F433754

General Info

Members Datasets Scaffolds Average Seq Length
397 207 397 114

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_11868680|Ga0105237_118686802
Length 114
Sequence MLIFKIVHNDEWRAAEAADIYCGSAKDQADGFLHFSTEEQLIGTLTRYYADAEDLVLVAIDAESLGEALKYEPSTAGALYPHLYGDLPLSAVRWARPIARDAQGEFAPAELICR

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
150 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
199 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
200 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
201 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
202 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
203 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
204 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
205 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.03
Nodule 0
Rhizoplane 1.26
Rhizosphere 92.7
Stem 0
Stem Tuber 0
Unclassified 2.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000036 3300003214 Bacteria 286380
2 Ga0070658_10021167 3300005327 Bacteria 5209
3 Ga0070658_10029785 3300005327 Bacteria 4386
4 Ga0070658_10146680 3300005327 Bacteria 1974
5 Ga0070658_10200445 3300005327 Bacteria 1684
6 Ga0070658_10949475 3300005327 Bacteria 748
7 Ga0070676_10003084 3300005328 Bacteria 8610
8 Ga0070676_10384367 3300005328 Bacteria 973
9 Ga0070683_100599843 3300005329 Bacteria 1054
10 Ga0070683_101416309 3300005329 Bacteria 668
11 Ga0070670_100241417 3300005331 Bacteria 1573
12 Ga0070670_100452032 3300005331 Bacteria 1139
13 Ga0070670_100676746 3300005331 Bacteria 927
14 Ga0068869_101081291 3300005334 Unclassified 701
15 Ga0070666_10272560 3300005335 Bacteria 1201
16 Ga0070680_101465864 3300005336 Bacteria 591
17 Ga0068868_100215307 3300005338 Bacteria 1607
18 Ga0068868_100343582 3300005338 Bacteria 1277
19 Ga0068868_100398004 3300005338 Bacteria 1188
20 Ga0068868_100860691 3300005338 Unclassified 821
21 Ga0070660_100363174 3300005339 Bacteria 1193
22 Ga0070660_100445020 3300005339 Unclassified 1074
23 Ga0070661_100031637 3300005344 Unclassified 3827
24 Ga0070661_100393428 3300005344 Bacteria 1095
25 Ga0070661_100793586 3300005344 Bacteria 777
26 Ga0070661_101773299 3300005344 Bacteria 524
27 Ga0070675_100436320 3300005354 Bacteria 1173
28 Ga0070671_100044371 3300005355 Bacteria 3695
29 Ga0070674_100747026 3300005356 Unclassified 840
30 Ga0070673_100377196 3300005364 Bacteria 1264
31 Ga0070659_100184703 3300005366 Bacteria 1712
32 Ga0070659_100897050 3300005366 Bacteria 775
33 Ga0070667_100128112 3300005367 Bacteria 2213
34 Ga0070667_100212343 3300005367 Bacteria 1720
35 Ga0070667_101844397 3300005367 Bacteria 569
36 Ga0070714_101268128 3300005435 Unclassified 719
37 Ga0070713_100514549 3300005436 Bacteria 1130
38 Ga0070701_10319861 3300005438 Bacteria 960
39 Ga0070700_100363188 3300005441 Bacteria 1077
40 Ga0070700_100668389 3300005441 Bacteria 822
41 Ga0070678_100032733 3300005456 Bacteria 3601
42 Ga0070678_100301146 3300005456 Bacteria 1362
43 Ga0070678_101305617 3300005456 Bacteria 675
44 Ga0070678_101448009 3300005456 Unclassified 642
45 Ga0070662_101639352 3300005457 Bacteria 555
46 Ga0070681_10071861 3300005458 Bacteria 3425
47 Ga0070681_10180906 3300005458 Bacteria 2030
48 Ga0068867_100010889 3300005459 Bacteria 6415
49 Ga0068867_100032708 3300005459 Bacteria 3763
50 Ga0068867_100421118 3300005459 Unclassified 1131
51 Ga0070679_100140524 3300005530 Bacteria 2394
52 Ga0070684_100158085 3300005535 Bacteria 2055
53 Ga0068853_100621591 3300005539 Bacteria 1027
54 Ga0070695_100401458 3300005545 Bacteria 1039
55 Ga0070693_100725369 3300005547 Unclassified 730
56 Ga0070665_100000381 3300005548 Bacteria 65638
57 Ga0070665_100033021 3300005548 Bacteria 5207
58 Ga0070665_100664024 3300005548 Bacteria 1055
59 Ga0070665_101071562 3300005548 Bacteria 818
60 Ga0070665_101285112 3300005548 Bacteria 742
61 Ga0068855_100121122 3300005563 Bacteria 2994
62 Ga0068855_100343782 3300005563 Bacteria 1644
63 Ga0068855_100345044 3300005563 Bacteria 1641
64 Ga0068855_100375135 3300005563 Bacteria 1563
65 Ga0068855_100635658 3300005563 Bacteria 1148
66 Ga0068855_101901226 3300005563 Unclassified 603
67 Ga0068857_101480998 3300005577 Bacteria 661
68 Ga0068854_100388816 3300005578 Bacteria 1151
69 Ga0070702_100334935 3300005615 Unclassified 1060
70 Ga0068852_100040826 3300005616 Unclassified 3917
71 Ga0068852_100042502 3300005616 Bacteria 3847
72 Ga0068852_100398153 3300005616 Bacteria 1354
73 Ga0068859_101283600 3300005617 Unclassified 807
74 Ga0068864_100381011 3300005618 Bacteria 1337
75 Ga0068864_101759907 3300005618 Unclassified 625
76 Ga0068864_102199430 3300005618 Bacteria 558
77 Ga0068866_10033241 3300005718 Bacteria 2500
78 Ga0068861_101451318 3300005719 Bacteria 672
79 Ga0068861_102498056 3300005719 Bacteria 520
80 Ga0068870_10154771 3300005840 Bacteria 1354
81 Ga0068870_10321550 3300005840 Bacteria 983
82 Ga0068863_102316630 3300005841 Unclassified 547
83 Ga0068858_100379194 3300005842 Bacteria 1357
84 Ga0068858_100758674 3300005842 Bacteria 945
85 Ga0068860_101008722 3300005843 Bacteria 850
86 Ga0068862_100882814 3300005844 Bacteria 878
87 Ga0068862_101114841 3300005844 Bacteria 785
88 Ga0075365_10353490 3300006038 Bacteria 1036
89 Ga0097621_100000209 3300006237 Bacteria 38414
90 Ga0097621_100016590 3300006237 Bacteria 5571
91 Ga0097621_100057973 3300006237 Bacteria 3169
92 Ga0068871_100002253 3300006358 Bacteria 13111
93 Ga0068871_100063684 3300006358 Bacteria 3017
94 Ga0068871_100238310 3300006358 Bacteria 1581
95 Ga0068871_100320009 3300006358 Bacteria 1366
96 Ga0068871_100691328 3300006358 Unclassified 934
97 Ga0068865_100002773 3300006881 Bacteria 10412
98 Ga0068865_100124755 3300006881 Bacteria 1920
99 Ga0097620_101283436 3300006931 Unclassified 807
100 Ga0099795_10142862 3300007788 Bacteria 975
101 Ga0099795_10611425 3300007788 Bacteria 519
102 Ga0105240_10312373 3300009093 Bacteria 1794
103 Ga0105240_10402381 3300009093 Bacteria 1542
104 Ga0105240_10461801 3300009093 Bacteria 1419
105 Ga0105240_10643081 3300009093 Unclassified 1163
106 Ga0105240_10785161 3300009093 Bacteria 1033
107 Ga0105240_10840821 3300009093 Bacteria 991
108 Ga0105240_11288063 3300009093 Bacteria 771
109 Ga0105245_10239856 3300009098 Bacteria 1757
110 Ga0105245_10603148 3300009098 Bacteria 1125
111 Ga0105245_11737248 3300009098 Bacteria 676
112 Ga0105243_10020198 3300009148 Bacteria 5051
113 Ga0105243_12432326 3300009148 Bacteria 562
114 Ga0105241_10250600 3300009174 Unclassified 1501
115 Ga0105241_10395436 3300009174 Bacteria 1211
116 Ga0105241_10467314 3300009174 Bacteria 1119
117 Ga0105241_10663065 3300009174 Bacteria 949
118 Ga0105242_10012177 3300009176 Bacteria 6617
119 Ga0105242_10019567 3300009176 Bacteria 5307
120 Ga0105242_10023524 3300009176 Bacteria 4855
121 Ga0105242_10083778 3300009176 Bacteria 2671
122 Ga0105242_10332781 3300009176 Bacteria 1397
123 Ga0105248_10000005 3300009177 Bacteria 673111
124 Ga0105248_11252641 3300009177 Unclassified 839
125 Ga0105248_13154656 3300009177 Unclassified 525
126 Ga0105237_10121075 3300009545 Bacteria 2612
127 Ga0105237_10940034 3300009545 Bacteria 871
128 Ga0105237_11868680 3300009545 Unclassified 608
129 Ga0105237_12640457 3300009545 Unclassified 513
130 Ga0105238_10090833 3300009551 Bacteria 3041
131 Ga0105238_10099827 3300009551 Unclassified 2886
132 Ga0105238_10407488 3300009551 Bacteria 1353
133 Ga0105238_11555664 3300009551 Bacteria 691
134 Ga0105238_11755710 3300009551 Bacteria 652
135 Ga0105238_12193502 3300009551 Bacteria 587
136 Ga0105249_11426422 3300009553 Bacteria 764
137 Ga0105147_106867 3300009982 Bacteria 963
138 Ga0099796_10006309 3300010159 Bacteria 3026
139 Ga0099796_10319760 3300010159 Bacteria 662
140 Ga0105239_10144837 3300010375 Bacteria 2649
141 Ga0105239_10348491 3300010375 Bacteria 1672
142 Ga0105239_10428406 3300010375 Bacteria 1499
143 Ga0105239_10698569 3300010375 Bacteria 1160
144 Ga0105246_10007171 3300011119 Bacteria 6829
145 Ga0157370_10285470 3300013104 Unclassified 1525
146 Ga0157370_10478090 3300013104 Bacteria 1145
147 Ga0157369_10009212 3300013105 Bacteria 11296
148 Ga0157369_10114533 3300013105 Bacteria 2863
149 Ga0157374_10022605 3300013296 Bacteria 5610
150 Ga0157374_10444207 3300013296 Bacteria 1298
151 Ga0157378_10148084 3300013297 Unclassified 2185
152 Ga0157378_10431040 3300013297 Bacteria 1305
153 Ga0157378_11430909 3300013297 Bacteria 735
154 Ga0163162_10037764 3300013306 Bacteria 4820
155 Ga0163162_10062534 3300013306 Bacteria 3763
156 Ga0163162_10107516 3300013306 Bacteria 2885
157 Ga0163162_12052858 3300013306 Bacteria 655
158 Ga0157375_10237407 3300013308 Bacteria 1982
159 Ga0157375_12148781 3300013308 Bacteria 665
160 Ga0157375_12769485 3300013308 Bacteria 586
161 Ga0163163_10000015 3300014325 Bacteria 214881
162 Ga0163163_10212669 3300014325 Bacteria 1983
163 Ga0157380_10142171 3300014326 Bacteria 2063
164 Ga0157380_11831357 3300014326 Bacteria 666
165 Ga0157379_10000349 3300014968 Bacteria 37189
166 Ga0157379_10044600 3300014968 Bacteria 3958
167 Ga0157379_10883687 3300014968 Bacteria 847
168 Ga0157376_10007081 3300014969 Bacteria 7964
169 Ga0157376_10313541 3300014969 Bacteria 1489
170 Ga0157376_10551929 3300014969 Bacteria 1140
171 Ga0157376_12840970 3300014969 Unclassified 524
172 Ga0163161_10009672 3300017792 Bacteria 6671
173 Ga0213876_10029834 3300021384 Unclassified 2874
174 Ga0213876_10220719 3300021384 Bacteria 1008
175 Ga0207427_108078 3300025231 Bacteria 1193
176 Ga0209233_1000015 3300025261 Bacteria 980563
177 Ga0209233_1008503 3300025261 Bacteria 3173
178 Ga0207642_10003420 3300025899 Bacteria 5009
179 Ga0207688_10121855 3300025901 Bacteria 1522
180 Ga0207680_10463481 3300025903 Bacteria 900
181 Ga0207645_10064758 3300025907 Bacteria 2335
182 Ga0207645_10413303 3300025907 Bacteria 908
183 Ga0207705_10034376 3300025909 Unclassified 3624
184 Ga0207705_10177225 3300025909 Bacteria 1607
185 Ga0207705_10419110 3300025909 Bacteria 1036
186 Ga0207705_11203936 3300025909 Bacteria 581
187 Ga0207654_10154382 3300025911 Bacteria 1477
188 Ga0207654_10165173 3300025911 Bacteria 1433
189 Ga0207654_10578295 3300025911 Bacteria 800
190 Ga0207654_10919541 3300025911 Bacteria 635
191 Ga0207707_10205821 3300025912 Bacteria 1715
192 Ga0207707_10209264 3300025912 Bacteria 1699
193 Ga0207695_10274394 3300025913 Bacteria 1581
194 Ga0207695_10523346 3300025913 Bacteria 1068
195 Ga0207660_11345279 3300025917 Unclassified 579
196 Ga0207657_10242423 3300025919 Bacteria 1439
197 Ga0207657_10706212 3300025919 Unclassified 783
198 Ga0207649_10715110 3300025920 Bacteria 777
199 Ga0207652_10471973 3300025921 Bacteria 1130
200 Ga0207652_10621724 3300025921 Unclassified 967
201 Ga0207652_10938803 3300025921 Bacteria 763
202 Ga0207652_11194068 3300025921 Bacteria 662
203 Ga0207681_10261098 3300025923 Bacteria 1356
204 Ga0207694_10064968 3300025924 Bacteria 2845
205 Ga0207694_10119933 3300025924 Unclassified 2099
206 Ga0207694_11513857 3300025924 Bacteria 566
207 Ga0207650_10296786 3300025925 Bacteria 1319
208 Ga0207650_10365735 3300025925 Bacteria 1189
209 Ga0207659_11327306 3300025926 Unclassified 617
210 Ga0207687_10114495 3300025927 Bacteria 2007
211 Ga0207687_10961529 3300025927 Bacteria 732
212 Ga0207687_11116009 3300025927 Bacteria 677
213 Ga0207700_10597143 3300025928 Bacteria 982
214 Ga0207700_11440886 3300025928 Bacteria 612
215 Ga0207664_11465308 3300025929 Bacteria 604
216 Ga0207644_10042012 3300025931 Bacteria 3238
217 Ga0207690_10808056 3300025932 Unclassified 775
218 Ga0207706_10268703 3300025933 Bacteria 1488
219 Ga0207686_10036832 3300025934 Unclassified 2949
220 Ga0207686_10247084 3300025934 Bacteria 1301
221 Ga0207686_11512848 3300025934 Unclassified 553
222 Ga0207709_10018456 3300025935 Bacteria 3908
223 Ga0207669_10728498 3300025937 Unclassified 817
224 Ga0207669_10737597 3300025937 Bacteria 812
225 Ga0207704_10003862 3300025938 Bacteria 6807
226 Ga0207704_10236592 3300025938 Bacteria 1362
227 Ga0207691_11278203 3300025940 Bacteria 606
228 Ga0207711_10000002 3300025941 Bacteria 1228676
229 Ga0207711_10407365 3300025941 Bacteria 1264
230 Ga0207711_11380294 3300025941 Unclassified 647
231 Ga0207689_10156513 3300025942 Bacteria 1878
232 Ga0207689_10780986 3300025942 Unclassified 806
233 Ga0207661_10043243 3300025944 Bacteria 3555
234 Ga0207661_10966047 3300025944 Unclassified 785
235 Ga0207661_11184012 3300025944 Bacteria 703
236 Ga0207667_10050836 3300025949 Bacteria 4372
237 Ga0207667_10329461 3300025949 Bacteria 1559
238 Ga0207667_10694713 3300025949 Bacteria 1020
239 Ga0207667_10869591 3300025949 Bacteria 895
240 Ga0207667_11377282 3300025949 Bacteria 679
241 Ga0207651_10009917 3300025960 Bacteria 5245
242 Ga0207712_10294212 3300025961 Bacteria 1330
243 Ga0207712_12095568 3300025961 Unclassified 506
244 Ga0207640_10291874 3300025981 Bacteria 1286
245 Ga0207658_10079228 3300025986 Bacteria 2512
246 Ga0207658_10120620 3300025986 Bacteria 2090
247 Ga0207658_11890317 3300025986 Unclassified 544
248 Ga0207677_10140027 3300026023 Bacteria 1851
249 Ga0207677_10236896 3300026023 Bacteria 1474
250 Ga0207677_10263290 3300026023 Bacteria 1406
251 Ga0207703_10302862 3300026035 Bacteria 1458
252 Ga0207639_11068843 3300026041 Bacteria 756
253 Ga0207639_11490361 3300026041 Bacteria 635
254 Ga0207708_10412714 3300026075 Bacteria 1118
255 Ga0207702_10253042 3300026078 Bacteria 1655
256 Ga0207702_10982972 3300026078 Bacteria 837
257 Ga0207702_11546443 3300026078 Bacteria 657
258 Ga0207648_10007588 3300026089 Bacteria 10640
259 Ga0207648_10020227 3300026089 Bacteria 5999
260 Ga0207648_10295581 3300026089 Bacteria 1451
261 Ga0207676_10165016 3300026095 Bacteria 1923
262 Ga0207674_10797054 3300026116 Bacteria 912
263 Ga0207674_11051231 3300026116 Unclassified 783
264 Ga0207674_11277308 3300026116 Bacteria 704
265 Ga0207675_101752893 3300026118 Bacteria 640
266 Ga0207683_10047876 3300026121 Bacteria 3744
267 Ga0207683_10165517 3300026121 Bacteria 2001
268 Ga0207683_10465516 3300026121 Bacteria 1166
269 Ga0207698_10056440 3300026142 Bacteria 3033
270 Ga0207698_10326233 3300026142 Bacteria 1440
271 Ga0207698_10628723 3300026142 Bacteria 1061
272 Ga0268266_10000900 3300028379 Bacteria 38445
273 Ga0268266_10041761 3300028379 Bacteria 3915
274 Ga0268266_10049573 3300028379 Bacteria 3601
275 Ga0268266_10779326 3300028379 Bacteria 923
276 Ga0268266_11111522 3300028379 Bacteria 765
277 Ga0268266_11163524 3300028379 Bacteria 746
278 Ga0268265_11833286 3300028380 Bacteria 613
279 Ga0268264_10308087 3300028381 Bacteria 1493
280 Ga0268264_10566888 3300028381 Bacteria 1116
281 Ga0265338_10007775 3300028800 Bacteria 13191
282 Ga0265330_10109472 3300031235 Bacteria 1181
283 Ga0265320_10152875 3300031240 Unclassified 1042
284 Ga0265325_10000950 3300031241 Bacteria 20939
285 Ga0265329_10083551 3300031242 Bacteria 1011
286 Ga0265340_10336219 3300031247 Bacteria 668
287 Ga0265339_10001402 3300031249 Bacteria 17911
288 Ga0265331_10072446 3300031250 Bacteria 1610
289 Ga0265331_10087118 3300031250 Bacteria 1446
290 Ga0265316_10060892 3300031344 Bacteria 2933
291 Ga0265316_10260692 3300031344 Bacteria 1271
292 Ga0265313_10000672 3300031595 Bacteria 35190
293 Ga0265313_10033278 3300031595 Bacteria 2622
294 Ga0265313_10404694 3300031595 Bacteria 535
295 Ga0265314_10259050 3300031711 Bacteria 994
296 Ga0265314_10481165 3300031711 Bacteria 656
297 Ga0265342_10636578 3300031712 Bacteria 536
298 Ga0307516_10046235 3300031730 Bacteria 4296
299 Ga0307516_10064348 3300031730 Bacteria 3547
300 Ga0373950_0015636 3300034818 Bacteria 1289
301 Ga0373926_0373925 3300035083 Bacteria 561
302 Ga0373936_0098088 3300035113 Bacteria 1234
303 Ga0373927_0015623 3300035695 Bacteria 5014
304 Ga0373947_0357764 3300035725 Bacteria 980
305 Ga0395898_0045842 3300037466 Bacteria 4296
306 Ga0395901_0079597 3300038443 Bacteria 3422
307 Ga0395901_1515765 3300038443 Unclassified 626
308 Ga0436365_1000935 3300039437 Bacteria 517
309 Ga0436365_1627614 3300039437 Bacteria 14353
310 Ga0451793_0490877 3300041452 Bacteria 1902
311 Ga0451802_0323929 3300041460 Bacteria 861
312 Ga0466957_0844063 3300044842 Bacteria 652
313 Ga0466959_0096241 3300045049 Bacteria 2123
314 Ga0495651_0171288 3300046462 Bacteria 1546
315 Ga0495653_0407502 3300046463 Bacteria 863
316 Ga0495585_0076239 3300046492 Bacteria 1822
317 Ga0495606_0226478 3300046507 Bacteria 1050
318 Ga0495618_0137327 3300046514 Bacteria 1564
319 Ga0495630_1166592 3300046517 Unclassified 583
320 Ga0495648_0337206 3300046524 Unclassified 693
321 Ga0495652_0051025 3300046529 Bacteria 3535
322 Ga0495652_1008398 3300046529 Bacteria 544
323 Ga0495587_0183746 3300046536 Bacteria 1185
324 Ga0495609_0122417 3300046538 Bacteria 1117
325 Ga0495622_0082770 3300046557 Bacteria 1476
326 Ga0495633_0367838 3300046558 Unclassified 651
327 Ga0495624_0424757 3300046690 Bacteria 797
328 Ga0495674_0163232 3300047319 Bacteria 1863
329 Ga0495672_0072397 3300047320 Bacteria 1947
330 Ga0495672_0425440 3300047320 Unclassified 603
331 Ga0495675_0753978 3300047444 Bacteria 542
332 Ga0495673_0108296 3300047469 Bacteria 1114
333 Ga0495593_0385979 3300047673 Bacteria 700
334 Ga0495602_0101444 3300048088 Bacteria 2361
335 Ga0496102_1675606 3300048905 Unclassified 554
336 Ga0496112_1924572 3300048915 Unclassified 503
337 Ga0496115_0308015 3300048918 Bacteria 1297
338 Ga0496126_0209208 3300048929 Bacteria 1643
339 Ga0496126_0588517 3300048929 Bacteria 878
340 Ga0501031_0626811 3300049568 Bacteria 691
341 Ga0501033_0076484 3300049570 Bacteria 2457
342 Ga0501033_0212833 3300049570 Bacteria 1378
343 Ga0501033_0232239 3300049570 Unclassified 1310
344 Ga0501033_0329517 3300049570 Bacteria 1071
345 Ga0501033_0361535 3300049570 Bacteria 1016
346 Ga0501034_0285358 3300049571 Bacteria 1590
347 Ga0501034_0288979 3300049571 Bacteria 1578
348 Ga0501034_0496111 3300049571 Bacteria 1135
349 Ga0501037_0413095 3300049573 Bacteria 924
350 Ga0501038_0304092 3300049574 Bacteria 1251
351 Ga0501043_0044360 3300049579 Bacteria 3496
352 Ga0501043_0290205 3300049579 Bacteria 1252
353 Ga0501043_1079916 3300049579 Bacteria 568
354 Ga0501047_0009625 3300049581 Bacteria 9138
355 Ga0501047_0045014 3300049581 Bacteria 4266
356 Ga0501047_0178906 3300049581 Bacteria 1988
357 Ga0501047_0253318 3300049581 Bacteria 1609
358 Ga0501047_0358612 3300049581 Bacteria 1294
359 Ga0501047_0585756 3300049581 Bacteria 938
360 Ga0501048_0397474 3300049582 Bacteria 985
361 Ga0501048_1085036 3300049582 Bacteria 576
362 Ga0501070_0464053 3300049586 Bacteria 1020
363 Ga0501073_0008918 3300049589 Bacteria 7410
364 Ga0501073_0144472 3300049589 Bacteria 1649
365 Ga0501073_0189525 3300049589 Bacteria 1423
366 Ga0501073_0222758 3300049589 Bacteria 1303
367 Ga0501073_0265158 3300049589 Unclassified 1185
368 Ga0501074_0334558 3300049590 Unclassified 1075
369 Ga0501080_0127007 3300049742 Bacteria 2362
370 Ga0501080_0378438 3300049742 Bacteria 1276
371 Ga0501083_0375900 3300049744 Bacteria 924
372 Ga0501083_0636431 3300049744 Unclassified 694
373 Ga0501035_0087809 3300049822 Bacteria 2740
374 Ga0501035_0214305 3300049822 Bacteria 1647
375 Ga0501035_0798569 3300049822 Bacteria 754
376 Ga0501044_0053542 3300049823 Bacteria 4151
377 Ga0501044_0500565 3300049823 Bacteria 1116
378 Ga0501044_0557224 3300049823 Bacteria 1043
379 Ga0501044_0946517 3300049823 Bacteria 734
380 nmdc:mga0yw44_406770_c1 3300050492 Bacteria 920
381 nmdc:mga0n895_1111463_c1 3300050512 Bacteria 767
382 nmdc:mga0rr50_337916_c1 3300050513 Bacteria 1265
383 Ga0495601_0144153 3300053077 Bacteria 1554
384 Ga0500635_0073853 3300053080 Bacteria 1214
385 Ga0495595_0009145 3300053084 Bacteria 4093
386 Ga0495619_0176368 3300053085 Bacteria 1478
387 Ga0500643_000003 3300053087 Bacteria 876659
388 Ga0500566_0331835 3300053094 Unclassified 704
389 Ga0500595_003515 3300053119 Bacteria 7287
390 Ga0500595_012701 3300053119 Bacteria 3248
391 Ga0500614_172473 3300053123 Bacteria 659
392 Ga0500655_024804 3300053133 Bacteria 1136
393 Ga0500573_0000037 3300053140 Bacteria 107603
394 Ga0500577_0312009 3300053142 Unclassified 687
395 Ga0500619_306833 3300053154 Unclassified 511
396 Ga0501084_0245047 3300054114 Bacteria 1513
397 Ga0501082_0622836 3300060353 Bacteria 944

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026078 Ga0207702_11546443 Ga0207702_115464431 97
2 3300005618 Ga0068864_101759907 Ga0068864_1017599072 100
3 3300009093 Ga0105240_10402381 Ga0105240_104023812 100
4 3300014968 Ga0157379_10883687 Ga0157379_108836873 100
5 3300046507 Ga0495606_0226478 Ga0495606_0226478_24_374 100
6 3300047469 Ga0495673_0108296 Ga0495673_0108296_84_425 101
7 3300049570 Ga0501033_0212833 Ga0501033_0212833_751_1092 101
8 3300049579 Ga0501043_0290205 Ga0501043_0290205_547_888 101
9 3300049581 Ga0501047_0585756 Ga0501047_0585756_115_456 101
10 3300054114 Ga0501084_0245047 Ga0501084_0245047_672_1007 102
11 3300025917 Ga0207660_11345279 Ga0207660_113452792 103
12 3300031235 Ga0265330_10109472 Ga0265330_101094722 104
13 3300005344 Ga0070661_100031637 Ga0070661_1000316373 107
14 3300005563 Ga0068855_101901226 Ga0068855_1019012262 107
15 3300005616 Ga0068852_100040826 Ga0068852_1000408263 107
16 3300009174 Ga0105241_10250600 Ga0105241_102506002 107
17 3300009177 Ga0105248_10000005 Ga0105248_10000005601 107
18 3300025911 Ga0207654_10165173 Ga0207654_101651733 107
19 3300025941 Ga0207711_10000002 Ga0207711_10000002599 107
20 3300025944 Ga0207661_10966047 Ga0207661_109660471 107
21 3300025949 Ga0207667_10869591 Ga0207667_108695912 107
22 3300026142 Ga0207698_10056440 Ga0207698_100564402 107
23 3300049586 Ga0501070_0464053 Ga0501070_0464053_181_510 107
24 3300046462 Ga0495651_0171288 Ga0495651_0171288_1050_1397 108
25 3300046463 Ga0495653_0407502 Ga0495653_0407502_219_566 108
26 3300046514 Ga0495618_0137327 Ga0495618_0137327_883_1230 108
27 3300046529 Ga0495652_0051025 Ga0495652_0051025_2579_2926 108
28 3300047319 Ga0495674_0163232 Ga0495674_0163232_1468_1815 108
29 3300047444 Ga0495675_0753978 Ga0495675_0753978_25_372 108
30 3300048088 Ga0495602_0101444 Ga0495602_0101444_1939_2286 108
31 3300053077 Ga0495601_0144153 Ga0495601_0144153_435_782 108
32 3300053084 Ga0495595_0009145 Ga0495595_0009145_971_1318 108
33 3300053085 Ga0495619_0176368 Ga0495619_0176368_121_468 108
34 3300005458 Ga0070681_10071861 Ga0070681_100718614 109
35 3300005563 Ga0068855_100345044 Ga0068855_1003450443 109
36 3300005577 Ga0068857_101480998 Ga0068857_1014809982 109
37 3300005578 Ga0068854_100388816 Ga0068854_1003888163 109
38 3300005616 Ga0068852_100398153 Ga0068852_1003981532 109
39 3300010159 Ga0099796_10006309 Ga0099796_100063093 109
40 3300025912 Ga0207707_10209264 Ga0207707_102092644 109
41 3300025949 Ga0207667_11377282 Ga0207667_113772822 109
42 3300025981 Ga0207640_10291874 Ga0207640_102918741 109
43 3300026041 Ga0207639_11068843 Ga0207639_110688431 109
44 3300026116 Ga0207674_11277308 Ga0207674_112773082 109
45 3300026142 Ga0207698_10326233 Ga0207698_103262334 109
46 3300037466 Ga0395898_0045842 Ga0395898_0045842_1920_2249 109
47 3300038443 Ga0395901_0079597 Ga0395901_0079597_1806_2135 109
48 3300039437 Ga0436365_1000935 Ga0436365_1000935_134_469 109
49 3300047320 Ga0495672_0072397 Ga0495672_0072397_1556_1885 109
50 3300049579 Ga0501043_1079916 Ga0501043_1079916_130_459 109
51 3300049589 Ga0501073_0265158 Ga0501073_0265158_777_1106 109
52 3300049822 Ga0501035_0214305 Ga0501035_0214305_940_1269 109
53 3300053087 Ga0500643_000003 Ga0500643_000003_629527_629856 109
54 3300005328 Ga0070676_10003084 Ga0070676_100030848 110
55 3300005331 Ga0070670_100452032 Ga0070670_1004520322 110
56 3300005338 Ga0068868_100343582 Ga0068868_1003435822 110
57 3300005364 Ga0070673_100377196 Ga0070673_1003771962 110
58 3300005436 Ga0070713_100514549 Ga0070713_1005145492 110
59 3300005438 Ga0070701_10319861 Ga0070701_103198612 110
60 3300005441 Ga0070700_100363188 Ga0070700_1003631881 110
61 3300005459 Ga0068867_100032708 Ga0068867_1000327084 110
62 3300005719 Ga0068861_101451318 Ga0068861_1014513182 110
63 3300005840 Ga0068870_10154771 Ga0068870_101547712 110
64 3300005844 Ga0068862_100882814 Ga0068862_1008828142 110
65 3300006881 Ga0068865_100124755 Ga0068865_1001247552 110
66 3300009093 Ga0105240_10643081 Ga0105240_106430813 110
67 3300009098 Ga0105245_10239856 Ga0105245_102398562 110
68 3300009148 Ga0105243_10020198 Ga0105243_100201984 110
69 3300009176 Ga0105242_10019567 Ga0105242_100195674 110
70 3300009545 Ga0105237_11868680 Ga0105237_118686802 110
71 3300013105 Ga0157369_10009212 Ga0157369_100092127 110
72 3300013308 Ga0157375_10237407 Ga0157375_102374072 110
73 3300025901 Ga0207688_10121855 Ga0207688_101218552 110
74 3300025907 Ga0207645_10064758 Ga0207645_100647582 110
75 3300025925 Ga0207650_10365735 Ga0207650_103657352 110
76 3300025927 Ga0207687_10114495 Ga0207687_101144952 110
77 3300025928 Ga0207700_10597143 Ga0207700_105971432 110
78 3300025935 Ga0207709_10018456 Ga0207709_100184562 110
79 3300025937 Ga0207669_10737597 Ga0207669_107375971 110
80 3300025938 Ga0207704_10236592 Ga0207704_102365922 110
81 3300025942 Ga0207689_10156513 Ga0207689_101565132 110
82 3300025960 Ga0207651_10009917 Ga0207651_100099172 110
83 3300026023 Ga0207677_10263290 Ga0207677_102632902 110
84 3300026075 Ga0207708_10412714 Ga0207708_104127141 110
85 3300026089 Ga0207648_10007588 Ga0207648_100075884 110
86 3300028800 Ga0265338_10007775 Ga0265338_100077756 110
87 3300031247 Ga0265340_10336219 Ga0265340_103362191 110
88 3300031250 Ga0265331_10087118 Ga0265331_100871182 110
89 3300031595 Ga0265313_10033278 Ga0265313_100332782 110
90 3300035113 Ga0373936_0098088 Ga0373936_0098088_667_1005 110
91 3300049589 Ga0501073_0008918 Ga0501073_0008918_5613_5951 110
92 3300049589 Ga0501073_0222758 Ga0501073_0222758_605_943 110
93 3300050512 nmdc:mga0n895_1111463_c1 nmdc:mga0n895_1111463_c1_213_551 110
94 3300050513 nmdc:mga0rr50_337916_c1 nmdc:mga0rr50_337916_c1_778_1116 110
95 3300053133 Ga0500655_024804 Ga0500655_024804_157_498 110
96 3300005327 Ga0070658_10200445 Ga0070658_102004452 111
97 3300005328 Ga0070676_10384367 Ga0070676_103843671 111
98 3300005354 Ga0070675_100436320 Ga0070675_1004363202 111
99 3300005356 Ga0070674_100747026 Ga0070674_1007470262 111
100 3300005456 Ga0070678_100301146 Ga0070678_1003011462 111
101 3300005456 Ga0070678_101305617 Ga0070678_1013056171 111
102 3300005457 Ga0070662_101639352 Ga0070662_1016393522 111
103 3300005545 Ga0070695_100401458 Ga0070695_1004014581 111
104 3300005548 Ga0070665_101071562 Ga0070665_1010715623 111
105 3300005548 Ga0070665_101285112 Ga0070665_1012851122 111
106 3300005617 Ga0068859_101283600 Ga0068859_1012836003 111
107 3300005618 Ga0068864_100381011 Ga0068864_1003810113 111
108 3300005719 Ga0068861_102498056 Ga0068861_1024980561 111
109 3300005844 Ga0068862_101114841 Ga0068862_1011148411 111
110 3300006358 Ga0068871_100063684 Ga0068871_1000636842 111
111 3300006931 Ga0097620_101283436 Ga0097620_1012834361 111
112 3300007788 Ga0099795_10142862 Ga0099795_101428622 111
113 3300007788 Ga0099795_10611425 Ga0099795_106114251 111
114 3300009093 Ga0105240_10785161 Ga0105240_107851613 111
115 3300009093 Ga0105240_10840821 Ga0105240_108408212 111
116 3300009176 Ga0105242_10332781 Ga0105242_103327813 111
117 3300009545 Ga0105237_10940034 Ga0105237_109400341 111
118 3300009982 Ga0105147_106867 Ga0105147_1068671 111
119 3300010159 Ga0099796_10319760 Ga0099796_103197601 111
120 3300010375 Ga0105239_10428406 Ga0105239_104284062 111
121 3300013104 Ga0157370_10478090 Ga0157370_104780903 111
122 3300013306 Ga0163162_10107516 Ga0163162_101075162 111
123 3300013306 Ga0163162_12052858 Ga0163162_120528582 111
124 3300014325 Ga0163163_10000015 Ga0163163_10000015200 111
125 3300014326 Ga0157380_10142171 Ga0157380_101421714 111
126 3300014968 Ga0157379_10044600 Ga0157379_100446001 111
127 3300014969 Ga0157376_12840970 Ga0157376_128409701 111
128 3300021384 Ga0213876_10029834 Ga0213876_100298343 111
129 3300021384 Ga0213876_10220719 Ga0213876_102207192 111
130 3300025913 Ga0207695_10274394 Ga0207695_102743942 111
131 3300025921 Ga0207652_10471973 Ga0207652_104719732 111
132 3300025923 Ga0207681_10261098 Ga0207681_102610982 111
133 3300025924 Ga0207694_11513857 Ga0207694_115138571 111
134 3300025926 Ga0207659_11327306 Ga0207659_113273062 111
135 3300025934 Ga0207686_11512848 Ga0207686_115128482 111
136 3300025937 Ga0207669_10728498 Ga0207669_107284982 111
137 3300025949 Ga0207667_10050836 Ga0207667_100508363 111
138 3300025961 Ga0207712_10294212 Ga0207712_102942122 111
139 3300026118 Ga0207675_101752893 Ga0207675_1017528931 111
140 3300026121 Ga0207683_10465516 Ga0207683_104655162 111
141 3300028379 Ga0268266_10779326 Ga0268266_107793263 111
142 3300028379 Ga0268266_11163524 Ga0268266_111635242 111
143 3300031240 Ga0265320_10152875 Ga0265320_101528752 111
144 3300031241 Ga0265325_10000950 Ga0265325_1000095013 111
145 3300031242 Ga0265329_10083551 Ga0265329_100835512 111
146 3300031249 Ga0265339_10001402 Ga0265339_100014024 111
147 3300031250 Ga0265331_10072446 Ga0265331_100724462 111
148 3300031344 Ga0265316_10060892 Ga0265316_100608925 111
149 3300031344 Ga0265316_10260692 Ga0265316_102606922 111
150 3300031595 Ga0265313_10000672 Ga0265313_1000067227 111
151 3300031595 Ga0265313_10404694 Ga0265313_104046942 111
152 3300031711 Ga0265314_10481165 Ga0265314_104811652 111
153 3300031712 Ga0265342_10636578 Ga0265342_106365781 111
154 3300031730 Ga0307516_10046235 Ga0307516_100462355 111
155 3300035083 Ga0373926_0373925 Ga0373926_0373925_90_434 111
156 3300035695 Ga0373927_0015623 Ga0373927_0015623_2720_3064 111
157 3300035725 Ga0373947_0357764 Ga0373947_0357764_471_815 111
158 3300039437 Ga0436365_1627614 Ga0436365_1627614_3168_3503 111
159 3300041452 Ga0451793_0490877 Ga0451793_0490877_939_1283 111
160 3300045049 Ga0466959_0096241 Ga0466959_0096241_787_1269 111
161 3300046690 Ga0495624_0424757 Ga0495624_0424757_126_467 111
162 3300047320 Ga0495672_0425440 Ga0495672_0425440_157_501 111
163 3300049568 Ga0501031_0626811 Ga0501031_0626811_191_538 111
164 3300049570 Ga0501033_0076484 Ga0501033_0076484_277_624 111
165 3300049570 Ga0501033_0232239 Ga0501033_0232239_46_381 111
166 3300049570 Ga0501033_0329517 Ga0501033_0329517_617_952 111
167 3300049571 Ga0501034_0288979 Ga0501034_0288979_1021_1356 111
168 3300049573 Ga0501037_0413095 Ga0501037_0413095_462_809 111
169 3300049574 Ga0501038_0304092 Ga0501038_0304092_196_531 111
170 3300049579 Ga0501043_0044360 Ga0501043_0044360_3002_3337 111
171 3300049581 Ga0501047_0009625 Ga0501047_0009625_6190_6537 111
172 3300049581 Ga0501047_0045014 Ga0501047_0045014_3775_4110 111
173 3300049581 Ga0501047_0253318 Ga0501047_0253318_339_683 111
174 3300049581 Ga0501047_0358612 Ga0501047_0358612_676_1011 111
175 3300049582 Ga0501048_0397474 Ga0501048_0397474_307_654 111
176 3300049582 Ga0501048_1085036 Ga0501048_1085036_50_385 111
177 3300049589 Ga0501073_0189525 Ga0501073_0189525_394_729 111
178 3300049590 Ga0501074_0334558 Ga0501074_0334558_441_776 111
179 3300049742 Ga0501080_0127007 Ga0501080_0127007_76_411 111
180 3300049742 Ga0501080_0378438 Ga0501080_0378438_85_429 111
181 3300049744 Ga0501083_0375900 Ga0501083_0375900_334_669 111
182 3300049744 Ga0501083_0636431 Ga0501083_0636431_56_391 111
183 3300049822 Ga0501035_0087809 Ga0501035_0087809_1145_1480 111
184 3300049822 Ga0501035_0798569 Ga0501035_0798569_127_474 111
185 3300049823 Ga0501044_0053542 Ga0501044_0053542_501_848 111
186 3300049823 Ga0501044_0500565 Ga0501044_0500565_249_584 111
187 3300049823 Ga0501044_0946517 Ga0501044_0946517_329_664 111
188 3300053094 Ga0500566_0331835 Ga0500566_0331835_168_503 111
189 3300053119 Ga0500595_012701 Ga0500595_012701_1343_1684 111
190 3300053142 Ga0500577_0312009 Ga0500577_0312009_185_529 111
191 3300060353 Ga0501082_0622836 Ga0501082_0622836_102_437 111
192 3300005336 Ga0070680_101465864 Ga0070680_1014658642 112
193 3300005367 Ga0070667_101844397 Ga0070667_1018443971 112
194 3300005435 Ga0070714_101268128 Ga0070714_1012681281 112
195 3300005615 Ga0070702_100334935 Ga0070702_1003349352 112
196 3300005618 Ga0068864_102199430 Ga0068864_1021994301 112
197 3300006358 Ga0068871_100691328 Ga0068871_1006913282 112
198 3300009093 Ga0105240_11288063 Ga0105240_112880633 112
199 3300009553 Ga0105249_11426422 Ga0105249_114264221 112
200 3300010375 Ga0105239_10698569 Ga0105239_106985693 112
201 3300013105 Ga0157369_10114533 Ga0157369_101145333 112
202 3300014326 Ga0157380_11831357 Ga0157380_118313571 112
203 3300025911 Ga0207654_10919541 Ga0207654_109195411 112
204 3300025925 Ga0207650_10296786 Ga0207650_102967863 112
205 3300025929 Ga0207664_11465308 Ga0207664_114653082 112
206 3300025986 Ga0207658_11890317 Ga0207658_118903171 112
207 3300028379 Ga0268266_10041761 Ga0268266_100417611 112
208 3300028379 Ga0268266_11111522 Ga0268266_111115223 112
209 3300031730 Ga0307516_10064348 Ga0307516_100643483 112
210 3300034818 Ga0373950_0015636 Ga0373950_0015636_472_831 112
211 3300038443 Ga0395901_1515765 Ga0395901_1515765_33_371 112
212 3300044842 Ga0466957_0844063 Ga0466957_0844063_278_634 112
213 3300046492 Ga0495585_0076239 Ga0495585_0076239_905_1249 112
214 3300046524 Ga0495648_0337206 Ga0495648_0337206_21_365 112
215 3300046538 Ga0495609_0122417 Ga0495609_0122417_306_650 112
216 3300049570 Ga0501033_0361535 Ga0501033_0361535_220_567 112
217 3300049571 Ga0501034_0285358 Ga0501034_0285358_20_367 112
218 3300049581 Ga0501047_0178906 Ga0501047_0178906_422_769 112
219 3300049589 Ga0501073_0144472 Ga0501073_0144472_403_750 112
220 3300049823 Ga0501044_0557224 Ga0501044_0557224_568_915 112
221 3300003214 JGI25165J46597_1000036 JGI25165J46597_100003694 113
222 3300005327 Ga0070658_10021167 Ga0070658_100211673 113
223 3300005327 Ga0070658_10029785 Ga0070658_100297852 113
224 3300005327 Ga0070658_10146680 Ga0070658_101466802 113
225 3300005327 Ga0070658_10949475 Ga0070658_109494751 113
226 3300005329 Ga0070683_100599843 Ga0070683_1005998431 113
227 3300005329 Ga0070683_101416309 Ga0070683_1014163092 113
228 3300005331 Ga0070670_100241417 Ga0070670_1002414172 113
229 3300005331 Ga0070670_100676746 Ga0070670_1006767461 113
230 3300005334 Ga0068869_101081291 Ga0068869_1010812912 113
231 3300005335 Ga0070666_10272560 Ga0070666_102725603 113
232 3300005338 Ga0068868_100215307 Ga0068868_1002153073 113
233 3300005338 Ga0068868_100398004 Ga0068868_1003980042 113
234 3300005338 Ga0068868_100860691 Ga0068868_1008606911 113
235 3300005339 Ga0070660_100363174 Ga0070660_1003631742 113
236 3300005339 Ga0070660_100445020 Ga0070660_1004450201 113
237 3300005344 Ga0070661_100393428 Ga0070661_1003934282 113
238 3300005344 Ga0070661_100793586 Ga0070661_1007935862 113
239 3300005344 Ga0070661_101773299 Ga0070661_1017732992 113
240 3300005355 Ga0070671_100044371 Ga0070671_1000443713 113
241 3300005366 Ga0070659_100184703 Ga0070659_1001847032 113
242 3300005366 Ga0070659_100897050 Ga0070659_1008970503 113
243 3300005367 Ga0070667_100128112 Ga0070667_1001281122 113
244 3300005367 Ga0070667_100212343 Ga0070667_1002123432 113
245 3300005441 Ga0070700_100668389 Ga0070700_1006683893 113
246 3300005456 Ga0070678_100032733 Ga0070678_1000327334 113
247 3300005456 Ga0070678_101448009 Ga0070678_1014480092 113
248 3300005458 Ga0070681_10180906 Ga0070681_101809063 113
249 3300005459 Ga0068867_100010889 Ga0068867_1000108895 113
250 3300005459 Ga0068867_100421118 Ga0068867_1004211182 113
251 3300005530 Ga0070679_100140524 Ga0070679_1001405242 113
252 3300005535 Ga0070684_100158085 Ga0070684_1001580853 113
253 3300005539 Ga0068853_100621591 Ga0068853_1006215911 113
254 3300005547 Ga0070693_100725369 Ga0070693_1007253692 113
255 3300005548 Ga0070665_100000381 Ga0070665_10000038136 113
256 3300005548 Ga0070665_100033021 Ga0070665_1000330215 113
257 3300005548 Ga0070665_100664024 Ga0070665_1006640241 113
258 3300005563 Ga0068855_100121122 Ga0068855_1001211224 113
259 3300005563 Ga0068855_100343782 Ga0068855_1003437823 113
260 3300005563 Ga0068855_100375135 Ga0068855_1003751352 113
261 3300005563 Ga0068855_100635658 Ga0068855_1006356583 113
262 3300005616 Ga0068852_100042502 Ga0068852_1000425026 113
263 3300005718 Ga0068866_10033241 Ga0068866_100332413 113
264 3300005840 Ga0068870_10321550 Ga0068870_103215502 113
265 3300005841 Ga0068863_102316630 Ga0068863_1023166301 113
266 3300005842 Ga0068858_100379194 Ga0068858_1003791942 113
267 3300005842 Ga0068858_100758674 Ga0068858_1007586743 113
268 3300005843 Ga0068860_101008722 Ga0068860_1010087223 113
269 3300006038 Ga0075365_10353490 Ga0075365_103534901 113
270 3300006237 Ga0097621_100000209 Ga0097621_1000002095 113
271 3300006237 Ga0097621_100016590 Ga0097621_1000165903 113
272 3300006237 Ga0097621_100057973 Ga0097621_1000579733 113
273 3300006358 Ga0068871_100002253 Ga0068871_1000022533 113
274 3300006358 Ga0068871_100238310 Ga0068871_1002383102 113
275 3300006358 Ga0068871_100320009 Ga0068871_1003200093 113
276 3300006881 Ga0068865_100002773 Ga0068865_1000027738 113
277 3300009093 Ga0105240_10312373 Ga0105240_103123732 113
278 3300009093 Ga0105240_10461801 Ga0105240_104618013 113
279 3300009098 Ga0105245_10603148 Ga0105245_106031482 113
280 3300009098 Ga0105245_11737248 Ga0105245_117372481 113
281 3300009148 Ga0105243_12432326 Ga0105243_124323262 113
282 3300009174 Ga0105241_10395436 Ga0105241_103954363 113
283 3300009174 Ga0105241_10467314 Ga0105241_104673143 113
284 3300009174 Ga0105241_10663065 Ga0105241_106630652 113
285 3300009176 Ga0105242_10012177 Ga0105242_100121773 113
286 3300009176 Ga0105242_10023524 Ga0105242_100235242 113
287 3300009176 Ga0105242_10083778 Ga0105242_100837783 113
288 3300009177 Ga0105248_11252641 Ga0105248_112526411 113
289 3300009177 Ga0105248_13154656 Ga0105248_131546562 113
290 3300009545 Ga0105237_10121075 Ga0105237_101210753 113
291 3300009545 Ga0105237_12640457 Ga0105237_126404571 113
292 3300009551 Ga0105238_10090833 Ga0105238_100908333 113
293 3300009551 Ga0105238_10099827 Ga0105238_100998273 113
294 3300009551 Ga0105238_10407488 Ga0105238_104074882 113
295 3300009551 Ga0105238_11555664 Ga0105238_115556642 113
296 3300009551 Ga0105238_11755710 Ga0105238_117557101 113
297 3300009551 Ga0105238_12193502 Ga0105238_121935022 113
298 3300010375 Ga0105239_10144837 Ga0105239_101448373 113
299 3300010375 Ga0105239_10348491 Ga0105239_103484911 113
300 3300011119 Ga0105246_10007171 Ga0105246_100071715 113
301 3300013104 Ga0157370_10285470 Ga0157370_102854703 113
302 3300013296 Ga0157374_10022605 Ga0157374_100226055 113
303 3300013296 Ga0157374_10444207 Ga0157374_104442072 113
304 3300013297 Ga0157378_10148084 Ga0157378_101480843 113
305 3300013297 Ga0157378_10431040 Ga0157378_104310403 113
306 3300013297 Ga0157378_11430909 Ga0157378_114309092 113
307 3300013306 Ga0163162_10037764 Ga0163162_100377645 113
308 3300013306 Ga0163162_10062534 Ga0163162_100625342 113
309 3300013308 Ga0157375_12148781 Ga0157375_121487811 113
310 3300013308 Ga0157375_12769485 Ga0157375_127694851 113
311 3300014325 Ga0163163_10212669 Ga0163163_102126692 113
312 3300014968 Ga0157379_10000349 Ga0157379_1000034938 113
313 3300014969 Ga0157376_10007081 Ga0157376_100070814 113
314 3300014969 Ga0157376_10313541 Ga0157376_103135413 113
315 3300014969 Ga0157376_10551929 Ga0157376_105519293 113
316 3300017792 Ga0163161_10009672 Ga0163161_100096725 113
317 3300025231 Ga0207427_108078 Ga0207427_1080782 113
318 3300025261 Ga0209233_1000015 Ga0209233_1000015872 113
319 3300025261 Ga0209233_1008503 Ga0209233_10085033 113
320 3300025899 Ga0207642_10003420 Ga0207642_100034203 113
321 3300025903 Ga0207680_10463481 Ga0207680_104634811 113
322 3300025907 Ga0207645_10413303 Ga0207645_104133032 113
323 3300025909 Ga0207705_10034376 Ga0207705_100343764 113
324 3300025909 Ga0207705_10177225 Ga0207705_101772252 113
325 3300025909 Ga0207705_10419110 Ga0207705_104191103 113
326 3300025909 Ga0207705_11203936 Ga0207705_112039361 113
327 3300025911 Ga0207654_10154382 Ga0207654_101543822 113
328 3300025911 Ga0207654_10578295 Ga0207654_105782953 113
329 3300025912 Ga0207707_10205821 Ga0207707_102058212 113
330 3300025913 Ga0207695_10523346 Ga0207695_105233461 113
331 3300025919 Ga0207657_10242423 Ga0207657_102424232 113
332 3300025919 Ga0207657_10706212 Ga0207657_107062122 113
333 3300025920 Ga0207649_10715110 Ga0207649_107151101 113
334 3300025921 Ga0207652_10621724 Ga0207652_106217241 113
335 3300025921 Ga0207652_10938803 Ga0207652_109388031 113
336 3300025921 Ga0207652_11194068 Ga0207652_111940682 113
337 3300025924 Ga0207694_10064968 Ga0207694_100649682 113
338 3300025924 Ga0207694_10119933 Ga0207694_101199332 113
339 3300025927 Ga0207687_10961529 Ga0207687_109615292 113
340 3300025927 Ga0207687_11116009 Ga0207687_111160092 113
341 3300025928 Ga0207700_11440886 Ga0207700_114408862 113
342 3300025931 Ga0207644_10042012 Ga0207644_100420123 113
343 3300025932 Ga0207690_10808056 Ga0207690_108080562 113
344 3300025933 Ga0207706_10268703 Ga0207706_102687033 113
345 3300025934 Ga0207686_10036832 Ga0207686_100368324 113
346 3300025934 Ga0207686_10247084 Ga0207686_102470842 113
347 3300025938 Ga0207704_10003862 Ga0207704_100038624 113
348 3300025940 Ga0207691_11278203 Ga0207691_112782032 113
349 3300025941 Ga0207711_10407365 Ga0207711_104073651 113
350 3300025941 Ga0207711_11380294 Ga0207711_113802941 113
351 3300025942 Ga0207689_10780986 Ga0207689_107809862 113
352 3300025944 Ga0207661_10043243 Ga0207661_100432432 113
353 3300025944 Ga0207661_11184012 Ga0207661_111840121 113
354 3300025949 Ga0207667_10329461 Ga0207667_103294612 113
355 3300025949 Ga0207667_10694713 Ga0207667_106947132 113
356 3300025961 Ga0207712_12095568 Ga0207712_120955681 113
357 3300025986 Ga0207658_10079228 Ga0207658_100792283 113
358 3300025986 Ga0207658_10120620 Ga0207658_101206202 113
359 3300026023 Ga0207677_10140027 Ga0207677_101400273 113
360 3300026023 Ga0207677_10236896 Ga0207677_102368963 113
361 3300026035 Ga0207703_10302862 Ga0207703_103028622 113
362 3300026041 Ga0207639_11490361 Ga0207639_114903611 113
363 3300026078 Ga0207702_10253042 Ga0207702_102530423 113
364 3300026078 Ga0207702_10982972 Ga0207702_109829721 113
365 3300026089 Ga0207648_10020227 Ga0207648_100202275 113
366 3300026089 Ga0207648_10295581 Ga0207648_102955812 113
367 3300026095 Ga0207676_10165016 Ga0207676_101650163 113
368 3300026116 Ga0207674_10797054 Ga0207674_107970542 113
369 3300026116 Ga0207674_11051231 Ga0207674_110512312 113
370 3300026121 Ga0207683_10047876 Ga0207683_100478765 113
371 3300026121 Ga0207683_10165517 Ga0207683_101655171 113
372 3300026142 Ga0207698_10628723 Ga0207698_106287233 113
373 3300028379 Ga0268266_10000900 Ga0268266_1000090036 113
374 3300028379 Ga0268266_10049573 Ga0268266_100495733 113
375 3300028380 Ga0268265_11833286 Ga0268265_118332862 113
376 3300028381 Ga0268264_10308087 Ga0268264_103080872 113
377 3300028381 Ga0268264_10566888 Ga0268264_105668881 113
378 3300031711 Ga0265314_10259050 Ga0265314_102590502 113
379 3300041460 Ga0451802_0323929 Ga0451802_0323929_132_494 113
380 3300046517 Ga0495630_1166592 Ga0495630_1166592_129_479 113
381 3300046529 Ga0495652_1008398 Ga0495652_1008398_89_439 113
382 3300046536 Ga0495587_0183746 Ga0495587_0183746_252_599 113
383 3300046557 Ga0495622_0082770 Ga0495622_0082770_977_1327 113
384 3300046558 Ga0495633_0367838 Ga0495633_0367838_59_418 113
385 3300047673 Ga0495593_0385979 Ga0495593_0385979_337_687 113
386 3300048905 Ga0496102_1675606 Ga0496102_1675606_153_503 113
387 3300048915 Ga0496112_1924572 Ga0496112_1924572_134_487 113
388 3300048918 Ga0496115_0308015 Ga0496115_0308015_261_611 113
389 3300048929 Ga0496126_0209208 Ga0496126_0209208_1012_1353 113
390 3300048929 Ga0496126_0588517 Ga0496126_0588517_18_377 113
391 3300049571 Ga0501034_0496111 Ga0501034_0496111_506_847 113
392 3300050492 nmdc:mga0yw44_406770_c1 nmdc:mga0yw44_406770_c1_59_400 113
393 3300053080 Ga0500635_0073853 Ga0500635_0073853_793_1146 113
394 3300053119 Ga0500595_003515 Ga0500595_003515_3448_3795 113
395 3300053123 Ga0500614_172473 Ga0500614_172473_246_596 113
396 3300053140 Ga0500573_0000037 Ga0500573_0000037_103816_104172 113
397 3300053154 Ga0500619_306833 Ga0500619_306833_74_427 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06108

DUF952

Protein of unknown function (DUF952)

6

95

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o0q-assembly1.cif.gz_A x-ray crystal structure of protein cc0527 from caulobacter crescentus. northeast structural genomics consortium target ccr55 0.917 4 108
2o0p-assembly1.cif.gz_A x-ray crystal structure of protein cc0527 (v27m / l66m double mutant) from caulobacter crescentus. northeast structural genomics consortium target ccr55. 0.913 4 108
2jqn-assembly1.cif.gz_A solution nmr structure of cc0527 from caulobacter crescentus. northeast structural genomics target ccr55 0.8614 4 106
2o0q-assembly1.cif.gz_A x-ray crystal structure of protein cc0527 from caulobacter crescentus. northeast structural genomics consortium target ccr55 0.8483 4 108
2o0p-assembly1.cif.gz_A x-ray crystal structure of protein cc0527 (v27m / l66m double mutant) from caulobacter crescentus. northeast structural genomics consortium target ccr55. 0.8451 4 108
ID Description Score Start End Superfamily
2o0pA00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.9033 4 108 3.20.170.20
af_Q0DQS8_1_107_3.20.170.20 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.8848 12 107 3.20.170.20
2jqnA00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.8614 4 106 3.20.170.20
2o0pA00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.8355 4 108 3.20.170.20
af_O07206_8_119_3.20.170.20 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.8192 4 107 3.20.170.20
ID Description Score Start End GO Terms
AF-A0A7V9MW51-F1-model_v4 DUF952 domain-containing protein 0.9997 1 113
AF-A0A2M7CTI4-F1-model_v4 Uncharacterized protein 0.9858 33 98
AF-A0A2D6JGD2-F1-model_v4 Glutathione S-transferase 0.9574 3 100
AF-A0A439ZUE4-F1-model_v4 Dihydroorotate dehydrogenase (quinone) (EC 1.3.5.2) (DHOdehase) (DHOD) (DHODase) (Dihydroorotate oxidase) 0.9569 1 112 GO:0005737
GO:0005886
GO:0006207
GO:0044205
GO:0106430
AF-A0A5C5WEY3-F1-model_v4 DUF952 domain-containing protein 0.9565 1 100

Feature Viewer

pLDDT pTM Quality
94.48 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map