239_100425685 444
201 3300010375 Ga0105239_10050076 Ga0105239_100500762 444
202 3300011119 Ga0105246_10007350 Ga0105246_100073502 444
203 3300011119 Ga0105246_10024473 Ga0105246_100244732 444
204 3300011119 Ga0105246_10028746 Ga0105246_100287462 444
205 3300011119 Ga0105246_10039992 Ga0105246_100399922 444
206 3300013102 Ga0157371_10004404 Ga0157371_1000440411 444
207 3300013104 Ga0157370_10019477 Ga0157370_100194773 444
208 3300013105 Ga0157369_10026797 Ga0157369_100267972 444
209 3300013105 Ga0157369_10217798 Ga0157369_102177982 444
210 3300013296 Ga0157374_10000001 Ga0157374_10000001765 444
211 3300013296 Ga0157374_10000258 Ga0157374_1000025841 444
212 3300013296 Ga0157374_10001763 Ga0157374_100017634 444
213 3300013296 Ga0157374_10014360 Ga0157374_100143604 444
214 3300013296 Ga0157374_10014360 Ga0157374_100143606 444
215 3300013297 Ga0157378_10003682 Ga0157378_100036826 444
216 3300013297 Ga0157378_10083361 Ga0157378_100833611 444
217 3300013297 Ga0157378_10212656 Ga0157378_102126562 444
218 3300013306 Ga0163162_10000005 Ga0163162_10000005317 444
219 3300013306 Ga0163162_10000528 Ga0163162_1000052810 444
220 3300013306 Ga0163162_10002184 Ga0163162_100021846 444
221 3300013306 Ga0163162_10016486 Ga0163162_100164865 444
222 3300013306 Ga0163162_10325931 Ga0163162_103259311 444
223 3300013307 Ga0157372_10000305 Ga0157372_1000030531 444
224 3300013307 Ga0157372_10013020 Ga0157372_100130207 444
225 3300013307 Ga0157372_10058774 Ga0157372_100587743 444
226 3300013307 Ga0157372_10101679 Ga0157372_101016792 444
227 3300013308 Ga0157375_10000207 Ga0157375_1000020719 444
228 3300013308 Ga0157375_10035206 Ga0157375_100352065 444
229 3300013308 Ga0157375_10104158 Ga0157375_101041582 444
230 3300014325 Ga0163163_10000553 Ga0163163_1000055310 444
231 3300014325 Ga0163163_10078327 Ga0163163_100783272 444
232 3300014325 Ga0163163_10143652 Ga0163163_101436523 444
233 3300014497 Ga0182008_10000391 Ga0182008_100003917 444
234 3300014745 Ga0157377_10013129 Ga0157377_100131294 444
235 3300014968 Ga0157379_10028678 Ga0157379_100286783 444
236 3300014968 Ga0157379_10040875 Ga0157379_100408752 444
237 3300014969 Ga0157376_10000555 Ga0157376_1000055519 444
238 3300014969 Ga0157376_10001344 Ga0157376_100013448 444
239 3300014969 Ga0157376_10084534 Ga0157376_100845342 444
240 3300017792 Ga0163161_10001303 Ga0163161_100013036 444
241 3300017792 Ga0163161_10003175 Ga0163161_100031759 444
242 3300017792 Ga0163161_10226468 Ga0163161_102264681 444
243 3300021361 Ga0213872_10003022 Ga0213872_100030229 444
244 3300021384 Ga0213876_10037242 Ga0213876_100372422 444
245 3300025246 Ga0209646_1000004 Ga0209646_1000004634 444
246 3300025250 Ga0209026_1000136 Ga0209026_100013625 444
247 3300025250 Ga0209026_1000842 Ga0209026_10008424 444
248 3300025273 Ga0209673_1000519 Ga0209673_100051951 444
249 3300025294 Ga0209025_1000005 Ga0209025_1000005651 444
250 3300025295 Ga0209564_1003135 Ga0209564_10031355 444
251 3300025295 Ga0209564_1005021 Ga0209564_10050212 444
252 3300025297 Ga0209758_1002710 Ga0209758_10027109 444
253 3300025297 Ga0209758_1009141 Ga0209758_10091413 444
254 3300025297 Ga0209758_1010338 Ga0209758_10103383 444
255 3300025298 Ga0209050_1000276 Ga0209050_100027698 444
256 3300025302 Ga0207426_1000032 Ga0207426_1000032189 444
257 3300025302 Ga0207426_1000089 Ga0207426_100008956 444
258 3300025302 Ga0207426_1000367 Ga0207426_100036724 444
259 3300025302 Ga0207426_1001395 Ga0207426_10013954 444
260 3300025304 Ga0209257_1000931 Ga0209257_100093132 444
261 3300025893 Ga0207682_10014550 Ga0207682_100145502 444
262 3300025903 Ga0207680_10000024 Ga0207680_1000002410 444
263 3300025903 Ga0207680_10078657 Ga0207680_100786572 444
264 3300025904 Ga0207647_10000044 Ga0207647_1000004425 444
265 3300025907 Ga0207645_10000219 Ga0207645_100002195 444
266 3300025907 Ga0207645_10000219 Ga0207645_100002197 444
267 3300025907 Ga0207645_10000558 Ga0207645_1000055816 444
268 3300025908 Ga0207643_10025264 Ga0207643_100252642 444
269 3300025911 Ga0207654_10001733 Ga0207654_100017337 444
270 3300025911 Ga0207654_10001873 Ga0207654_100018732 444
271 3300025911 Ga0207654_10050827 Ga0207654_100508272 444
272 3300025913 Ga0207695_10001521 Ga0207695_1000152128 444
273 3300025913 Ga0207695_10014747 Ga0207695_100147474 444
274 3300025913 Ga0207695_10077767 Ga0207695_100777672 444
275 3300025914 Ga0207671_10000450 Ga0207671_1000045035 444
276 3300025914 Ga0207671_10002380 Ga0207671_100023805 444
277 3300025914 Ga0207671_10002525 Ga0207671_100025254 444
278 3300025914 Ga0207671_10005345 Ga0207671_100053451 444
279 3300025914 Ga0207671_10006651 Ga0207671_100066515 444
280 3300025914 Ga0207671_10015022 Ga0207671_100150222 444
281 3300025914 Ga0207671_10057245 Ga0207671_100572452 444
282 3300025923 Ga0207681_10102020 Ga0207681_101020202 444
283 3300025924 Ga0207694_10002932 Ga0207694_100029323 444
284 3300025924 Ga0207694_10020187 Ga0207694_100201872 444
285 3300025924 Ga0207694_10030683 Ga0207694_100306832 444
286 3300025924 Ga0207694_10035316 Ga0207694_100353162 444
287 3300025925 Ga0207650_10015363 Ga0207650_100153634 444
288 3300025925 Ga0207650_10142350 Ga0207650_101423502 444
289 3300025926 Ga0207659_10040039 Ga0207659_100400392 444
290 3300025927 Ga0207687_10043871 Ga0207687_100438712 444
291 3300025933 Ga0207706_10000173 Ga0207706_1000017325 444
292 3300025933 Ga0207706_10031779 Ga0207706_100317791 444
293 3300025933 Ga0207706_10089187 Ga0207706_100891873 444
294 3300025937 Ga0207669_10102922 Ga0207669_101029222 444
295 3300025938 Ga0207704_10000019 Ga0207704_10000019139 444
296 3300025940 Ga0207691_10019389 Ga0207691_100193892 444
297 3300025942 Ga0207689_10001199 Ga0207689_1000119911 444
298 3300025942 Ga0207689_10001199 Ga0207689_1000119913 444
299 3300025942 Ga0207689_10001505 Ga0207689_100015056 444
300 3300025942 Ga0207689_10026945 Ga0207689_100269454 444
301 3300025942 Ga0207689_10066632 Ga0207689_100666322 444
302 3300025949 Ga0207667_10000968 Ga0207667_1000096814 444
303 3300025949 Ga0207667_10007266 Ga0207667_100072669 444
304 3300025949 Ga0207667_10016309 Ga0207667_100163092 444
305 3300025949 Ga0207667_10244504 Ga0207667_102445042 444
306 3300025961 Ga0207712_10069522 Ga0207712_100695222 444
307 3300025972 Ga0207668_10093180 Ga0207668_100931802 444
308 3300025986 Ga0207658_10008008 Ga0207658_100080085 444
309 3300025986 Ga0207658_10043905 Ga0207658_100439052 444
310 3300026023 Ga0207677_10017494 Ga0207677_100174944 444
311 3300026023 Ga0207677_10044355 Ga0207677_100443552 444
312 3300026023 Ga0207677_10086033 Ga0207677_100860332 444
313 3300026023 Ga0207677_10087160 Ga0207677_100871602 444
314 3300026041 Ga0207639_10004313 Ga0207639_100043136 444
315 3300026088 Ga0207641_10000058 Ga0207641_1000005857 444
316 3300026088 Ga0207641_10020384 Ga0207641_100203842 444
317 3300026088 Ga0207641_10218483 Ga0207641_102184832 444
318 3300026089 Ga0207648_10002523 Ga0207648_100025232 444
319 3300026089 Ga0207648_10002523 Ga0207648_100025234 444
320 3300026089 Ga0207648_10002973 Ga0207648_1000297316 444
321 3300026116 Ga0207674_10000629 Ga0207674_1000062926 444
322 3300026118 Ga0207675_100006970 Ga0207675_1000069705 444
323 3300026118 Ga0207675_100006970 Ga0207675_1000069708 444
324 3300026118 Ga0207675_100026719 Ga0207675_1000267194 444
325 3300026121 Ga0207683_10000730 Ga0207683_1000073010 444
326 3300026121 Ga0207683_10000730 Ga0207683_100007308 444
327 3300026142 Ga0207698_10001840 Ga0207698_100018404 444
328 3300026142 Ga0207698_10004648 Ga0207698_100046482 444
329 3300026142 Ga0207698_10042478 Ga0207698_100424783 444
330 3300028379 Ga0268266_10000032 Ga0268266_10000032115 444
331 3300028379 Ga0268266_10000070 Ga0268266_10000070149 444
332 3300028379 Ga0268266_10102248 Ga0268266_101022481 444
333 3300028380 Ga0268265_10127216 Ga0268265_101272162 444
334 3300028380 Ga0268265_10162706 Ga0268265_101627061 444
335 3300028381 Ga0268264_10000011 Ga0268264_1000001178 444
336 3300028381 Ga0268264_10002040 Ga0268264_1000204013 444
337 3300028381 Ga0268264_10002921 Ga0268264_100029213 444
338 3300028381 Ga0268264_10003791 Ga0268264_100037913 444
339 3300028786 Ga0307517_10000640 Ga0307517_1000064031 444
340 3300028794 Ga0307515_10004635 Ga0307515_1000463510 444
341 3300028794 Ga0307515_10026520 Ga0307515_100265201 444
342 3300028794 Ga0307515_10052539 Ga0307515_100525393 444
343 3300030521 Ga0307511_10001201 Ga0307511_1000120125 444
344 3300031251 Ga0265327_10000168 Ga0265327_10000168102 444
345 3300031251 Ga0265327_10024826 Ga0265327_100248261 444
346 3300031507 Ga0307509_10012028 Ga0307509_100120288 444
347 3300031507 Ga0307509_10096204 Ga0307509_100962042 444
348 3300031730 Ga0307516_10031082 Ga0307516_100310823 444
349 3300033179 Ga0307507_10000010 Ga0307507_1000001065 444
350 3300033180 Ga0307510_10000062 Ga0307510_1000006219 444
351 3300033180 Ga0307510_10004416 Ga0307510_100044164 444
352 3300037312 Ga0395899_0000563 Ga0395899_0000563_1393_2730 444
353 3300037418 Ga0395900_0000173 Ga0395900_0000173_51726_53063 444
354 3300037466 Ga0395898_0018685 Ga0395898_0018685_3996_5333 444
355 3300037471 Ga0395905_0000641 Ga0395905_0000641_867_2204 444
356 3300038443 Ga0395901_0000294 Ga0395901_0000294_40547_41884 444
357 3300039437 Ga0436365_0935453 Ga0436365_0935453_6296_7633 444
358 3300039447 Ga0436361_0123021 Ga0436361_0123021_4106_5443 444
359 3300044658 Ga0466972_0000001 Ga0466972_0000001_119611_120948 444
360 3300044658 Ga0466972_0000001 Ga0466972_0000001_132992_134326 444
361 3300044658 Ga0466972_0024963 Ga0466972_0024963_1339_2673 444
362 3300044735 Ga0466968_0064866 Ga0466968_0064866_46_1380 444
363 3300044765 Ga0466970_0000065 Ga0466970_0000065_33782_35116 444
364 3300044765 Ga0466970_0001560 Ga0466970_0001560_8673_10010 444
365 3300046460 Ga0495638_0011610 Ga0495638_0011610_4702_6036 444
366 3300046492 Ga0495585_0006676 Ga0495585_0006676_5711_7048 444
367 3300046507 Ga0495606_0003716 Ga0495606_0003716_7002_8336 444
368 3300046507 Ga0495606_0029107 Ga0495606_0029107_208_1548 444
369 3300046513 Ga0495616_0007790 Ga0495616_0007790_960_2297 444
370 3300046518 Ga0495631_0007677 Ga0495631_0007677_516_1856 444
371 3300046524 Ga0495648_0005100 Ga0495648_0005100_4220_5557 444
372 3300046524 Ga0495648_0070368 Ga0495648_0070368_291_1625 444
373 3300046524 Ga0495648_0078157 Ga0495648_0078157_378_1715 444
374 3300046538 Ga0495609_0013557 Ga0495609_0013557_415_1752 444
375 3300046558 Ga0495633_0000322 Ga0495633_0000322_5368_6705 444
376 3300046616 Ga0495668_0000044 Ga0495668_0000044_87300_88637 444
377 3300046648 Ga0495611_0001630 Ga0495611_0001630_5456_6790 444
378 3300046660 Ga0495625_0001984 Ga0495625_0001984_2657_3994 444
379 3300046660 Ga0495625_0003910 Ga0495625_0003910_11576_12913 444
380 3300046660 Ga0495625_0051693 Ga0495625_0051693_1537_2874 444
381 3300046660 Ga0495625_0154709 Ga0495625_0154709_72_1409 444
382 3300046665 Ga0495661_0037652 Ga0495661_0037652_1467_2804 444
383 3300046683 Ga0495658_0105319 Ga0495658_0105319_194_1531 444
384 3300046694 Ga0495649_0027183 Ga0495649_0027183_182_1522 444
385 3300047443 Ga0495687_000006 Ga0495687_000006_160370_161704 444
386 3300047443 Ga0495687_002515 Ga0495687_002515_1870_3207 444
387 3300047472 Ga0495686_0000078 Ga0495686_0000078_103798_105132 444
388 3300048920 Ga0496117_0002637 Ga0496117_0002637_10812_12146 444
389 3300048921 Ga0496118_0006062 Ga0496118_0006062_9999_11333 444
390 3300048927 Ga0496124_0058418 Ga0496124_0058418_180_1514 444
391 3300048928 Ga0496125_0026821 Ga0496125_0026821_2607_3941 444
392 3300050493 nmdc:mga0k408_116_c3 nmdc:mga0k408_116_c3_9357_10694 444
393 3300053091 Ga0500647_0058781 Ga0500647_0058781_367_1704 444
394 3300053092 Ga0500583_0001914 Ga0500583_0001914_2672_4006 444
395 3300053156 Ga0500622_0001084 Ga0500622_0001084_11780_13114 444
396 3300053157 Ga0500624_000800 Ga0500624_000800_3534_4871 444
397 3300053178 Ga0500637_0045894 Ga0500637_0045894_884_2218 444

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19289

PmbA_TldD_3rd

PmbA/TldA metallopeptidase C-terminal domain

214

431

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vl4-assembly1.cif.gz_B crystal structure of a putative modulator of a dna gyrase (tm0727) from thermotoga maritima msb8 at 1.95 a resolution 0.877 9 438
6j6a-assembly1.cif.gz_B crystal structure of tlde from thermococcus kodakarensis 0.8746 9 439
1vl4-assembly1.cif.gz_B crystal structure of a putative modulator of a dna gyrase (tm0727) from thermotoga maritima msb8 at 1.95 a resolution 0.8732 9 438
3qtd-assembly2.cif.gz_B crystal structure of putative modulator of gyrase (pmba) from pseudomonas aeruginosa pao1 0.8638 6 439
3tv9-assembly1.cif.gz_A-2 crystal structure of putative peptide maturation protein from shigella flexneri 0.8549 6 434
ID Description Score Start End Superfamily
af_Q57684_3_193_3.30.2290.10 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.8798 13 207 3.30.2290.10
1vl4B01 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.8583 4 211 3.30.2290.10
af_Q57684_3_193_3.30.2290.10 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.8582 13 207 3.30.2290.10
af_P71898_23_321_3.30.2290.10 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.8575 25 310 3.30.2290.10
1vl4B01 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.8505 4 211 3.30.2290.10
ID Description Score Start End GO Terms
AF-A0A4Q3DBT1-F1-model_v4 TldD/PmbA family protein 0.9945 1 212 GO:0006508
GO:0008237
AF-A0A4Q3DBT1-F1-model_v4 TldD/PmbA family protein 0.9899 1 212 GO:0006508
GO:0008237
AF-A0A7Y4VI98-F1-model_v4 TldD/PmbA family protein 0.9852 3 349 GO:0006508
GO:0008237
AF-A0A0S8A8Y1-F1-model_v4 Peptidase C69 0.9827 2 443 GO:0006508
GO:0008237
AF-A0A5E6MGA2-F1-model_v4 PmbA protein 0.9806 3 443 GO:0006508
GO:0008237

Feature Viewer

pLDDT pTM Quality
93.5 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map