F433797

General Info

Members Datasets Scaffolds Average Seq Length
397 276 794 302

Family's Representative Sequence

Representative Sequence 3300028380|Ga0268265_10321732|Ga0268265_103217322
Length 361
Sequence MVVPPTIANTPMSGATHNYGEAEDLSLTYLNAAADGIGCLLLLLQRLDRGYAANNFEGEAVKDPYETLGVARTASAEEIRKAYRRLAKKLHPDLNPGNKELEERFKEVASANDLLSDPDKRQRFDSGEIDASGAERPRQRFYKDYAAEAPAGHPYENRSGFADFADSDDLFAELFRRQAEQARRAPGQDLHYRLAIDFLDAVTGATKRLTLPDGGTLNXXXXSGIEAGKILRLRGKGAPSPGEGEPGDALVEISINPHRFFSRHGDDIHLDLPITLTEAVLGSRVRVPTPTGAVTLTVPKGSNTGAVLRLKGKGVPRPGGHGDELVRLKVMLPSQPDAELEAFLANWKPGTNYDPRRDMQP

Samples

Sample ID Description Type Environment
1 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
89 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
140 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
179 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
191 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
207 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
258 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
259 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
260 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 2509276019 Ensifer aridi TW10 Isolate Nodule
264 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
265 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
266 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
267 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
268 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
269 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
270 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
271 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
272 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
273 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
274 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
275 2922368715
276 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.46
Metatranscriptomes 0
Isolates 3.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.02
Nodule 3.02
Rhizoplane 12.85
Rhizosphere 77.08
Stem 0
Stem Tuber 0
Unclassified 5.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268265_10321732 3300028380 Bacteria 1401
2 JGI24743J22301_10002152 3300001991 Bacteria 2912
3 JGI24748J21848_1003298 3300002074 Bacteria 1842
4 JGI24751J29686_10004864 3300002459 Bacteria 2734
5 JGI25406J46586_10000448 3300003203 Bacteria 19119
6 JGI25406J46586_10000626 3300003203 Bacteria 16556
7 Ga0070676_10015337 3300005328 Bacteria 4227
8 Ga0070670_100031342 3300005331 Bacteria 4578
9 Ga0070670_100135365 3300005331 Bacteria 2129
10 Ga0068868_100018655 3300005338 Bacteria 5190
11 Ga0070660_100329073 3300005339 Bacteria 1256
12 Ga0070689_100124632 3300005340 Bacteria 2061
13 Ga0070691_10018416 3300005341 Bacteria 3220
14 Ga0070687_100057567 3300005343 Bacteria 2039
15 Ga0070668_100077963 3300005347 Bacteria 2590
16 Ga0070668_100276753 3300005347 Bacteria 1400
17 Ga0070675_100165475 3300005354 Bacteria 1904
18 Ga0070671_100014937 3300005355 Bacteria 6273
19 Ga0070671_100142639 3300005355 Bacteria 2022
20 Ga0070659_100417309 3300005366 Bacteria 1135
21 Ga0070667_100404577 3300005367 Bacteria 1243
22 Ga0070709_10002320 3300005434 Bacteria 10318
23 Ga0070709_10171440 3300005434 Bacteria 1516
24 Ga0070714_100106433 3300005435 Bacteria 2478
25 Ga0070714_100151623 3300005435 Bacteria 2089
26 Ga0070713_100192266 3300005436 Bacteria 1840
27 Ga0070713_100398986 3300005436 Bacteria 1284
28 Ga0070710_10164441 3300005437 Bacteria 1378
29 Ga0070711_100048553 3300005439 Bacteria 2903
30 Ga0070711_100083209 3300005439 Bacteria 2286
31 Ga0070711_100230289 3300005439 Bacteria 1444
32 Ga0070700_100010594 3300005441 Bacteria 5092
33 Ga0070708_100163802 3300005445 Unclassified 2073
34 Ga0070663_100120767 3300005455 Bacteria 1979
35 Ga0070662_100070690 3300005457 Bacteria 2572
36 Ga0070681_10066194 3300005458 Bacteria 3582
37 Ga0068867_100115474 3300005459 Bacteria 2067
38 Ga0070685_10014775 3300005466 Bacteria 4139
39 Ga0070699_100022843 3300005518 Bacteria 5390
40 Ga0070699_100200268 3300005518 Bacteria 1775
41 Ga0070679_100014596 3300005530 Bacteria 7547
42 Ga0070684_100207502 3300005535 Bacteria 1786
43 Ga0070684_100229323 3300005535 Bacteria 1695
44 Ga0068853_100266748 3300005539 Bacteria 1575
45 Ga0070672_100087980 3300005543 Bacteria 2500
46 Ga0070695_100082166 3300005545 Bacteria 2133
47 Ga0070665_100103809 3300005548 Bacteria 2845
48 Ga0070664_100322038 3300005564 Bacteria 1401
49 Ga0068857_100152416 3300005577 Bacteria 2095
50 Ga0070702_100237303 3300005615 Bacteria 1229
51 Ga0068859_100186218 3300005617 Bacteria 2160
52 Ga0068864_100023798 3300005618 Bacteria 5146
53 Ga0068870_10007615 3300005840 Bacteria 4839
54 Ga0068858_100068011 3300005842 Bacteria 3300
55 Ga0081455_10001093 3300005937 Bacteria 34045
56 Ga0081455_10012309 3300005937 Bacteria 8537
57 Ga0081538_10014704 3300005981 Bacteria 6108
58 Ga0081540_1001486 3300005983 Bacteria 20247
59 Ga0081540_1094268 3300005983 Bacteria 1308
60 Ga0081539_10000350 3300005985 Bacteria 101255
61 Ga0070717_10043267 3300006028 Bacteria 3675
62 Ga0070717_10213213 3300006028 Bacteria 1695
63 Ga0075365_10048329 3300006038 Bacteria 2800
64 Ga0075432_10041131 3300006058 Bacteria 1614
65 Ga0070715_10153018 3300006163 Unclassified 1132
66 Ga0070716_100005600 3300006173 Bacteria 6098
67 Ga0070712_100057044 3300006175 Bacteria 2742
68 Ga0070712_100162493 3300006175 Unclassified 1725
69 Ga0068871_100081819 3300006358 Bacteria 2676
70 Ga0075428_100053330 3300006844 Bacteria 4430
71 Ga0075428_100097944 3300006844 Bacteria 3197
72 Ga0075428_100115675 3300006844 Bacteria 2922
73 Ga0075431_100010609 3300006847 Bacteria 9266
74 Ga0075431_100031466 3300006847 Bacteria 5465
75 Ga0075431_100035601 3300006847 Bacteria 5126
76 Ga0075433_10099560 3300006852 Bacteria 2573
77 Ga0075434_100219785 3300006871 Unclassified 1919
78 Ga0075434_100300541 3300006871 Bacteria 1626
79 Ga0075429_100030551 3300006880 Bacteria 4680
80 Ga0068865_100029513 3300006881 Bacteria 3640
81 Ga0097620_100186208 3300006931 Bacteria 2160
82 Ga0075435_100039123 3300007076 Bacteria 3784
83 Ga0099794_10016149 3300007265 Bacteria 3307
84 Ga0105240_10006336 3300009093 Bacteria 17420
85 Ga0105240_10009245 3300009093 Bacteria 13980
86 Ga0105240_10077948 3300009093 Bacteria 4082
87 Ga0111539_10473987 3300009094 Bacteria 1458
88 Ga0105245_10326865 3300009098 Bacteria 1512
89 Ga0105247_10007123 3300009101 Bacteria 6868
90 Ga0105247_10218308 3300009101 Bacteria 1289
91 Ga0114129_10039350 3300009147 Bacteria 6666
92 Ga0114129_10050925 3300009147 Bacteria 5814
93 Ga0114129_10231640 3300009147 Bacteria 2487
94 Ga0114129_10388459 3300009147 Bacteria 1841
95 Ga0105243_10080592 3300009148 Bacteria 2656
96 Ga0105242_10167473 3300009176 Bacteria 1928
97 Ga0105248_10022767 3300009177 Bacteria 6953
98 Ga0105237_10002226 3300009545 Bacteria 24262
99 Ga0105237_10137237 3300009545 Bacteria 2440
100 Ga0105238_10155368 3300009551 Bacteria 2263
101 Ga0105249_10083445 3300009553 Bacteria 2974
102 Ga0105239_10003033 3300010375 Bacteria 20894
103 Ga0105239_10116881 3300010375 Bacteria 2960
104 Ga0105246_10034468 3300011119 Bacteria 3374
105 Ga0105246_10088872 3300011119 Bacteria 2221
106 Ga0157370_10019223 3300013104 Bacteria 6862
107 Ga0157370_10153250 3300013104 Bacteria 2144
108 Ga0157369_10004728 3300013105 Bacteria 16002
109 Ga0157374_10054198 3300013296 Bacteria 3740
110 Ga0157378_10320973 3300013297 Bacteria 1504
111 Ga0163162_10151879 3300013306 Bacteria 2434
112 Ga0157375_10287335 3300013308 Bacteria 1807
113 Ga0163163_10103290 3300014325 Bacteria 2875
114 Ga0157377_10110041 3300014745 Bacteria 1654
115 Ga0157379_10051895 3300014968 Bacteria 3661
116 Ga0157376_10209136 3300014969 Bacteria 1800
117 Ga0163161_10024550 3300017792 Bacteria 4260
118 Ga0214542_1022666 3300021321 Bacteria 3965
119 Ga0214543_1000071 3300021327 Bacteria 123940
120 Ga0213875_10000546 3300021388 Bacteria 30849
121 Ga0213875_10000615 3300021388 Bacteria 28752
122 Ga0207697_10109517 3300025315 Bacteria 1182
123 Ga0207692_10003003 3300025898 Bacteria 6537
124 Ga0207692_10022872 3300025898 Bacteria 2883
125 Ga0207642_10096059 3300025899 Bacteria 1476
126 Ga0207710_10005797 3300025900 Bacteria 5301
127 Ga0207688_10001814 3300025901 Bacteria 11369
128 Ga0207680_10079064 3300025903 Bacteria 2061
129 Ga0207647_10063151 3300025904 Bacteria 2253
130 Ga0207685_10171867 3300025905 Bacteria 998
131 Ga0207699_10024285 3300025906 Bacteria 3313
132 Ga0207699_10103569 3300025906 Bacteria 1810
133 Ga0207645_10007457 3300025907 Bacteria 7725
134 Ga0207643_10004469 3300025908 Bacteria 7516
135 Ga0207707_10026599 3300025912 Bacteria 5057
136 Ga0207671_10157029 3300025914 Bacteria 1760
137 Ga0207693_10010142 3300025915 Bacteria 7653
138 Ga0207693_10012163 3300025915 Bacteria 6953
139 Ga0207693_10025917 3300025915 Bacteria 4644
140 Ga0207693_10041526 3300025915 Bacteria 3621
141 Ga0207663_10111894 3300025916 Bacteria 1854
142 Ga0207662_10057170 3300025918 Bacteria 2331
143 Ga0207657_10061992 3300025919 Bacteria 3203
144 Ga0207652_10044614 3300025921 Bacteria 3777
145 Ga0207650_10036763 3300025925 Bacteria 3564
146 Ga0207650_10070987 3300025925 Bacteria 2619
147 Ga0207687_10020649 3300025927 Bacteria 4371
148 Ga0207664_10047478 3300025929 Bacteria 3373
149 Ga0207690_10290150 3300025932 Bacteria 1277
150 Ga0207706_10127398 3300025933 Bacteria 2239
151 Ga0207686_10050016 3300025934 Bacteria 2597
152 Ga0207665_10000206 3300025939 Bacteria 39664
153 Ga0207691_10033479 3300025940 Bacteria 4784
154 Ga0207711_10025757 3300025941 Bacteria 4932
155 Ga0207689_10028382 3300025942 Bacteria 4682
156 Ga0207679_10008925 3300025945 Bacteria 6400
157 Ga0207651_10022839 3300025960 Bacteria 3835
158 Ga0207712_10042538 3300025961 Bacteria 3129
159 Ga0207668_10384543 3300025972 Bacteria 1182
160 Ga0207640_10032715 3300025981 Bacteria 3226
161 Ga0207677_10131380 3300026023 Bacteria 1902
162 Ga0207703_10021745 3300026035 Bacteria 5022
163 Ga0207703_10071002 3300026035 Bacteria 2875
164 Ga0207639_10160419 3300026041 Bacteria 1894
165 Ga0207678_10072094 3300026067 Bacteria 2960
166 Ga0207708_10024343 3300026075 Bacteria 4580
167 Ga0207702_10141314 3300026078 Bacteria 2179
168 Ga0207641_10104786 3300026088 Bacteria 2497
169 Ga0207648_10005942 3300026089 Bacteria 12210
170 Ga0207676_10065968 3300026095 Bacteria 2884
171 Ga0207675_100000915 3300026118 Bacteria 29452
172 Ga0207683_10007238 3300026121 Bacteria 9509
173 Ga0209371_1012957 3300027312 Bacteria 2378
174 Ga0209588_1021020 3300027671 Bacteria 2046
175 Ga0268266_10109093 3300028379 Bacteria 2450
176 Ga0268264_10481428 3300028381 Bacteria 1207
177 Ga0265319_1047074 3300028563 Bacteria 1436
178 Ga0268256_1020330 3300030500 Unclassified 1792
179 Ga0265330_10108370 3300031235 Unclassified 1187
180 Ga0265328_10002068 3300031239 Bacteria 9062
181 Ga0265325_10003600 3300031241 Bacteria 10050
182 Ga0265340_10021493 3300031247 Bacteria 3309
183 Ga0265339_10033641 3300031249 Unclassified 2885
184 Ga0265339_10060853 3300031249 Unclassified 2034
185 Ga0265339_10116741 3300031249 Bacteria 1376
186 Ga0265331_10000125 3300031250 Bacteria 101037
187 Ga0265316_10033788 3300031344 Bacteria 4161
188 Ga0265316_10109903 3300031344 Bacteria 2089
189 Ga0307513_10015530 3300031456 Bacteria 9229
190 Ga0307513_10180516 3300031456 Bacteria 1975
191 Ga0265313_10021757 3300031595 Unclassified 3499
192 Ga0265314_10017169 3300031711 Bacteria 5687
193 Ga0265314_10084007 3300031711 Unclassified 2091
194 Ga0265342_10069036 3300031712 Unclassified 2064
195 Ga0307407_10111994 3300031903 Bacteria 1715
196 Ga0307415_100385025 3300032126 Bacteria 1192
197 Ga0315911_1000020 3300033442 Bacteria 139809
198 Ga0373926_0015185 3300035083 Bacteria 2624
199 Ga0373934_0018641 3300035086 Bacteria 2657
200 Ga0373923_0010616 3300035111 Bacteria 3356
201 Ga0373936_0023557 3300035113 Bacteria 2400
202 Ga0373936_0067751 3300035113 Bacteria 1467
203 Ga0373945_0006407 3300035116 Bacteria 3797
204 Ga0373954_0004253 3300035118 Bacteria 6154
205 Ga0373957_0003499 3300035120 Bacteria 4651
206 Ga0373943_0004224 3300035170 Bacteria 6514
207 Ga0373935_0097707 3300035692 Bacteria 1932
208 Ga0373935_0227606 3300035692 Bacteria 1297
209 Ga0373935_0236656 3300035692 Unclassified 1273
210 Ga0373927_0012744 3300035695 Bacteria 5592
211 Ga0373927_0046642 3300035695 Bacteria 2803
212 Ga0373927_0073899 3300035695 Bacteria 2207
213 Ga0373933_0012328 3300035724 Bacteria 4720
214 Ga0373947_0012500 3300035725 Bacteria 4868
215 Ga0373947_0044474 3300035725 Bacteria 2654
216 Ga0373937_0042459 3300036401 Bacteria 4149
217 Ga0373925_0014674 3300037068 Bacteria 5661
218 Ga0373925_0021069 3300037068 Bacteria 4749
219 Ga0373925_0024810 3300037068 Bacteria 4379
220 Ga0395899_0053761 3300037312 Bacteria 2981
221 Ga0395900_0120204 3300037418 Bacteria 2696
222 Ga0436364_0335253 3300037853 Bacteria 76277
223 Ga0436364_0659614 3300037853 Bacteria 2674
224 Ga0436364_0787562 3300037853 Bacteria 1121
225 Ga0436364_1400834 3300037853 Bacteria 1732
226 Ga0436365_0425545 3300039437 Bacteria 2840
227 Ga0436360_0734694 3300039438 Bacteria 8371
228 Ga0436361_0260315 3300039447 Bacteria 3943
229 Ga0436361_1215348 3300039447 Bacteria 1747
230 Ga0436363_1025590 3300039450 Bacteria 3569
231 Ga0495592_0053970 3300046454 Bacteria 2979
232 Ga0495603_0005268 3300046455 Bacteria 7716
233 Ga0495590_0000125 3300046457 Bacteria 45786
234 Ga0495641_0096414 3300046461 Bacteria 1320
235 Ga0495580_0006376 3300046472 Bacteria 9624
236 Ga0495580_0150999 3300046472 Bacteria 1609
237 Ga0495582_0012074 3300046473 Bacteria 4759
238 Ga0495582_0025796 3300046473 Bacteria 3220
239 Ga0495639_0006411 3300046475 Bacteria 5062
240 Ga0495662_0023708 3300046476 Bacteria 2963
241 Ga0495664_0011910 3300046477 Bacteria 4914
242 Ga0495664_0161755 3300046477 Unclassified 1358
243 Ga0495594_0011942 3300046499 Bacteria 4517
244 Ga0495607_0135422 3300046501 Bacteria 1276
245 Ga0495608_0232448 3300046511 Bacteria 1154
246 Ga0495616_0151970 3300046513 Bacteria 1046
247 Ga0495630_0019143 3300046517 Bacteria 5032
248 Ga0495630_0119471 3300046517 Bacteria 1999
249 Ga0495630_0179522 3300046517 Bacteria 1614
250 Ga0495644_0049852 3300046523 Bacteria 1571
251 Ga0495663_0013584 3300046525 Bacteria 2278
252 Ga0495665_0004207 3300046531 Bacteria 7768
253 Ga0495665_0021854 3300046531 Bacteria 3441
254 Ga0495665_0046634 3300046531 Bacteria 2300
255 Ga0495640_0017384 3300046533 Bacteria 5362
256 Ga0495640_0192847 3300046533 Unclassified 1294
257 Ga0495621_0040649 3300046539 Bacteria 1630
258 Ga0495633_0106000 3300046558 Bacteria 1304
259 Ga0495667_0015618 3300046559 Bacteria 5134
260 Ga0495634_0020450 3300046642 Bacteria 4694
261 Ga0495634_0032440 3300046642 Bacteria 3592
262 Ga0495634_0043533 3300046642 Bacteria 3042
263 Ga0495625_0226139 3300046660 Bacteria 1224
264 Ga0495635_0075054 3300046663 Bacteria 2316
265 Ga0495588_0005463 3300046674 Bacteria 5657
266 Ga0495646_0006689 3300046680 Bacteria 7309
267 Ga0495647_0059836 3300046681 Bacteria 1500
268 Ga0495658_0018228 3300046683 Bacteria 3646
269 Ga0495613_0032249 3300046689 Bacteria 3891
270 Ga0495624_0063814 3300046690 Bacteria 2302
271 Ga0495624_0083865 3300046690 Bacteria 1970
272 Ga0495671_0043709 3300046692 Bacteria 2249
273 Ga0495660_0069365 3300046810 Bacteria 1874
274 Ga0495581_0055710 3300047315 Bacteria 2282
275 Ga0495604_0077750 3300047317 Bacteria 2493
276 Ga0495674_0003405 3300047319 Bacteria 15455
277 Ga0495674_0050048 3300047319 Bacteria 3688
278 Ga0495674_0302956 3300047319 Unclassified 1305
279 Ga0495676_0014118 3300047321 Bacteria 7152
280 Ga0495676_0043359 3300047321 Bacteria 3683
281 Ga0495681_0003520 3300047470 Bacteria 10881
282 Ga0495684_0003539 3300047471 Bacteria 12218
283 Ga0495684_0019455 3300047471 Bacteria 5229
284 Ga0495593_0055563 3300047673 Bacteria 2083
285 Ga0495593_0078900 3300047673 Bacteria 1704
286 Ga0495614_0042087 3300048089 Bacteria 1959
287 Ga0496100_0006319 3300048903 Bacteria 6455
288 Ga0496100_0040013 3300048903 Bacteria 2980
289 Ga0496100_0177869 3300048903 Bacteria 1537
290 Ga0496101_0001371 3300048904 Bacteria 14598
291 Ga0496101_0035976 3300048904 Bacteria 3505
292 Ga0496102_0146297 3300048905 Bacteria 2218
293 Ga0496102_0213516 3300048905 Bacteria 1819
294 Ga0496103_0027225 3300048906 Bacteria 3462
295 Ga0496103_0272876 3300048906 Bacteria 1088
296 Ga0496104_0000044 3300048907 Bacteria 153699
297 Ga0496104_0000917 3300048907 Bacteria 25278
298 Ga0496104_0002541 3300048907 Bacteria 15713
299 Ga0496104_0002784 3300048907 Bacteria 15071
300 Ga0496104_0147824 3300048907 Bacteria 2256
301 Ga0496104_0148746 3300048907 Bacteria 2248
302 Ga0496104_0552195 3300048907 Bacteria 1063
303 Ga0496105_0000017 3300048908 Bacteria 210323
304 Ga0496105_0010862 3300048908 Bacteria 7171
305 Ga0496105_0018159 3300048908 Bacteria 5647
306 Ga0496105_0020495 3300048908 Bacteria 5343
307 Ga0496105_0024476 3300048908 Bacteria 4905
308 Ga0496105_0082509 3300048908 Bacteria 2655
309 Ga0496105_0441216 3300048908 Bacteria 1028
310 Ga0496107_0009465 3300048910 Bacteria 6758
311 Ga0496107_0081608 3300048910 Bacteria 2358
312 Ga0496108_0000400 3300048911 Bacteria 35840
313 Ga0496108_0037360 3300048911 Bacteria 4044
314 Ga0496108_0100979 3300048911 Bacteria 2461
315 Ga0496108_0393229 3300048911 Bacteria 1211
316 Ga0496109_0006999 3300048912 Bacteria 9515
317 Ga0496109_0025942 3300048912 Bacteria 5222
318 Ga0496110_0044947 3300048913 Bacteria 3858
319 Ga0496110_0057513 3300048913 Bacteria 3423
320 Ga0496110_0112918 3300048913 Bacteria 2443
321 Ga0496110_0143037 3300048913 Bacteria 2162
322 Ga0496110_0242327 3300048913 Bacteria 1640
323 Ga0496112_0024721 3300048915 Bacteria 5758
324 Ga0496112_0103395 3300048915 Bacteria 2818
325 Ga0496112_0515950 3300048915 Unclassified 1130
326 Ga0496113_0001227 3300048916 Bacteria 14080
327 Ga0496113_0011038 3300048916 Bacteria 6005
328 Ga0496113_0022160 3300048916 Bacteria 4488
329 Ga0496114_0011955 3300048917 Bacteria 6944
330 Ga0496114_0083065 3300048917 Bacteria 2709
331 Ga0496114_0347603 3300048917 Bacteria 1311
332 Ga0496115_0021831 3300048918 Bacteria 4950
333 Ga0496115_0106443 3300048918 Bacteria 2302
334 Ga0496115_0107804 3300048918 Bacteria 2287
335 Ga0496115_0246555 3300048918 Bacteria 1471
336 Ga0496115_0419325 3300048918 Bacteria 1084
337 Ga0496115_0459800 3300048918 Bacteria 1027
338 Ga0496118_0159279 3300048921 Bacteria 1399
339 Ga0496119_0002993 3300048922 Bacteria 17920
340 Ga0496119_0189533 3300048922 Bacteria 1072
341 Ga0496126_0001140 3300048929 Bacteria 44190
342 Ga0501031_0028693 3300049568 Bacteria 3628
343 Ga0501032_0136384 3300049569 Bacteria 1617
344 Ga0501032_0260466 3300049569 Bacteria 1124
345 Ga0501033_0017566 3300049570 Bacteria 5404
346 Ga0501036_0131574 3300049572 Bacteria 2112
347 Ga0501037_0030955 3300049573 Bacteria 3952
348 Ga0501039_0134954 3300049575 Unclassified 1937
349 Ga0501039_0259804 3300049575 Bacteria 1365
350 Ga0501043_0128819 3300049579 Unclassified 1983
351 Ga0501074_0314668 3300049590 Bacteria 1112
352 Ga0501076_0113532 3300049592 Bacteria 2192
353 Ga0501077_0046070 3300049593 Bacteria 2771
354 Ga0501079_0327015 3300049741 Bacteria 1200
355 Ga0501044_0107315 3300049823 Bacteria 2804
356 Ga0501044_0376017 3300049823 Bacteria 1336
357 nmdc:mga00v17_168582_c1 3300050491 Bacteria 1411
358 nmdc:mga0yw44_131142_c1 3300050492 Bacteria 1623
359 nmdc:mga0yw44_22030_c1 3300050492 Bacteria 3565
360 nmdc:mga05p37_165765_c1 3300050507 Bacteria 2697
361 nmdc:mga05p37_20526_c1 3300050507 Bacteria 7993
362 nmdc:mga05p37_240908_c1 3300050507 Unclassified 2175
363 nmdc:mga05p37_320932_c1 3300050507 Bacteria 1833
364 nmdc:mga0qj67_188122_c1 3300050509 Bacteria 1678
365 nmdc:mga06r32_173694_c1 3300050510 Bacteria 2139
366 nmdc:mga06r32_83387_c1 3300050510 Bacteria 3115
367 nmdc:mga08y16_451126_c1 3300050511 Bacteria 1311
368 nmdc:mga08y16_89603_c1 3300050511 Bacteria 3205
369 nmdc:mga0n895_275023_c1 3300050512 Bacteria 1708
370 nmdc:mga0a205_393523_c1 3300050515 Unclassified 1250
371 Ga0495601_0024775 3300053077 Bacteria 3695
372 Ga0495612_0019045 3300053078 Bacteria 2748
373 Ga0495595_0094816 3300053084 Bacteria 1435
374 Ga0495619_0096768 3300053085 Bacteria 2005
375 Ga0495619_0120247 3300053085 Unclassified 1800
376 Ga0495619_0163422 3300053085 Bacteria 1538
377 Ga0500578_0130829 3300053086 Bacteria 1574
378 Ga0500651_0003589 3300053093 Bacteria 8503
379 Ga0500560_000286 3300053107 Bacteria 6375
380 Ga0500594_0008249 3300053118 Bacteria 2370
381 Ga0501084_0244838 3300054114 Bacteria 1513
382 Ga0501082_0124085 3300060353 Bacteria 2239
383 2509376924 2509276019 Bacteria 6802256
384 2558861258 2558860100 Bacteria 8458965
385 2558862814 2558860100 Bacteria 8458965
386 2616555408 2615840698 Bacteria 7319877
387 2792641589 2791355094 Bacteria 7011481
388 2850082971 2850079185 Bacteria 6848280
389 2855876083 2855872281 Bacteria 6964271
390 2903751696 2903748898 Bacteria 9972761
391 2904693256 2904690495 Bacteria 9412302
392 2906637552 2906635258 Bacteria 8601019
393 2906661142 2906660503 Bacteria 8595048
394 2919413513 2919408235 Bacteria 6149349
395 2920766348 2920760137 Bacteria 7427611
396 2922369287
397 8056695576 8056689827 Bacteria 6712655
398 Ga0268265_10321732
399 JGI24743J22301_10002152
400 JGI24748J21848_1003298
401 JGI24751J29686_10004864
402 JGI25406J46586_10000448
403 JGI25406J46586_10000626
404 Ga0070676_10015337
405 Ga0070670_100031342
406 Ga0070670_100135365
407 Ga0068868_100018655
408 Ga0070660_100329073
409 Ga0070689_100124632
410 Ga0070691_10018416
411 Ga0070687_100057567
412 Ga0070668_100077963
413 Ga0070668_100276753
414 Ga0070675_100165475
415 Ga0070671_100014937
416 Ga0070671_100142639
417 Ga0070659_100417309
418 Ga0070667_100404577
419 Ga0070709_10002320
420 Ga0070709_10171440
421 Ga0070714_100106433
422 Ga0070714_100151623
423 Ga0070713_100192266
424 Ga0070713_100398986
425 Ga0070710_10164441
426 Ga0070711_100048553
427 Ga0070711_100083209
428 Ga0070711_100230289
429 Ga0070700_100010594
430 Ga0070708_100163802
431 Ga0070663_100120767
432 Ga0070662_100070690
433 Ga0070681_10066194
434 Ga0068867_100115474
435 Ga0070685_10014775
436 Ga0070699_100022843
437 Ga0070699_100200268
438 Ga0070679_100014596
439 Ga0070684_100207502
440 Ga0070684_100229323
441 Ga0068853_100266748
442 Ga0070672_100087980
443 Ga0070695_100082166
444 Ga0070665_100103809
445 Ga0070664_100322038
446 Ga0068857_100152416
447 Ga0070702_100237303
448 Ga0068859_100186218
449 Ga0068864_100023798
450 Ga0068870_10007615
451 Ga0068858_100068011
452 Ga0081455_10001093
453 Ga0081455_10012309
454 Ga0081538_10014704
455 Ga0081540_1001486
456 Ga0081540_1094268
457 Ga0081539_10000350
458 Ga0070717_10043267
459 Ga0070717_10213213
460 Ga0075365_10048329
461 Ga0075432_10041131
462 Ga0070715_10153018
463 Ga0070716_100005600
464 Ga0070712_100057044
465 Ga0070712_100162493
466 Ga0068871_100081819
467 Ga0075428_100053330
468 Ga0075428_100097944
469 Ga0075428_100115675
470 Ga0075431_100010609
471 Ga0075431_100031466
472 Ga0075431_100035601
473 Ga0075433_10099560
474 Ga0075434_100219785
475 Ga0075434_100300541
476 Ga0075429_100030551
477 Ga0068865_100029513
478 Ga0097620_100186208
479 Ga0075435_100039123
480 Ga0099794_10016149
481 Ga0105240_10006336
482 Ga0105240_10009245
483 Ga0105240_10077948
484 Ga0111539_10473987
485 Ga0105245_10326865
486 Ga0105247_10007123
487 Ga0105247_10218308
488 Ga0114129_10039350
489 Ga0114129_10050925
490 Ga0114129_10231640
491 Ga0114129_10388459
492 Ga0105243_10080592
493 Ga0105242_10167473
494 Ga0105248_10022767
495 Ga0105237_10002226
496 Ga0105237_10137237
497 Ga0105238_10155368
498 Ga0105249_10083445
499 Ga0105239_10003033
500 Ga0105239_10116881
501 Ga0105246_10034468
502 Ga0105246_10088872
503 Ga0157370_10019223
504 Ga0157370_10153250
505 Ga0157369_10004728
506 Ga0157374_10054198
507 Ga0157378_10320973
508 Ga0163162_10151879
509 Ga0157375_10287335
510 Ga0163163_10103290
511 Ga0157377_10110041
512 Ga0157379_10051895
513 Ga0157376_10209136
514 Ga0163161_10024550
515 Ga0214542_1022666
516 Ga0214543_1000071
517 Ga0213875_10000546
518 Ga0213875_10000615
519 Ga0207697_10109517
520 Ga0207692_10003003
521 Ga0207692_10022872
522 Ga0207642_10096059
523 Ga0207710_10005797
524 Ga0207688_10001814
525 Ga0207680_10079064
526 Ga0207647_10063151
527 Ga0207685_10171867
528 Ga0207699_10024285
529 Ga0207699_10103569
530 Ga0207645_10007457
531 Ga0207643_10004469
532 Ga0207707_10026599
533 Ga0207671_10157029
534 Ga0207693_10010142
535 Ga0207693_10012163
536 Ga0207693_10025917
537 Ga0207693_10041526
538 Ga0207663_10111894
539 Ga0207662_10057170
540 Ga0207657_10061992
541 Ga0207652_10044614
542 Ga0207650_10036763
543 Ga0207650_10070987
544 Ga0207687_10020649
545 Ga0207664_10047478
546 Ga0207690_10290150
547 Ga0207706_10127398
548 Ga0207686_10050016
549 Ga0207665_10000206
550 Ga0207691_10033479
551 Ga0207711_10025757
552 Ga0207689_10028382
553 Ga0207679_10008925
554 Ga0207651_10022839
555 Ga0207712_10042538
556 Ga0207668_10384543
557 Ga0207640_10032715
558 Ga0207677_10131380
559 Ga0207703_10021745
560 Ga0207703_10071002
561 Ga0207639_10160419
562 Ga0207678_10072094
563 Ga0207708_10024343
564 Ga0207702_10141314
565 Ga0207641_10104786
566 Ga0207648_10005942
567 Ga0207676_10065968
568 Ga0207675_100000915
569 Ga0207683_10007238
570 Ga0209371_1012957
571 Ga0209588_1021020
572 Ga0268266_10109093
573 Ga0268264_10481428
574 Ga0265319_1047074
575 Ga0268256_1020330
576 Ga0265330_10108370
577 Ga0265328_10002068
578 Ga0265325_10003600
579 Ga0265340_10021493
580 Ga0265339_10033641
581 Ga0265339_10060853
582 Ga0265339_10116741
583 Ga0265331_10000125
584 Ga0265316_10033788
585 Ga0265316_10109903
586 Ga0307513_10015530
587 Ga0307513_10180516
588 Ga0265313_10021757
589 Ga0265314_10017169
590 Ga0265314_10084007
591 Ga0265342_10069036
592 Ga0307407_10111994
593 Ga0307415_100385025
594 Ga0315911_1000020
595 Ga0373926_0015185
596 Ga0373934_0018641
597 Ga0373923_0010616
598 Ga0373936_0023557
599 Ga0373936_0067751
600 Ga0373945_0006407
601 Ga0373954_0004253
602 Ga0373957_0003499
603 Ga0373943_0004224
604 Ga0373935_0097707
605 Ga0373935_0227606
606 Ga0373935_0236656
607 Ga0373927_0012744
608 Ga0373927_0046642
609 Ga0373927_0073899
610 Ga0373933_0012328
611 Ga0373947_0012500
612 Ga0373947_0044474
613 Ga0373937_0042459
614 Ga0373925_0014674
615 Ga0373925_0021069
616 Ga0373925_0024810
617 Ga0395899_0053761
618 Ga0395900_0120204
619 Ga0436364_0335253
620 Ga0436364_0659614
621 Ga0436364_0787562
622 Ga0436364_1400834
623 Ga0436365_0425545
624 Ga0436360_0734694
625 Ga0436361_0260315
626 Ga0436361_1215348
627 Ga0436363_1025590
628 Ga0495592_0053970
629 Ga0495603_0005268
630 Ga0495590_0000125
631 Ga0495641_0096414
632 Ga0495580_0006376
633 Ga0495580_0150999
634 Ga0495582_0012074
635 Ga0495582_0025796
636 Ga0495639_0006411
637 Ga0495662_0023708
638 Ga0495664_0011910
639 Ga0495664_0161755
640 Ga0495594_0011942
641 Ga0495607_0135422
642 Ga0495608_0232448
643 Ga0495616_0151970
644 Ga0495630_0019143
645 Ga0495630_0119471
646 Ga0495630_0179522
647 Ga0495644_0049852
648 Ga0495663_0013584
649 Ga0495665_0004207
650 Ga0495665_0021854
651 Ga0495665_0046634
652 Ga0495640_0017384
653 Ga0495640_0192847
654 Ga0495621_0040649
655 Ga0495633_0106000
656 Ga0495667_0015618
657 Ga0495634_0020450
658 Ga0495634_0032440
659 Ga0495634_0043533
660 Ga0495625_0226139
661 Ga0495635_0075054
662 Ga0495588_0005463
663 Ga0495646_0006689
664 Ga0495647_0059836
665 Ga0495658_0018228
666 Ga0495613_0032249
667 Ga0495624_0063814
668 Ga0495624_0083865
669 Ga0495671_0043709
670 Ga0495660_0069365
671 Ga0495581_0055710
672 Ga0495604_0077750
673 Ga0495674_0003405
674 Ga0495674_0050048
675 Ga0495674_0302956
676 Ga0495676_0014118
677 Ga0495676_0043359
678 Ga0495681_0003520
679 Ga0495684_0003539
680 Ga0495684_0019455
681 Ga0495593_0055563
682 Ga0495593_0078900
683 Ga0495614_0042087
684 Ga0496100_0006319
685 Ga0496100_0040013
686 Ga0496100_0177869
687 Ga0496101_0001371
688 Ga0496101_0035976
689 Ga0496102_0146297
690 Ga0496102_0213516
691 Ga0496103_0027225
692 Ga0496103_0272876
693 Ga0496104_0000044
694 Ga0496104_0000917
695 Ga0496104_0002541
696 Ga0496104_0002784
697 Ga0496104_0147824
698 Ga0496104_0148746
699 Ga0496104_0552195
700 Ga0496105_0000017
701 Ga0496105_0010862
702 Ga0496105_0018159
703 Ga0496105_0020495
704 Ga0496105_0024476
705 Ga0496105_0082509
706 Ga0496105_0441216
707 Ga0496107_0009465
708 Ga0496107_0081608
709 Ga0496108_0000400
710 Ga0496108_0037360
711 Ga0496108_0100979
712 Ga0496108_0393229
713 Ga0496109_0006999
714 Ga0496109_0025942
715 Ga0496110_0044947
716 Ga0496110_0057513
717 Ga0496110_0112918
718 Ga0496110_0143037
719 Ga0496110_0242327
720 Ga0496112_0024721
721 Ga0496112_0103395
722 Ga0496112_0515950
723 Ga0496113_0001227
724 Ga0496113_0011038
725 Ga0496113_0022160
726 Ga0496114_0011955
727 Ga0496114_0083065
728 Ga0496114_0347603
729 Ga0496115_0021831
730 Ga0496115_0106443
731 Ga0496115_0107804
732 Ga0496115_0246555
733 Ga0496115_0419325
734 Ga0496115_0459800
735 Ga0496118_0159279
736 Ga0496119_0002993
737 Ga0496119_0189533
738 Ga0496126_0001140
739 Ga0501031_0028693
740 Ga0501032_0136384
741 Ga0501032_0260466
742 Ga0501033_0017566
743 Ga0501036_0131574
744 Ga0501037_0030955
745 Ga0501039_0134954
746 Ga0501039_0259804
747 Ga0501043_0128819
748 Ga0501074_0314668
749 Ga0501076_0113532
750 Ga0501077_0046070
751 Ga0501079_0327015
752 Ga0501044_0107315
753 Ga0501044_0376017
754 nmdc:mga00v17_168582_c1
755 nmdc:mga0yw44_131142_c1
756 nmdc:mga0yw44_22030_c1
757 nmdc:mga05p37_165765_c1
758 nmdc:mga05p37_20526_c1
759 nmdc:mga05p37_240908_c1
760 nmdc:mga05p37_320932_c1
761 nmdc:mga0qj67_188122_c1
762 nmdc:mga06r32_173694_c1
763 nmdc:mga06r32_83387_c1
764 nmdc:mga08y16_451126_c1
765 nmdc:mga08y16_89603_c1
766 nmdc:mga0n895_275023_c1
767 nmdc:mga0a205_393523_c1
768 Ga0495601_0024775
769 Ga0495612_0019045
770 Ga0495595_0094816
771 Ga0495619_0096768
772 Ga0495619_0120247
773 Ga0495619_0163422
774 Ga0500578_0130829
775 Ga0500651_0003589
776 Ga0500560_000286
777 Ga0500594_0008249
778 Ga0501084_0244838
779 Ga0501082_0124085
780 2509376924
781 2558861258
782 2558862814
783 2616555408
784 2792641589
785 2850082971
786 2855876083
787 2903751696
788 2904693256
789 2906637552
790 2906661142
791 2919413513
792 2920766348
793 2922369287
794 8056695576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

63

125

0.99

PF01556

DnaJ_C

DnaJ C terminal domain

190

333

0.97

PF01556

DnaJ_C

DnaJ C terminal domain

157

242

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j7z-assembly6.cif.gz_F thermus thermophilus dnaj j- and g/f-domains 0.9695 1 66
7jtk-assembly1.cif.gz_y radial spoke 1 isolated from chlamydomonas reinhardtii 0.9583 4 66
8glv-assembly1.cif.gz_KA 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.9473 4 66
5ayl-assembly1.cif.gz_A crystal structure of erdj5 form ii 0.938 3 67
3apq-assembly2.cif.gz_B crystal structure of j-trx1 fragment of erdj5 0.9342 3 66
ID Description Score Start End Superfamily
af_Q96LL9_48_122_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9905 5 68 1.10.287.110
af_I1NG96_25_126_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9772 3 68 1.10.287.110
af_Q54GP6_1_104_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9715 2 68 1.10.287.110
af_Q8GUN6_21_122_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9713 3 68 1.10.287.110
4j7zF00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9695 1 66 1.10.287.110
ID Description Score Start End GO Terms
AF-A0A1W4W308-F1-model_v4 Diphthamide biosynthesis protein 4 0.987 3 68
AF-A0A4U5QFY3-F1-model_v4 J domain-containing protein 0.9751 3 68 GO:0005634
GO:0005737
AF-A0A0E0CQ24-F1-model_v4 J domain-containing protein 0.9736 3 68 GO:0005634
GO:0005783
AF-A0A2E1Z000-F1-model_v4 deleted 0.9642 4 77
AF-A0A6G3VHS8-F1-model_v4 deleted 0.9553 202 278

Map