F433755

General Info

Members Datasets Scaffolds Average Seq Length
397 244 794 265

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10540123|Ga0105238_105401231
Length 320
Sequence MTAEILANAQAVREFCRAGLRCANNYKSLSDPPIVSSETADGHAEATSMQGEGXGQMQRRDFLATSLFGTAGLLASRLPFAASLGATSTRAAGRKILIAGGNYNTPFVRYMAELTGKARPKLLYLPTASADRADGIISWYKTCSTLNVTPMVQESFIASTKQAEGWEEVLLGVDGIVASGGNTLNQQAIWKAQGIDVVLRKAWDQGVVLGGASAGSLCWFEEGTTDSRPKELTTVQCLGFLKGSHCPHYDREPGRRPLYQKLIGSGQMKPGYACDNDAGIYFEDNTVKRVVHTDEKAKVYYVSLEGGKVVEKVLEPEMIR

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
145 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
146 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
147 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
153 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
171 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
175 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
176 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 2.52
Rhizosphere 96.73
Stem 0
Stem Tuber 0
Unclassified 9.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10540123 3300009551 Bacteria 1169
2 Ga0058863_10510848 3300004799 Bacteria 1165
3 Ga0070683_100013252 3300005329 Bacteria 7185
4 Ga0070683_100018755 3300005329 Bacteria 6133
5 Ga0070683_100060690 3300005329 Bacteria 3514
6 Ga0070690_100015533 3300005330 Bacteria 4545
7 Ga0070670_100001650 3300005331 Bacteria 18076
8 Ga0070670_100031245 3300005331 Bacteria 4585
9 Ga0070670_100053990 3300005331 Bacteria 3450
10 Ga0068869_100009627 3300005334 Bacteria 6276
11 Ga0068869_100088879 3300005334 Bacteria 2319
12 Ga0070666_10310358 3300005335 Bacteria 1124
13 Ga0070680_100001814 3300005336 Bacteria 15674
14 Ga0070680_100005670 3300005336 Bacteria 9467
15 Ga0070680_100018640 3300005336 Bacteria 5488
16 Ga0070660_100036658 3300005339 Bacteria 3715
17 Ga0070660_100271937 3300005339 Bacteria 1385
18 Ga0070689_100063741 3300005340 Bacteria 2868
19 Ga0070687_100013528 3300005343 Bacteria 3639
20 Ga0070661_100001319 3300005344 Bacteria 17390
21 Ga0070661_100019490 3300005344 Bacteria 4835
22 Ga0070692_10018193 3300005345 Bacteria 3374
23 Ga0070668_100002269 3300005347 Bacteria 14171
24 Ga0070669_100226535 3300005353 Bacteria 1480
25 Ga0070669_100465358 3300005353 Bacteria 1044
26 Ga0070675_100005882 3300005354 Bacteria 9398
27 Ga0070675_100020431 3300005354 Bacteria 5284
28 Ga0070675_100037914 3300005354 Bacteria 3927
29 Ga0070673_100102751 3300005364 Bacteria 2357
30 Ga0070673_100131543 3300005364 Bacteria 2100
31 Ga0070673_100319683 3300005364 Bacteria 1371
32 Ga0070688_100267283 3300005365 Bacteria 1224
33 Ga0070659_100000532 3300005366 Bacteria 27819
34 Ga0070659_100509167 3300005366 Bacteria 1027
35 Ga0070709_10008058 3300005434 Bacteria 5781
36 Ga0070709_10020564 3300005434 Bacteria 3831
37 Ga0070709_10044221 3300005434 Bacteria 2757
38 Ga0070714_100004573 3300005435 Bacteria 10435
39 Ga0070714_100080687 3300005435 Bacteria 2831
40 Ga0070713_100029419 3300005436 Bacteria 4351
41 Ga0070701_10028969 3300005438 Bacteria 2725
42 Ga0070711_100061279 3300005439 Bacteria 2619
43 Ga0070711_100163425 3300005439 Unclassified 1690
44 Ga0070705_100428114 3300005440 Bacteria 987
45 Ga0070700_100226979 3300005441 Bacteria 1327
46 Ga0070694_100331077 3300005444 Bacteria 1175
47 Ga0070708_100006258 3300005445 Bacteria 9468
48 Ga0070663_100035925 3300005455 Bacteria 3441
49 Ga0070662_100006435 3300005457 Bacteria 7571
50 Ga0070662_100094212 3300005457 Bacteria 2254
51 Ga0070662_100435160 3300005457 Bacteria 1087
52 Ga0070681_10000819 3300005458 Bacteria 25974
53 Ga0070681_10026505 3300005458 Bacteria 5825
54 Ga0070681_10067849 3300005458 Bacteria 3534
55 Ga0070706_100470751 3300005467 Bacteria 1169
56 Ga0070707_100584546 3300005468 Bacteria 1079
57 Ga0070679_100002525 3300005530 Bacteria 16589
58 Ga0070679_100007716 3300005530 Bacteria 10073
59 Ga0070679_100020637 3300005530 Bacteria 6425
60 Ga0070679_100064265 3300005530 Bacteria 3657
61 Ga0070684_100008062 3300005535 Bacteria 8222
62 Ga0070684_100018236 3300005535 Bacteria 5778
63 Ga0070684_100060720 3300005535 Unclassified 3307
64 Ga0068853_100012429 3300005539 Bacteria 6926
65 Ga0068853_100039330 3300005539 Bacteria 4034
66 Ga0070672_100006283 3300005543 Bacteria 7963
67 Ga0070672_100550351 3300005543 Bacteria 1002
68 Ga0070686_100156746 3300005544 Bacteria 1600
69 Ga0070695_100008276 3300005545 Bacteria 6171
70 Ga0070693_100002220 3300005547 Bacteria 8922
71 Ga0070665_100047322 3300005548 Bacteria 4317
72 Ga0070665_100609673 3300005548 Bacteria 1105
73 Ga0070704_100169931 3300005549 Bacteria 1733
74 Ga0068855_100030717 3300005563 Bacteria 6423
75 Ga0070664_100029192 3300005564 Bacteria 4597
76 Ga0070664_100042841 3300005564 Bacteria 3820
77 Ga0068857_100020260 3300005577 Bacteria 5848
78 Ga0068856_100055426 3300005614 Bacteria 3912
79 Ga0070702_100001543 3300005615 Bacteria 9487
80 Ga0068852_100021435 3300005616 Bacteria 5159
81 Ga0068852_100034294 3300005616 Bacteria 4221
82 Ga0068859_100015968 3300005617 Bacteria 7547
83 Ga0068859_100829683 3300005617 Bacteria 1011
84 Ga0068864_100006225 3300005618 Bacteria 9790
85 Ga0068864_100213468 3300005618 Bacteria 1778
86 Ga0068866_10015781 3300005718 Bacteria 3363
87 Ga0068851_10081467 3300005834 Bacteria 1691
88 Ga0068863_100005505 3300005841 Bacteria 12455
89 Ga0068863_100028580 3300005841 Bacteria 5324
90 Ga0068863_100366062 3300005841 Bacteria 1406
91 Ga0068860_100042478 3300005843 Bacteria 4341
92 Ga0068862_100608712 3300005844 Bacteria 1050
93 Ga0070717_10269828 3300006028 Bacteria 1507
94 Ga0075364_10090435 3300006051 Bacteria 2031
95 Ga0070712_100194341 3300006175 Bacteria 1590
96 Ga0070712_100484436 3300006175 Bacteria 1035
97 Ga0097621_100483201 3300006237 Bacteria 1120
98 Ga0097621_100656077 3300006237 Bacteria 963
99 Ga0068871_100009259 3300006358 Bacteria 7124
100 Ga0075428_100004241 3300006844 Bacteria 15786
101 Ga0075428_100072652 3300006844 Bacteria 3758
102 Ga0075428_100276023 3300006844 Bacteria 1808
103 Ga0075430_100104184 3300006846 Bacteria 2368
104 Ga0075430_100313382 3300006846 Unclassified 1297
105 Ga0075431_100102002 3300006847 Bacteria 2961
106 Ga0075434_100020579 3300006871 Bacteria 6402
107 Ga0075434_100056264 3300006871 Bacteria 3909
108 Ga0075429_100025844 3300006880 Bacteria 5098
109 Ga0075429_100128412 3300006880 Bacteria 2217
110 Ga0075429_100590970 3300006880 Bacteria 973
111 Ga0097620_100015967 3300006931 Bacteria 7547
112 Ga0097620_100336118 3300006931 Bacteria 1605
113 Ga0097620_100829908 3300006931 Bacteria 1011
114 Ga0075435_100054645 3300007076 Bacteria 3223
115 Ga0111539_10008550 3300009094 Bacteria 13001
116 Ga0111539_10026257 3300009094 Bacteria 7124
117 Ga0111539_10061351 3300009094 Bacteria 4455
118 Ga0111539_10122237 3300009094 Bacteria 3051
119 Ga0111539_10130866 3300009094 Bacteria 2938
120 Ga0111539_10197508 3300009094 Bacteria 2346
121 Ga0111539_10243779 3300009094 Bacteria 2092
122 Ga0111539_10415285 3300009094 Bacteria 1567
123 Ga0105245_10004115 3300009098 Bacteria 12914
124 Ga0105245_10425272 3300009098 Bacteria 1332
125 Ga0105247_10303843 3300009101 Bacteria 1108
126 Ga0114129_10000345 3300009147 Bacteria 54161
127 Ga0114129_10119344 3300009147 Bacteria 3632
128 Ga0105243_10116455 3300009148 Bacteria 2245
129 Ga0105243_10622471 3300009148 Bacteria 1042
130 Ga0105241_10003107 3300009174 Bacteria 12355
131 Ga0105241_10284936 3300009174 Bacteria 1412
132 Ga0105242_10107145 3300009176 Bacteria 2377
133 Ga0105242_10120779 3300009176 Bacteria 2248
134 Ga0105242_10182381 3300009176 Bacteria 1853
135 Ga0105242_10609399 3300009176 Unclassified 1056
136 Ga0105248_10010954 3300009177 Bacteria 10004
137 Ga0105248_10027465 3300009177 Bacteria 6337
138 Ga0105248_10076479 3300009177 Bacteria 3763
139 Ga0105248_10282476 3300009177 Unclassified 1869
140 Ga0105248_10490717 3300009177 Bacteria 1384
141 Ga0105248_10786310 3300009177 Bacteria 1074
142 Ga0105237_10585767 3300009545 Bacteria 1122
143 Ga0105249_10110892 3300009553 Bacteria 2593
144 Ga0105249_10116961 3300009553 Bacteria 2528
145 Ga0105249_10457263 3300009553 Bacteria 1316
146 Ga0105239_10011140 3300010375 Bacteria 10038
147 Ga0105246_10002032 3300011119 Bacteria 12209
148 Ga0157373_10036728 3300013100 Bacteria 3514
149 Ga0157371_10009911 3300013102 Bacteria 7461
150 Ga0157369_10060242 3300013105 Bacteria 4093
151 Ga0157374_10168991 3300013296 Bacteria 2132
152 Ga0157374_10511107 3300013296 Bacteria 1206
153 Ga0157378_10437421 3300013297 Bacteria 1296
154 Ga0157378_10471441 3300013297 Bacteria 1249
155 Ga0157378_10983061 3300013297 Unclassified 878
156 Ga0163162_10202122 3300013306 Unclassified 2116
157 Ga0157372_10015346 3300013307 Bacteria 8210
158 Ga0157372_10024972 3300013307 Bacteria 6494
159 Ga0157372_10036334 3300013307 Bacteria 5429
160 Ga0157375_10019685 3300013308 Bacteria 6146
161 Ga0157375_10055474 3300013308 Bacteria 3907
162 Ga0157375_10119391 3300013308 Unclassified 2744
163 Ga0157375_10665427 3300013308 Bacteria 1197
164 Ga0163163_10084608 3300014325 Bacteria 3178
165 Ga0163163_10118131 3300014325 Bacteria 2684
166 Ga0157380_10234596 3300014326 Bacteria 1650
167 Ga0157380_10297905 3300014326 Bacteria 1484
168 Ga0157376_10110752 3300014969 Bacteria 2416
169 Ga0157376_10306082 3300014969 Bacteria 1506
170 Ga0157376_10635181 3300014969 Bacteria 1066
171 Ga0157376_11066725 3300014969 Unclassified 833
172 Ga0163161_10091237 3300017792 Bacteria 2254
173 Ga0207697_10003786 3300025315 Bacteria 7386
174 Ga0207697_10064663 3300025315 Bacteria 1526
175 Ga0207656_10016723 3300025321 Bacteria 2859
176 Ga0207647_10032004 3300025904 Bacteria 3382
177 Ga0207647_10184797 3300025904 Bacteria 1209
178 Ga0207699_10046728 3300025906 Bacteria 2534
179 Ga0207699_10154352 3300025906 Bacteria 1522
180 Ga0207699_10247634 3300025906 Bacteria 1227
181 Ga0207645_10000743 3300025907 Bacteria 27133
182 Ga0207643_10002926 3300025908 Bacteria 9214
183 Ga0207654_10004779 3300025911 Bacteria 6865
184 Ga0207707_10007471 3300025912 Bacteria 9520
185 Ga0207707_10008627 3300025912 Bacteria 8841
186 Ga0207707_10020376 3300025912 Bacteria 5790
187 Ga0207693_10027510 3300025915 Bacteria 4495
188 Ga0207693_10195177 3300025915 Bacteria 1593
189 Ga0207663_10040770 3300025916 Bacteria 2825
190 Ga0207660_10013166 3300025917 Bacteria 5416
191 Ga0207660_10036382 3300025917 Bacteria 3422
192 Ga0207662_10018613 3300025918 Bacteria 3946
193 Ga0207662_10023082 3300025918 Bacteria 3571
194 Ga0207662_10043358 3300025918 Bacteria 2654
195 Ga0207657_10009927 3300025919 Bacteria 9528
196 Ga0207657_10233016 3300025919 Bacteria 1472
197 Ga0207649_10002404 3300025920 Bacteria 10493
198 Ga0207649_10035374 3300025920 Bacteria 3001
199 Ga0207649_10213735 3300025920 Bacteria 1370
200 Ga0207652_10002461 3300025921 Bacteria 15606
201 Ga0207652_10005599 3300025921 Bacteria 10187
202 Ga0207652_10071033 3300025921 Unclassified 3024
203 Ga0207681_10035543 3300025923 Bacteria 3283
204 Ga0207681_10175893 3300025923 Bacteria 1626
205 Ga0207650_10020084 3300025925 Bacteria 4706
206 Ga0207650_10026034 3300025925 Bacteria 4170
207 Ga0207659_10012591 3300025926 Bacteria 5388
208 Ga0207659_10104685 3300025926 Bacteria 2140
209 Ga0207687_10004340 3300025927 Bacteria 9464
210 Ga0207687_10074791 3300025927 Bacteria 2429
211 Ga0207687_10411084 3300025927 Unclassified 1115
212 Ga0207700_10031748 3300025928 Bacteria 3756
213 Ga0207664_10017657 3300025929 Bacteria 5236
214 Ga0207664_10069390 3300025929 Bacteria 2834
215 Ga0207644_10172938 3300025931 Bacteria 1688
216 Ga0207644_10315534 3300025931 Bacteria 1263
217 Ga0207690_10018912 3300025932 Bacteria 4230
218 Ga0207706_10005526 3300025933 Bacteria 11787
219 Ga0207706_10082350 3300025933 Bacteria 2828
220 Ga0207706_10166751 3300025933 Bacteria 1936
221 Ga0207686_10018112 3300025934 Bacteria 3981
222 Ga0207686_10061493 3300025934 Bacteria 2381
223 Ga0207670_10031986 3300025936 Bacteria 3378
224 Ga0207670_10082559 3300025936 Bacteria 2252
225 Ga0207670_10571756 3300025936 Bacteria 925
226 Ga0207669_10542307 3300025937 Bacteria 937
227 Ga0207704_10168266 3300025938 Bacteria 1568
228 Ga0207704_10271291 3300025938 Bacteria 1285
229 Ga0207691_10003473 3300025940 Bacteria 15345
230 Ga0207691_10032979 3300025940 Bacteria 4825
231 Ga0207691_10384310 3300025940 Bacteria 1198
232 Ga0207711_10100239 3300025941 Bacteria 2562
233 Ga0207711_10555087 3300025941 Bacteria 1071
234 Ga0207711_10581978 3300025941 Bacteria 1044
235 Ga0207711_10618183 3300025941 Bacteria 1011
236 Ga0207711_10626865 3300025941 Unclassified 1003
237 Ga0207689_10002837 3300025942 Bacteria 15987
238 Ga0207689_10013071 3300025942 Bacteria 7089
239 Ga0207661_10003435 3300025944 Bacteria 10995
240 Ga0207661_10059145 3300025944 Unclassified 3087
241 Ga0207661_10064608 3300025944 Bacteria 2967
242 Ga0207679_10002036 3300025945 Bacteria 12538
243 Ga0207679_10010812 3300025945 Bacteria 5884
244 Ga0207679_10050886 3300025945 Bacteria 3030
245 Ga0207667_10056872 3300025949 Bacteria 4107
246 Ga0207651_10063322 3300025960 Bacteria 2582
247 Ga0207651_10160502 3300025960 Bacteria 1762
248 Ga0207651_10329324 3300025960 Bacteria 1279
249 Ga0207712_10047278 3300025961 Bacteria 2987
250 Ga0207658_10375390 3300025986 Bacteria 1244
251 Ga0207703_10048254 3300026035 Bacteria 3436
252 Ga0207703_10276203 3300026035 Bacteria 1524
253 Ga0207639_10063809 3300026041 Bacteria 2854
254 Ga0207639_10083997 3300026041 Bacteria 2528
255 Ga0207678_10037004 3300026067 Bacteria 4248
256 Ga0207708_10008801 3300026075 Bacteria 7471
257 Ga0207702_10044518 3300026078 Bacteria 3731
258 Ga0207641_10232047 3300026088 Bacteria 1716
259 Ga0207641_10260452 3300026088 Bacteria 1623
260 Ga0207676_10032642 3300026095 Bacteria 3925
261 Ga0207676_10262256 3300026095 Bacteria 1561
262 Ga0207676_10444220 3300026095 Bacteria 1221
263 Ga0207674_10003606 3300026116 Bacteria 18875
264 Ga0207674_10024587 3300026116 Bacteria 6434
265 Ga0207675_100001439 3300026118 Bacteria 23863
266 Ga0207683_10306758 3300026121 Bacteria 1453
267 Ga0207698_10043527 3300026142 Bacteria 3364
268 Ga0207428_10000574 3300027907 Bacteria 43446
269 Ga0207428_10065156 3300027907 Bacteria 2875
270 Ga0268266_10405933 3300028379 Bacteria 1289
271 Ga0268265_10005691 3300028380 Bacteria 8512
272 Ga0268265_10391470 3300028380 Bacteria 1282
273 Ga0268264_10390736 3300028381 Bacteria 1334
274 Ga0316579_10166988 3300031691 Unclassified 1064
275 Ga0316576_10160063 3300031727 Bacteria 1698
276 Ga0316578_10002935 3300031728 Bacteria 7656
277 Ga0316577_10016926 3300031733 Bacteria 4023
278 Ga0307410_10151672 3300031852 Bacteria 1726
279 Ga0307409_100530370 3300031995 Unclassified 1152
280 Ga0307414_10262459 3300032004 Unclassified 1442
281 Ga0307415_100149279 3300032126 Bacteria 1797
282 Ga0373958_0025622 3300034819 Bacteria 1124
283 Ga0373926_0062334 3300035083 Bacteria 1361
284 Ga0373926_0123571 3300035083 Bacteria 977
285 Ga0373934_0000484 3300035086 Bacteria 13941
286 Ga0373923_0001441 3300035111 Bacteria 6824
287 Ga0373936_0115892 3300035113 Unclassified 1141
288 Ga0373945_0037224 3300035116 Unclassified 1746
289 Ga0373953_0014576 3300035117 Unclassified 2831
290 Ga0373956_0001127 3300035119 Bacteria 11025
291 Ga0373943_0032352 3300035170 Unclassified 2486
292 Ga0373943_0183731 3300035170 Bacteria 1150
293 Ga0373946_0097899 3300035171 Unclassified 1310
294 Ga0373955_0011417 3300035172 Bacteria 4233
295 Ga0373961_0089328 3300035241 Unclassified 982
296 Ga0316574_0057632 3300035398 Bacteria 2433
297 Ga0373935_0017388 3300035692 Unclassified 4362
298 Ga0373927_0029049 3300035695 Unclassified 3604
299 Ga0373927_0287697 3300035695 Bacteria 1081
300 Ga0373933_0000677 3300035724 Bacteria 21015
301 Ga0373947_0086469 3300035725 Unclassified 1949
302 Ga0373947_0210708 3300035725 Unclassified 1274
303 Ga0373937_0003072 3300036401 Bacteria 13961
304 Ga0316582_0038060 3300036647 Bacteria 2987
305 Ga0316584_0010556 3300036712 Bacteria 6460
306 Ga0373925_0008064 3300037068 Bacteria 7671
307 Ga0436365_0765662 3300039437 Bacteria 2155
308 Ga0439453_0044494 3300041408 Unclassified 880
309 Ga0439446_0006957 3300042156 Bacteria 2963
310 Ga0439435_0125155 3300042436 Unclassified 808
311 Ga0466957_0262959 3300044842 Bacteria 1150
312 Ga0451576_0143936 3300045051 Bacteria 2486
313 Ga0451576_0323531 3300045051 Bacteria 1614
314 Ga0495592_0003976 3300046454 Bacteria 10716
315 Ga0495603_0268074 3300046455 Bacteria 982
316 Ga0495651_0001692 3300046462 Bacteria 17049
317 Ga0495653_0011129 3300046463 Bacteria 7357
318 Ga0495580_0013022 3300046472 Bacteria 6367
319 Ga0495580_0301088 3300046472 Bacteria 1092
320 Ga0495582_0001806 3300046473 Bacteria 12100
321 Ga0495639_0017175 3300046475 Bacteria 3143
322 Ga0495664_0079766 3300046477 Unclassified 1962
323 Ga0495594_0031710 3300046499 Bacteria 2866
324 Ga0495608_0000808 3300046511 Bacteria 21978
325 Ga0495618_0040847 3300046514 Unclassified 2921
326 Ga0495628_0001564 3300046516 Bacteria 20953
327 Ga0495628_0148377 3300046516 Bacteria 1787
328 Ga0495630_0003633 3300046517 Bacteria 10753
329 Ga0495630_0013708 3300046517 Bacteria 5894
330 Ga0495666_0068765 3300046526 Unclassified 1686
331 Ga0495652_0004860 3300046529 Bacteria 12755
332 Ga0495665_0000913 3300046531 Bacteria 15561
333 Ga0495665_0066072 3300046531 Bacteria 1909
334 Ga0495640_0081828 3300046533 Unclassified 2146
335 Ga0495586_0255402 3300046535 Bacteria 1000
336 Ga0495587_0000128 3300046536 Bacteria 57292
337 Ga0495645_0001310 3300046543 Bacteria 16902
338 Ga0495635_0000302 3300046663 Bacteria 31833
339 Ga0495659_0068196 3300046664 Bacteria 1328
340 Ga0495588_0001294 3300046674 Bacteria 10716
341 Ga0495588_0206722 3300046674 Bacteria 1037
342 Ga0495657_0000670 3300046675 Bacteria 30989
343 Ga0495599_0000406 3300046678 Bacteria 24606
344 Ga0495623_0000010 3300046679 Bacteria 121464
345 Ga0495646_0003127 3300046680 Bacteria 10267
346 Ga0495658_0001785 3300046683 Bacteria 11099
347 Ga0495613_0092452 3300046689 Unclassified 2190
348 Ga0495600_0000430 3300046809 Bacteria 21493
349 Ga0495581_0000688 3300047315 Bacteria 17729
350 Ga0495581_0001787 3300047315 Bacteria 12014
351 Ga0495581_0224396 3300047315 Unclassified 1099
352 Ga0495604_0011880 3300047317 Bacteria 6924
353 Ga0495674_0002060 3300047319 Bacteria 19714
354 Ga0495672_0088202 3300047320 Bacteria 1710
355 Ga0495680_0003733 3300047322 Bacteria 14833
356 Ga0495675_0000707 3300047444 Bacteria 20824
357 Ga0495684_0000207 3300047471 Bacteria 45417
358 Ga0495684_0182101 3300047471 Unclassified 1557
359 Ga0495593_0001446 3300047673 Bacteria 13930
360 Ga0495602_0000693 3300048088 Bacteria 31634
361 Ga0495614_0084054 3300048089 Bacteria 1380
362 Ga0496101_0315597 3300048904 Unclassified 1226
363 Ga0496106_0220976 3300048909 Bacteria 1511
364 Ga0496107_0542791 3300048910 Bacteria 861
365 Ga0496108_0077297 3300048911 Bacteria 2815
366 Ga0496108_0093189 3300048911 Bacteria 2562
367 Ga0496109_0061181 3300048912 Bacteria 3442
368 Ga0496112_0022102 3300048915 Bacteria 6058
369 Ga0496112_0080269 3300048915 Bacteria 3226
370 Ga0496113_0012302 3300048916 Bacteria 5748
371 Ga0496113_0265188 3300048916 Bacteria 1372
372 Ga0501074_0345107 3300049590 Bacteria 1057
373 Ga0501075_0320384 3300049591 Unclassified 1181
374 Ga0501081_0216269 3300049743 Unclassified 1393
375 Ga0501045_0075854 3300049824 Bacteria 2477
376 nmdc:mga00v17_70962_c1 3300050491 Bacteria 2158
377 nmdc:mga05p37_12_c2 3300050507 Bacteria 54479
378 nmdc:mga05p37_83720_c1 3300050507 Bacteria 3929
379 nmdc:mga09592_115219_c1 3300050508 Bacteria 2307
380 nmdc:mga0qj67_353166_c1 3300050509 Bacteria 1188
381 nmdc:mga06r32_49497_c1 3300050510 Bacteria 4018
382 nmdc:mga06r32_81185_c1 3300050510 Bacteria 3158
383 nmdc:mga08y16_160611_c1 3300050511 Bacteria 2335
384 nmdc:mga08y16_42011_c1 3300050511 Bacteria 4789
385 nmdc:mga08y16_44430_c1 3300050511 Bacteria 4654
386 nmdc:mga08y16_492133_c1 3300050511 Unclassified 1247
387 nmdc:mga08y16_91430_c1 3300050511 Bacteria 3172
388 nmdc:mga0n895_142117_c1 3300050512 Bacteria 2429
389 nmdc:mga0n895_377276_c1 3300050512 Bacteria 1435
390 nmdc:mga0a205_62660_c1 3300050515 Bacteria 3593
391 Ga0495601_0011425 3300053077 Bacteria 5311
392 Ga0495612_0002893 3300053078 Bacteria 7117
393 Ga0495595_0010148 3300053084 Bacteria 3911
394 Ga0495619_0000323 3300053085 Bacteria 33441
395 Ga0590071_000714 3300059421 Bacteria 9403
396 Ga0590074_003939 3300059423 Bacteria 2456
397 Ga0590077_000422 3300059426 Bacteria 11851
398 Ga0105238_10540123
399 Ga0058863_10510848
400 Ga0070683_100013252
401 Ga0070683_100018755
402 Ga0070683_100060690
403 Ga0070690_100015533
404 Ga0070670_100001650
405 Ga0070670_100031245
406 Ga0070670_100053990
407 Ga0068869_100009627
408 Ga0068869_100088879
409 Ga0070666_10310358
410 Ga0070680_100001814
411 Ga0070680_100005670
412 Ga0070680_100018640
413 Ga0070660_100036658
414 Ga0070660_100271937
415 Ga0070689_100063741
416 Ga0070687_100013528
417 Ga0070661_100001319
418 Ga0070661_100019490
419 Ga0070692_10018193
420 Ga0070668_100002269
421 Ga0070669_100226535
422 Ga0070669_100465358
423 Ga0070675_100005882
424 Ga0070675_100020431
425 Ga0070675_100037914
426 Ga0070673_100102751
427 Ga0070673_100131543
428 Ga0070673_100319683
429 Ga0070688_100267283
430 Ga0070659_100000532
431 Ga0070659_100509167
432 Ga0070709_10008058
433 Ga0070709_10020564
434 Ga0070709_10044221
435 Ga0070714_100004573
436 Ga0070714_100080687
437 Ga0070713_100029419
438 Ga0070701_10028969
439 Ga0070711_100061279
440 Ga0070711_100163425
441 Ga0070705_100428114
442 Ga0070700_100226979
443 Ga0070694_100331077
444 Ga0070708_100006258
445 Ga0070663_100035925
446 Ga0070662_100006435
447 Ga0070662_100094212
448 Ga0070662_100435160
449 Ga0070681_10000819
450 Ga0070681_10026505
451 Ga0070681_10067849
452 Ga0070706_100470751
453 Ga0070707_100584546
454 Ga0070679_100002525
455 Ga0070679_100007716
456 Ga0070679_100020637
457 Ga0070679_100064265
458 Ga0070684_100008062
459 Ga0070684_100018236
460 Ga0070684_100060720
461 Ga0068853_100012429
462 Ga0068853_100039330
463 Ga0070672_100006283
464 Ga0070672_100550351
465 Ga0070686_100156746
466 Ga0070695_100008276
467 Ga0070693_100002220
468 Ga0070665_100047322
469 Ga0070665_100609673
470 Ga0070704_100169931
471 Ga0068855_100030717
472 Ga0070664_100029192
473 Ga0070664_100042841
474 Ga0068857_100020260
475 Ga0068856_100055426
476 Ga0070702_100001543
477 Ga0068852_100021435
478 Ga0068852_100034294
479 Ga0068859_100015968
480 Ga0068859_100829683
481 Ga0068864_100006225
482 Ga0068864_100213468
483 Ga0068866_10015781
484 Ga0068851_10081467
485 Ga0068863_100005505
486 Ga0068863_100028580
487 Ga0068863_100366062
488 Ga0068860_100042478
489 Ga0068862_100608712
490 Ga0070717_10269828
491 Ga0075364_10090435
492 Ga0070712_100194341
493 Ga0070712_100484436
494 Ga0097621_100483201
495 Ga0097621_100656077
496 Ga0068871_100009259
497 Ga0075428_100004241
498 Ga0075428_100072652
499 Ga0075428_100276023
500 Ga0075430_100104184
501 Ga0075430_100313382
502 Ga0075431_100102002
503 Ga0075434_100020579
504 Ga0075434_100056264
505 Ga0075429_100025844
506 Ga0075429_100128412
507 Ga0075429_100590970
508 Ga0097620_100015967
509 Ga0097620_100336118
510 Ga0097620_100829908
511 Ga0075435_100054645
512 Ga0111539_10008550
513 Ga0111539_10026257
514 Ga0111539_10061351
515 Ga0111539_10122237
516 Ga0111539_10130866
517 Ga0111539_10197508
518 Ga0111539_10243779
519 Ga0111539_10415285
520 Ga0105245_10004115
521 Ga0105245_10425272
522 Ga0105247_10303843
523 Ga0114129_10000345
524 Ga0114129_10119344
525 Ga0105243_10116455
526 Ga0105243_10622471
527 Ga0105241_10003107
528 Ga0105241_10284936
529 Ga0105242_10107145
530 Ga0105242_10120779
531 Ga0105242_10182381
532 Ga0105242_10609399
533 Ga0105248_10010954
534 Ga0105248_10027465
535 Ga0105248_10076479
536 Ga0105248_10282476
537 Ga0105248_10490717
538 Ga0105248_10786310
539 Ga0105237_10585767
540 Ga0105249_10110892
541 Ga0105249_10116961
542 Ga0105249_10457263
543 Ga0105239_10011140
544 Ga0105246_10002032
545 Ga0157373_10036728
546 Ga0157371_10009911
547 Ga0157369_10060242
548 Ga0157374_10168991
549 Ga0157374_10511107
550 Ga0157378_10437421
551 Ga0157378_10471441
552 Ga0157378_10983061
553 Ga0163162_10202122
554 Ga0157372_10015346
555 Ga0157372_10024972
556 Ga0157372_10036334
557 Ga0157375_10019685
558 Ga0157375_10055474
559 Ga0157375_10119391
560 Ga0157375_10665427
561 Ga0163163_10084608
562 Ga0163163_10118131
563 Ga0157380_10234596
564 Ga0157380_10297905
565 Ga0157376_10110752
566 Ga0157376_10306082
567 Ga0157376_10635181
568 Ga0157376_11066725
569 Ga0163161_10091237
570 Ga0207697_10003786
571 Ga0207697_10064663
572 Ga0207656_10016723
573 Ga0207647_10032004
574 Ga0207647_10184797
575 Ga0207699_10046728
576 Ga0207699_10154352
577 Ga0207699_10247634
578 Ga0207645_10000743
579 Ga0207643_10002926
580 Ga0207654_10004779
581 Ga0207707_10007471
582 Ga0207707_10008627
583 Ga0207707_10020376
584 Ga0207693_10027510
585 Ga0207693_10195177
586 Ga0207663_10040770
587 Ga0207660_10013166
588 Ga0207660_10036382
589 Ga0207662_10018613
590 Ga0207662_10023082
591 Ga0207662_10043358
592 Ga0207657_10009927
593 Ga0207657_10233016
594 Ga0207649_10002404
595 Ga0207649_10035374
596 Ga0207649_10213735
597 Ga0207652_10002461
598 Ga0207652_10005599
599 Ga0207652_10071033
600 Ga0207681_10035543
601 Ga0207681_10175893
602 Ga0207650_10020084
603 Ga0207650_10026034
604 Ga0207659_10012591
605 Ga0207659_10104685
606 Ga0207687_10004340
607 Ga0207687_10074791
608 Ga0207687_10411084
609 Ga0207700_10031748
610 Ga0207664_10017657
611 Ga0207664_10069390
612 Ga0207644_10172938
613 Ga0207644_10315534
614 Ga0207690_10018912
615 Ga0207706_10005526
616 Ga0207706_10082350
617 Ga0207706_10166751
618 Ga0207686_10018112
619 Ga0207686_10061493
620 Ga0207670_10031986
621 Ga0207670_10082559
622 Ga0207670_10571756
623 Ga0207669_10542307
624 Ga0207704_10168266
625 Ga0207704_10271291
626 Ga0207691_10003473
627 Ga0207691_10032979
628 Ga0207691_10384310
629 Ga0207711_10100239
630 Ga0207711_10555087
631 Ga0207711_10581978
632 Ga0207711_10618183
633 Ga0207711_10626865
634 Ga0207689_10002837
635 Ga0207689_10013071
636 Ga0207661_10003435
637 Ga0207661_10059145
638 Ga0207661_10064608
639 Ga0207679_10002036
640 Ga0207679_10010812
641 Ga0207679_10050886
642 Ga0207667_10056872
643 Ga0207651_10063322
644 Ga0207651_10160502
645 Ga0207651_10329324
646 Ga0207712_10047278
647 Ga0207658_10375390
648 Ga0207703_10048254
649 Ga0207703_10276203
650 Ga0207639_10063809
651 Ga0207639_10083997
652 Ga0207678_10037004
653 Ga0207708_10008801
654 Ga0207702_10044518
655 Ga0207641_10232047
656 Ga0207641_10260452
657 Ga0207676_10032642
658 Ga0207676_10262256
659 Ga0207676_10444220
660 Ga0207674_10003606
661 Ga0207674_10024587
662 Ga0207675_100001439
663 Ga0207683_10306758
664 Ga0207698_10043527
665 Ga0207428_10000574
666 Ga0207428_10065156
667 Ga0268266_10405933
668 Ga0268265_10005691
669 Ga0268265_10391470
670 Ga0268264_10390736
671 Ga0316579_10166988
672 Ga0316576_10160063
673 Ga0316578_10002935
674 Ga0316577_10016926
675 Ga0307410_10151672
676 Ga0307409_100530370
677 Ga0307414_10262459
678 Ga0307415_100149279
679 Ga0373958_0025622
680 Ga0373926_0062334
681 Ga0373926_0123571
682 Ga0373934_0000484
683 Ga0373923_0001441
684 Ga0373936_0115892
685 Ga0373945_0037224
686 Ga0373953_0014576
687 Ga0373956_0001127
688 Ga0373943_0032352
689 Ga0373943_0183731
690 Ga0373946_0097899
691 Ga0373955_0011417
692 Ga0373961_0089328
693 Ga0316574_0057632
694 Ga0373935_0017388
695 Ga0373927_0029049
696 Ga0373927_0287697
697 Ga0373933_0000677
698 Ga0373947_0086469
699 Ga0373947_0210708
700 Ga0373937_0003072
701 Ga0316582_0038060
702 Ga0316584_0010556
703 Ga0373925_0008064
704 Ga0436365_0765662
705 Ga0439453_0044494
706 Ga0439446_0006957
707 Ga0439435_0125155
708 Ga0466957_0262959
709 Ga0451576_0143936
710 Ga0451576_0323531
711 Ga0495592_0003976
712 Ga0495603_0268074
713 Ga0495651_0001692
714 Ga0495653_0011129
715 Ga0495580_0013022
716 Ga0495580_0301088
717 Ga0495582_0001806
718 Ga0495639_0017175
719 Ga0495664_0079766
720 Ga0495594_0031710
721 Ga0495608_0000808
722 Ga0495618_0040847
723 Ga0495628_0001564
724 Ga0495628_0148377
725 Ga0495630_0003633
726 Ga0495630_0013708
727 Ga0495666_0068765
728 Ga0495652_0004860
729 Ga0495665_0000913
730 Ga0495665_0066072
731 Ga0495640_0081828
732 Ga0495586_0255402
733 Ga0495587_0000128
734 Ga0495645_0001310
735 Ga0495635_0000302
736 Ga0495659_0068196
737 Ga0495588_0001294
738 Ga0495588_0206722
739 Ga0495657_0000670
740 Ga0495599_0000406
741 Ga0495623_0000010
742 Ga0495646_0003127
743 Ga0495658_0001785
744 Ga0495613_0092452
745 Ga0495600_0000430
746 Ga0495581_0000688
747 Ga0495581_0001787
748 Ga0495581_0224396
749 Ga0495604_0011880
750 Ga0495674_0002060
751 Ga0495672_0088202
752 Ga0495680_0003733
753 Ga0495675_0000707
754 Ga0495684_0000207
755 Ga0495684_0182101
756 Ga0495593_0001446
757 Ga0495602_0000693
758 Ga0495614_0084054
759 Ga0496101_0315597
760 Ga0496106_0220976
761 Ga0496107_0542791
762 Ga0496108_0077297
763 Ga0496108_0093189
764 Ga0496109_0061181
765 Ga0496112_0022102
766 Ga0496112_0080269
767 Ga0496113_0012302
768 Ga0496113_0265188
769 Ga0501074_0345107
770 Ga0501075_0320384
771 Ga0501081_0216269
772 Ga0501045_0075854
773 nmdc:mga00v17_70962_c1
774 nmdc:mga05p37_12_c2
775 nmdc:mga05p37_83720_c1
776 nmdc:mga09592_115219_c1
777 nmdc:mga0qj67_353166_c1
778 nmdc:mga06r32_49497_c1
779 nmdc:mga06r32_81185_c1
780 nmdc:mga08y16_160611_c1
781 nmdc:mga08y16_42011_c1
782 nmdc:mga08y16_44430_c1
783 nmdc:mga08y16_492133_c1
784 nmdc:mga08y16_91430_c1
785 nmdc:mga0n895_142117_c1
786 nmdc:mga0n895_377276_c1
787 nmdc:mga0a205_62660_c1
788 Ga0495601_0011425
789 Ga0495612_0002893
790 Ga0495595_0010148
791 Ga0495619_0000323
792 Ga0590071_000714
793 Ga0590074_003939
794 Ga0590077_000422

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03575

Peptidase_S51

Peptidase family S51

96

290

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uqv-assembly2.cif.gz_C pseudobacteroides cellulosolvens pseudo-cphb 0.8193 38 256
7uqv-assembly1.cif.gz_B pseudobacteroides cellulosolvens pseudo-cphb 0.8153 37 259
7uqv-assembly1.cif.gz_A pseudobacteroides cellulosolvens pseudo-cphb 0.8024 37 259
2nv0-assembly1.cif.gz_A structure of the glutaminase subunit pdx2 (yaae) of plp synthase from bacillus subtilis 0.7701 62 157
7ffp-assembly1.cif.gz_A-2 crystal structure of di-peptidase-e from xenopus laevis 0.7403 33 261
ID Description Score Start End Superfamily
af_Q4DS63_13_305_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8257 40 254 3.40.50.880
3en0C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7464 34 259 3.40.50.880
af_Q9VYH3_5_230_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7429 36 256 3.40.50.880
3l4eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7378 36 236 3.40.50.880
3l4eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7313 36 236 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A645IU68-F1-model_v4 Uncharacterized protein 0.9722 180 260 GO:0006508
GO:0008236
AF-A0A0P7KXA7-F1-model_v4 Uncharacterized protein 0.9719 185 260 GO:0006508
GO:0008236
AF-A0A327V2Z6-F1-model_v4 Uncharacterized protein 0.9578 190 262
AF-A0A849ZUR8-F1-model_v4 Peptidase E 0.9577 180 260
AF-A0A3N5NPY0-F1-model_v4 Uncharacterized protein 0.9566 177 262

Map