F433745

General Info

Members Datasets Scaffolds Average Seq Length
397 273 360 252

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10034129|Ga0105240_100341293
Length 269
Sequence MIEGEKRFMLQQTSDAVDRAVYPSLRDKRVIVTGGGSGIGEGLVEAFAAQGARVAFLDIDDEASHSVVARLSADAPHQPVYRHCDVTDLDALATTIAELEQLLGGIDILANNAGNDDRHTIADVTPDYWNERLNVNLRHQFFAAKAVVPAMQRAGGGAILNFGSISWHLGLPDLVLYQTCKAAIEGLTRSLARDLGRDGIRVNTIVPGNVQTPRQEKWYTPQGEAEIVAGQCLDGRIQPSDVAALVLFLASDDARMCTGHEYWVDAGWR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
3 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
4 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
5 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
6 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
7 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
8 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
9 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
10 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
11 2643221583 Caulobacter sp. Root655 Isolate Unclassified
12 2643221584 Caulobacter sp. Root656 Isolate Unclassified
13 2643221640 Caulobacter sp. Root342 Isolate Unclassified
14 2643221642 Caulobacter sp. Root343 Isolate Unclassified
15 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
16 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
17 2818991435 Caulobacter henricii 536 Isolate Unclassified
18 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
19 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
20 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
21 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
22 2849560528 Caulobacter zeae 410 Isolate Unclassified
23 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
24 2851153111 Caulobacter radicis 736 Isolate Unclassified
25 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
26 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
27 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
28 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
29 2902330777 Methylobacterium sp. 2A Isolate Unclassified
30 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
31 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
32 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
33 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
34 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
35 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
36 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
37 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
38 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
39 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
40 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
41 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
42 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
44 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
45 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
46 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
47 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
48 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
49 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
50 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
51 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
52 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
53 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
54 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
55 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
98 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
102 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
168 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
172 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
177 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
178 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
182 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
190 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
191 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
205 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
206 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
233 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
237 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
238 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
239 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
240 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
241 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
242 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
243 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
244 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
247 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
248 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
249 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
250 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
251 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
252 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
253 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
254 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
255 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
256 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
257 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
258 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
259 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
260 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
261 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
262 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
263 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
264 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
265 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
266 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
267 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
268 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
269 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
270 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
271 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
272 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
273 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.68
Metatranscriptomes 0
Isolates 9.32

Biome Distribution

Category Percentage (%)
Aerial Root 1.26
Bulb 0
Endosphere 25.94
Nodule 0.25
Rhizoplane 3.53
Rhizosphere 56.93
Stem 0
Stem Tuber 0
Unclassified 12.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1635877 2162886007 Bacteria 7373
2 JGI24741J21665_1001835 3300001915 Bacteria 5808
3 JGI24740J21852_10000779 3300001979 Bacteria 13973
4 JGI24737J22298_10001412 3300001990 Bacteria 8530
5 JGI25406J46586_10016685 3300003203 Bacteria 3055
6 Ga0055525_1000096 3300003759 Bacteria 137836
7 Ga0055542_1000012 3300003762 Bacteria 391808
8 Ga0055529_1000002 3300003763 Bacteria 537914
9 Ga0055529_1000021 3300003763 Bacteria 321484
10 Ga0055526_1010390 3300003771 Bacteria 4336
11 Ga0055537_1001969 3300003773 Bacteria 7333
12 Ga0055524_1010010 3300003775 Bacteria 3810
13 Ga0055524_1011340 3300003775 Bacteria 3493
14 Ga0055524_1021436 3300003775 Bacteria 2141
15 Ga0055536_1000653 3300003781 Bacteria 23422
16 Ga0055536_1000964 3300003781 Bacteria 18424
17 Ga0055528_1004650 3300003790 Bacteria 6564
18 Ga0055530_10000579 3300003791 Bacteria 31675
19 Ga0055530_10001170 3300003791 Bacteria 20304
20 Ga0055530_10001374 3300003791 Bacteria 18030
21 Ga0055530_10018714 3300003791 Bacteria 2125
22 Ga0055531_10000646 3300003794 Bacteria 30076
23 Ga0055531_10003351 3300003794 Bacteria 10242
24 Ga0055531_10006560 3300003794 Bacteria 6577
25 Ga0055531_10015275 3300003794 Bacteria 3396
26 Ga0055531_10020118 3300003794 Bacteria 2660
27 Ga0055531_10036604 3300003794 Bacteria 1509
28 Ga0065704_10070205 3300005289 Bacteria 83747
29 Ga0070658_10000196 3300005327 Bacteria 53378
30 Ga0070658_10002355 3300005327 Bacteria 15842
31 Ga0070666_10008776 3300005335 Bacteria 6282
32 Ga0070660_100016365 3300005339 Bacteria 5382
33 Ga0070661_100002495 3300005344 Bacteria 12611
34 Ga0070661_100006919 3300005344 Bacteria 7827
35 Ga0070675_100308949 3300005354 Bacteria 1395
36 Ga0070674_100118658 3300005356 Bacteria 1955
37 Ga0070659_100016509 3300005366 Bacteria 5543
38 Ga0070663_100270666 3300005455 Bacteria 1350
39 Ga0070678_100000055 3300005456 Bacteria 40348
40 Ga0068867_100002955 3300005459 Bacteria 11973
41 Ga0070684_100059523 3300005535 Bacteria 3340
42 Ga0068853_100074121 3300005539 Bacteria 2969
43 Ga0070665_100002302 3300005548 Bacteria 21191
44 Ga0068855_100000047 3300005563 Bacteria 145355
45 Ga0068855_100027779 3300005563 Bacteria 6769
46 Ga0070664_100006220 3300005564 Bacteria 9645
47 Ga0068857_100384080 3300005577 Bacteria 1304
48 Ga0068854_100023707 3300005578 Bacteria 4194
49 Ga0068856_100006207 3300005614 Bacteria 11727
50 Ga0068852_100174465 3300005616 Bacteria 2017
51 Ga0068859_100002646 3300005617 Bacteria 18230
52 Ga0068861_100000084 3300005719 Bacteria 45078
53 Ga0075369_10037077 3300006186 Bacteria 2076
54 Ga0075366_10007023 3300006195 Bacteria 6195
55 Ga0075366_10138359 3300006195 Bacteria 1471
56 Ga0097621_100028194 3300006237 Bacteria 4425
57 Ga0075370_10083706 3300006353 Bacteria 1835
58 Ga0075370_10100081 3300006353 Bacteria 1677
59 Ga0068871_100333516 3300006358 Bacteria 1338
60 Ga0068865_100095523 3300006881 Bacteria 2166
61 Ga0097620_100002646 3300006931 Bacteria 18230
62 Ga0105240_10000647 3300009093 Bacteria 64299
63 Ga0105240_10002690 3300009093 Bacteria 28290
64 Ga0105240_10034129 3300009093 Bacteria 6566
65 Ga0105247_10045830 3300009101 Bacteria 2684
66 Ga0105243_10000227 3300009148 Bacteria 64901
67 Ga0105241_10000352 3300009174 Bacteria 34850
68 Ga0105248_10003056 3300009177 Bacteria 18559
69 Ga0105237_10001281 3300009545 Bacteria 33535
70 Ga0105237_10067799 3300009545 Bacteria 3562
71 Ga0105237_10120051 3300009545 Bacteria 2623
72 Ga0105238_10247266 3300009551 Bacteria 1761
73 Ga0105249_10630958 3300009553 Bacteria 1128
74 Ga0105239_10000105 3300010375 Bacteria 117635
75 Ga0105239_10001683 3300010375 Bacteria 29162
76 Ga0105239_10100931 3300010375 Bacteria 3193
77 Ga0157373_10010643 3300013100 Bacteria 6769
78 Ga0157371_10000094 3300013102 Bacteria 139074
79 Ga0157370_10151669 3300013104 Bacteria 2156
80 Ga0157369_10010530 3300013105 Bacteria 10525
81 Ga0157369_10112576 3300013105 Bacteria 2891
82 Ga0157369_10134641 3300013105 Bacteria 2616
83 Ga0157372_10075910 3300013307 Bacteria 3794
84 Ga0157372_10449669 3300013307 Bacteria 1501
85 Ga0157375_10386806 3300013308 Bacteria 1566
86 Ga0183365_10005 3300015684 Bacteria 249619
87 Ga0183363_1004 3300015690 Bacteria 416766
88 Ga0163161_10189807 3300017792 Bacteria 1579
89 Ga0209674_102709 3300025226 Bacteria 3629
90 Ga0207425_1016036 3300025245 Bacteria 1669
91 Ga0209646_1003506 3300025246 Bacteria 3086
92 Ga0209148_1000008 3300025254 Bacteria 1504371
93 Ga0209565_1000140 3300025263 Bacteria 101561
94 Ga0209455_1000002 3300025272 Bacteria 1505459
95 Ga0209673_1000630 3300025273 Bacteria 53635
96 Ga0209130_1002498 3300025284 Bacteria 9091
97 Ga0209675_1005092 3300025291 Bacteria 5613
98 Ga0209675_1023894 3300025291 Bacteria 1572
99 Ga0209676_1000043 3300025292 Bacteria 418680
100 Ga0209676_1000712 3300025292 Bacteria 46015
101 Ga0209676_1004038 3300025292 Bacteria 8449
102 Ga0209025_1000864 3300025294 Bacteria 47865
103 Ga0209564_1006541 3300025295 Bacteria 6261
104 Ga0209564_1022706 3300025295 Bacteria 2206
105 Ga0209564_1032062 3300025295 Bacteria 1590
106 Ga0209758_1000924 3300025297 Bacteria 39688
107 Ga0209050_1000049 3300025298 Bacteria 364096
108 Ga0209050_1000559 3300025298 Bacteria 60902
109 Ga0209050_1001103 3300025298 Bacteria 32702
110 Ga0209050_1001731 3300025298 Bacteria 21722
111 Ga0209050_1022876 3300025298 Bacteria 2223
112 Ga0209256_1001549 3300025299 Bacteria 22921
113 Ga0209256_1008649 3300025299 Bacteria 4663
114 Ga0209256_1009010 3300025299 Bacteria 4471
115 Ga0209256_1014548 3300025299 Bacteria 2822
116 Ga0209051_1002278 3300025303 Bacteria 14056
117 Ga0209257_1000134 3300025304 Bacteria 207628
118 Ga0209257_1000200 3300025304 Bacteria 147538
119 Ga0209257_1000452 3300025304 Bacteria 77144
120 Ga0209257_1000692 3300025304 Bacteria 52346
121 Ga0209257_1001064 3300025304 Bacteria 36288
122 Ga0209257_1001841 3300025304 Bacteria 23124
123 Ga0209257_1008106 3300025304 Bacteria 6106
124 Ga0209257_1018216 3300025304 Bacteria 2716
125 Ga0207656_10001687 3300025321 Bacteria 7342
126 Ga0207647_10016955 3300025904 Bacteria 4959
127 Ga0207647_10255250 3300025904 Bacteria 1005
128 Ga0207705_10000183 3300025909 Bacteria 65457
129 Ga0207654_10000020 3300025911 Bacteria 167053
130 Ga0207654_10103877 3300025911 Bacteria 1755
131 Ga0207695_10000003 3300025913 Bacteria 1368691
132 Ga0207695_10009971 3300025913 Bacteria 11670
133 Ga0207695_10038057 3300025913 Bacteria 5185
134 Ga0207671_10028216 3300025914 Bacteria 4196
135 Ga0207657_10000140 3300025919 Bacteria 74094
136 Ga0207649_10002882 3300025920 Bacteria 9462
137 Ga0207649_10013619 3300025920 Bacteria 4544
138 Ga0207649_10496652 3300025920 Bacteria 927
139 Ga0207694_10000011 3300025924 Bacteria 417640
140 Ga0207694_10000878 3300025924 Bacteria 26740
141 Ga0207659_10099885 3300025926 Bacteria 2186
142 Ga0207690_10000063 3300025932 Bacteria 95620
143 Ga0207706_10008063 3300025933 Bacteria 9723
144 Ga0207686_10095705 3300025934 Bacteria 1971
145 Ga0207709_10000093 3300025935 Bacteria 139110
146 Ga0207669_10000086 3300025937 Bacteria 46934
147 Ga0207704_10047594 3300025938 Bacteria 2564
148 Ga0207711_10001846 3300025941 Bacteria 19327
149 Ga0207667_10000006 3300025949 Bacteria 679876
150 Ga0207667_10000050 3300025949 Bacteria 234390
151 Ga0207640_10001108 3300025981 Bacteria 14880
152 Ga0207640_10282439 3300025981 Bacteria 1305
153 Ga0207677_10232238 3300026023 Bacteria 1487
154 Ga0207639_10010063 3300026041 Bacteria 6541
155 Ga0207678_10002329 3300026067 Bacteria 17206
156 Ga0207702_10000713 3300026078 Bacteria 35789
157 Ga0207702_10327762 3300026078 Bacteria 1460
158 Ga0207648_10059597 3300026089 Bacteria 3329
159 Ga0207674_10048345 3300026116 Bacteria 4354
160 Ga0207675_100000166 3300026118 Bacteria 58837
161 Ga0207683_10000181 3300026121 Bacteria 54142
162 Ga0207698_10035277 3300026142 Bacteria 3657
163 Ga0307517_10012028 3300028786 Bacteria 11940
164 Ga0307517_10215329 3300028786 Bacteria 1176
165 Ga0307515_10090947 3300028794 Bacteria 3820
166 Ga0307515_10115900 3300028794 Bacteria 3081
167 Ga0307515_10208156 3300028794 Bacteria 1809
168 Ga0265338_10122560 3300028800 Bacteria 2069
169 Ga0265320_10017331 3300031240 Bacteria 4002
170 Ga0265331_10040923 3300031250 Bacteria 2253
171 Ga0265327_10002310 3300031251 Bacteria 20381
172 Ga0265316_10059336 3300031344 Bacteria 2976
173 Ga0265313_10077845 3300031595 Bacteria 1513
174 Ga0265314_10105653 3300031711 Bacteria 1800
175 Ga0265342_10137823 3300031712 Bacteria 1363
176 Ga0307516_10014691 3300031730 Bacteria 8273
177 Ga0307405_10024087 3300031731 Bacteria 3471
178 Ga0307413_10128946 3300031824 Bacteria 1727
179 Ga0307412_10009508 3300031911 Bacteria 5581
180 Ga0307409_100453356 3300031995 Bacteria 1238
181 Ga0307416_100016230 3300032002 Bacteria 5168
182 Ga0307510_10104057 3300033180 Bacteria 2614
183 Ga0373943_0170055 3300035170 Unclassified 1192
184 Ga0373927_0071414 3300035695 Bacteria 2247
185 Ga0373925_0113756 3300037068 Bacteria 2093
186 Ga0395905_0005061 3300037471 Bacteria 13571
187 Ga0436364_0529752 3300037853 Bacteria 4663
188 Ga0451800_1440841 3300041459 Bacteria 1433
189 Ga0439435_0068059 3300042436 Bacteria 1049
190 Ga0466961_0162879 3300044693 Bacteria 1390
191 Ga0466959_0055331 3300045049 Bacteria 2897
192 Ga0495627_002017 3300046453 Bacteria 10438
193 Ga0495590_0002729 3300046457 Bacteria 7285
194 Ga0495638_0000440 3300046460 Bacteria 50160
195 Ga0495638_0001973 3300046460 Bacteria 17547
196 Ga0495638_0005482 3300046460 Bacteria 9433
197 Ga0495638_0019185 3300046460 Bacteria 4526
198 Ga0495650_0000083 3300046471 Bacteria 237725
199 Ga0495650_0000217 3300046471 Bacteria 120688
200 Ga0495582_0168146 3300046473 Bacteria 1248
201 Ga0495584_0010039 3300046491 Bacteria 4860
202 Ga0495585_0149828 3300046492 Bacteria 1217
203 Ga0495583_0000002 3300046506 Bacteria 782521
204 Ga0495583_0000351 3300046506 Bacteria 72601
205 Ga0495583_0026820 3300046506 Bacteria 2850
206 Ga0495606_0010372 3300046507 Bacteria 7743
207 Ga0495610_0000157 3300046512 Bacteria 75701
208 Ga0495610_0010052 3300046512 Bacteria 5910
209 Ga0495610_0013395 3300046512 Bacteria 4875
210 Ga0495616_0000286 3300046513 Bacteria 40792
211 Ga0495616_0117995 3300046513 Bacteria 1227
212 Ga0495620_0024675 3300046515 Bacteria 2856
213 Ga0495620_0033976 3300046515 Bacteria 2309
214 Ga0495628_0250418 3300046516 Bacteria 1323
215 Ga0495631_0009346 3300046518 Bacteria 4898
216 Ga0495632_0044798 3300046519 Bacteria 2206
217 Ga0495632_0180418 3300046519 Bacteria 967
218 Ga0495637_0056566 3300046520 Bacteria 1623
219 Ga0495637_0064825 3300046520 Bacteria 1489
220 Ga0495643_0000093 3300046522 Bacteria 152412
221 Ga0495643_0266437 3300046522 Bacteria 793
222 Ga0495648_0000097 3300046524 Bacteria 109887
223 Ga0495648_0003568 3300046524 Bacteria 13615
224 Ga0495648_0032738 3300046524 Bacteria 3406
225 Ga0495648_0201887 3300046524 Bacteria 994
226 Ga0495663_0003193 3300046525 Bacteria 4775
227 Ga0495663_0018377 3300046525 Bacteria 1991
228 Ga0495654_0000042 3300046530 Bacteria 164346
229 Ga0495654_0203913 3300046530 Bacteria 845
230 Ga0495597_0128717 3300046542 Bacteria 1051
231 Ga0495622_0000566 3300046557 Bacteria 22206
232 Ga0495622_0000745 3300046557 Bacteria 18213
233 Ga0495633_0032115 3300046558 Bacteria 2538
234 Ga0495633_0047820 3300046558 Bacteria 2021
235 Ga0495668_0000587 3300046616 Bacteria 44244
236 Ga0495668_0006641 3300046616 Bacteria 7537
237 Ga0495668_0013954 3300046616 Bacteria 4723
238 Ga0495668_0021480 3300046616 Bacteria 3701
239 Ga0495611_0004517 3300046648 Bacteria 6003
240 Ga0495625_0000170 3300046660 Bacteria 102224
241 Ga0495625_0003323 3300046660 Bacteria 16204
242 Ga0495625_0004480 3300046660 Bacteria 13189
243 Ga0495625_0004911 3300046660 Bacteria 12447
244 Ga0495625_0015799 3300046660 Bacteria 5960
245 Ga0495625_0043822 3300046660 Bacteria 3242
246 Ga0495625_0048871 3300046660 Bacteria 3042
247 Ga0495625_0186236 3300046660 Bacteria 1377
248 Ga0495661_0123359 3300046665 Bacteria 1428
249 Ga0495669_0000023 3300046684 Bacteria 117158
250 Ga0495670_0256122 3300046691 Bacteria 933
251 Ga0495671_0072336 3300046692 Bacteria 1693
252 Ga0495671_0184213 3300046692 Bacteria 1014
253 Ga0495600_0005725 3300046809 Bacteria 7506
254 Ga0495660_0039095 3300046810 Bacteria 2636
255 Ga0495660_0112512 3300046810 Bacteria 1387
256 Ga0495660_0156982 3300046810 Bacteria 1119
257 Ga0495672_0004122 3300047320 Bacteria 12099
258 Ga0495683_0004660 3300047323 Bacteria 7727
259 Ga0495687_000076 3300047443 Bacteria 149259
260 Ga0495679_003056 3300047446 Bacteria 8223
261 Ga0495673_0000147 3300047469 Bacteria 125742
262 Ga0495673_0006447 3300047469 Bacteria 6895
263 Ga0495673_0011747 3300047469 Bacteria 4688
264 Ga0495673_0033295 3300047469 Bacteria 2393
265 Ga0495686_0001764 3300047472 Bacteria 22143
266 Ga0495686_0007138 3300047472 Bacteria 8412
267 Ga0495686_0012743 3300047472 Bacteria 5867
268 Ga0495686_0019911 3300047472 Bacteria 4478
269 Ga0495686_0069581 3300047472 Bacteria 2169
270 Ga0495686_0146979 3300047472 Bacteria 1386
271 Ga0495602_0204078 3300048088 Bacteria 1506
272 Ga0495615_0068097 3300048090 Bacteria 954
273 Ga0496102_0000163 3300048905 Bacteria 89673
274 Ga0496103_0000052 3300048906 Bacteria 149437
275 Ga0496104_0073135 3300048907 Bacteria 3261
276 Ga0496105_0001454 3300048908 Bacteria 16680
277 Ga0496106_0014673 3300048909 Bacteria 5791
278 Ga0496107_0000042 3300048910 Bacteria 75015
279 Ga0496109_0448111 3300048912 Bacteria 1219
280 Ga0496111_0023674 3300048914 Bacteria 4314
281 Ga0496113_0019371 3300048916 Bacteria 4759
282 Ga0496114_0019331 3300048917 Bacteria 5519
283 Ga0496115_0000078 3300048918 Bacteria 89817
284 Ga0496115_0062704 3300048918 Bacteria 2999
285 Ga0496116_0009792 3300048919 Bacteria 8127
286 Ga0496117_0000141 3300048920 Bacteria 158041
287 Ga0496118_0000103 3300048921 Bacteria 158099
288 Ga0496119_0048477 3300048922 Bacteria 2633
289 Ga0496121_0000156 3300048924 Bacteria 149376
290 Ga0496121_0000319 3300048924 Bacteria 100692
291 Ga0496121_0000794 3300048924 Bacteria 57780
292 Ga0496121_0004591 3300048924 Bacteria 18409
293 Ga0496121_0027518 3300048924 Bacteria 5319
294 Ga0496121_0194687 3300048924 Bacteria 1450
295 Ga0496122_0005782 3300048925 Bacteria 14559
296 Ga0496123_0007297 3300048926 Bacteria 10485
297 Ga0496123_0209255 3300048926 Bacteria 993
298 Ga0496124_0000041 3300048927 Bacteria 303887
299 Ga0496124_0047707 3300048927 Bacteria 3663
300 Ga0496125_0001443 3300048928 Bacteria 34571
301 Ga0496125_0011591 3300048928 Bacteria 8807
302 Ga0496126_0000155 3300048929 Bacteria 158816
303 Ga0496126_0009898 3300048929 Bacteria 10074
304 Ga0496126_0024130 3300048929 Bacteria 5875
305 Ga0496126_0508007 3300048929 Bacteria 962
306 Ga0495678_004170 3300049459 Bacteria 8525
307 Ga0495682_0001113 3300049460 Bacteria 15638
308 Ga0495682_0024811 3300049460 Bacteria 2234
309 Ga0501034_0044040 3300049571 Bacteria 4514
310 Ga0501047_0441166 3300049581 Bacteria 1132
311 Ga0501198_003137 3300049649 Bacteria 2247
312 Ga0501223_000106 3300049663 Bacteria 24016
313 Ga0501224_000007 3300049664 Bacteria 127654
314 Ga0501233_000050 3300049668 Bacteria 16101
315 Ga0501235_000245 3300049669 Bacteria 9923
316 Ga0501238_002676 3300049671 Bacteria 2146
317 Ga0501225_0000100 3300049705 Bacteria 27639
318 Ga0501234_003389 3300049707 Bacteria 2506
319 Ga0501226_000025 3300049853 Bacteria 91197
320 nmdc:mga0k408_126957_c1 3300050493 Bacteria 1513
321 nmdc:mga0k408_150298_c1 3300050493 Bacteria 1387
322 nmdc:mga0k408_16530_c1 3300050493 Bacteria 4095
323 nmdc:mga0sz30_12805_c1 3300050516 Bacteria 3269
324 Ga0500610_0000096 3300053079 Bacteria 26013
325 Ga0500578_0000692 3300053086 Bacteria 40321
326 Ga0500643_014159 3300053087 Bacteria 2784
327 Ga0500643_018371 3300053087 Bacteria 2321
328 Ga0500644_0000132 3300053088 Bacteria 45910
329 Ga0500644_0063815 3300053088 Bacteria 1306
330 Ga0500566_0251983 3300053094 Bacteria 858
331 Ga0500641_0087874 3300053096 Bacteria 1325
332 Ga0500650_0181632 3300053098 Bacteria 964
333 Ga0500554_002279 3300053102 Bacteria 3747
334 Ga0500556_0000013 3300053104 Bacteria 243797
335 Ga0500556_0007202 3300053104 Bacteria 3177
336 Ga0500594_0000944 3300053118 Bacteria 6251
337 Ga0500595_001269 3300053119 Bacteria 13814
338 Ga0500608_000079 3300053122 Bacteria 41088
339 Ga0500614_014838 3300053123 Bacteria 1731
340 Ga0500618_000059 3300053125 Bacteria 97360
341 Ga0500642_0000002 3300053130 Bacteria 795093
342 Ga0500642_0000837 3300053130 Bacteria 8979
343 Ga0500655_024744 3300053133 Bacteria 1137
344 Ga0500658_0001907 3300053134 Bacteria 8174
345 Ga0500559_0000412 3300053136 Bacteria 30720
346 Ga0500559_0009365 3300053136 Bacteria 4244
347 Ga0500559_0111862 3300053136 Bacteria 1265
348 Ga0500564_006325 3300053138 Bacteria 4933
349 Ga0500577_0008989 3300053142 Bacteria 2880
350 Ga0500616_0000074 3300053153 Bacteria 222910
351 Ga0500622_0005946 3300053156 Bacteria 7187
352 Ga0500622_0017816 3300053156 Bacteria 3778
353 Ga0500624_000101 3300053157 Bacteria 41193
354 Ga0500636_0004742 3300053177 Bacteria 7710
355 Ga0500645_000003 3300053730 Bacteria 305887
356 Ga0500645_000105 3300053730 Bacteria 67078
357 Ga0500645_003611 3300053730 Bacteria 6198
358 Ga0500645_006927 3300053730 Bacteria 3999
359 Ga0500609_002580 3300053731 Bacteria 2579
360 Ga0500601_000033 3300053737 Bacteria 29161

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031731 Ga0307405_10024087 Ga0307405_100240872 221
2 3300031824 Ga0307413_10128946 Ga0307413_101289462 221
3 3300031911 Ga0307412_10009508 Ga0307412_100095082 221
4 3300032002 Ga0307416_100016230 Ga0307416_1000162303 221
5 3300009553 Ga0105249_10630958 Ga0105249_106309582 227
6 3300035170 Ga0373943_0170055 Ga0373943_0170055_490_1176 227
7 3300037853 Ga0436364_0529752 Ga0436364_0529752_3526_4212 227
8 3300015684 Ga0183365_10005 Ga0183365_10005152 229
9 3300013104 Ga0157370_10151669 Ga0157370_101516692 230
10 3300003771 Ga0055526_1010390 Ga0055526_10103903 235
11 3300003775 Ga0055524_1021436 Ga0055524_10214361 235
12 3300003791 Ga0055530_10001374 Ga0055530_100013744 235
13 3300003794 Ga0055531_10015275 Ga0055531_100152752 235
14 3300046660 Ga0495625_0003323 Ga0495625_0003323_885_1637 237
15 3300046660 Ga0495625_0004480 Ga0495625_0004480_1198_1944 237
16 3300048909 Ga0496106_0014673 Ga0496106_0014673_3775_4527 237
17 3300048910 Ga0496107_0000042 Ga0496107_0000042_20983_21735 237
18 3300048924 Ga0496121_0000794 Ga0496121_0000794_53854_54606 237
19 3300046530 Ga0495654_0203913 Ga0495654_0203913_29_745 238
20 3300048090 Ga0495615_0068097 Ga0495615_0068097_36_752 238
21 3300025245 Ga0207425_1016036 Ga0207425_10160362 239
22 3300049460 Ga0495682_0024811 Ga0495682_0024811_417_1196 241
23 3300028786 Ga0307517_10012028 Ga0307517_1001202811 242
24 3300046512 Ga0495610_0010052 Ga0495610_0010052_3800_4546 242
25 3300046524 Ga0495648_0032738 Ga0495648_0032738_750_1529 242
26 3300046558 Ga0495633_0047820 Ga0495633_0047820_1073_1837 242
27 3300047472 Ga0495686_0146979 Ga0495686_0146979_234_980 242
28 3300053157 Ga0500624_000101 Ga0500624_000101_34408_35172 242
29 3300003781 Ga0055536_1000653 Ga0055536_100065316 243
30 3300003781 Ga0055536_1000964 Ga0055536_10009647 243
31 3300003791 Ga0055530_10001170 Ga0055530_1000117015 243
32 3300003791 Ga0055530_10018714 Ga0055530_100187142 243
33 3300003794 Ga0055531_10000646 Ga0055531_1000064618 243
34 3300003794 Ga0055531_10036604 Ga0055531_100366041 243
35 3300006186 Ga0075369_10037077 Ga0075369_100370772 243
36 3300006195 Ga0075366_10007023 Ga0075366_100070233 243
37 3300006353 Ga0075370_10100081 Ga0075370_101000812 243
38 3300025292 Ga0209676_1000043 Ga0209676_100004318 243
39 3300025292 Ga0209676_1000712 Ga0209676_100071216 243
40 3300025295 Ga0209564_1022706 Ga0209564_10227062 243
41 3300025298 Ga0209050_1000559 Ga0209050_100055916 243
42 3300025298 Ga0209050_1001103 Ga0209050_100110315 243
43 3300025303 Ga0209051_1002278 Ga0209051_10022789 243
44 3300025304 Ga0209257_1000134 Ga0209257_100013480 243
45 3300025304 Ga0209257_1008106 Ga0209257_10081067 243
46 3300046453 Ga0495627_002017 Ga0495627_002017_8170_8916 243
47 3300046460 Ga0495638_0019185 Ga0495638_0019185_655_1401 243
48 3300046616 Ga0495668_0013954 Ga0495668_0013954_2633_3382 243
49 3300046660 Ga0495625_0000170 Ga0495625_0000170_82545_83291 243
50 3300046660 Ga0495625_0043822 Ga0495625_0043822_513_1262 243
51 3300046810 Ga0495660_0156982 Ga0495660_0156982_41_787 243
52 3300047469 Ga0495673_0000147 Ga0495673_0000147_105568_106314 243
53 3300048917 Ga0496114_0019331 Ga0496114_0019331_2378_3109 243
54 3300048927 Ga0496124_0047707 Ga0496124_0047707_2804_3553 243
55 3300048928 Ga0496125_0011591 Ga0496125_0011591_5358_6107 243
56 3300048929 Ga0496126_0009898 Ga0496126_0009898_567_1316 243
57 3300050493 nmdc:mga0k408_16530_c1 nmdc:mga0k408_16530_c1_1300_2049 243
58 3300050516 nmdc:mga0sz30_12805_c1 nmdc:mga0sz30_12805_c1_870_1619 243
59 3300053094 Ga0500566_0251983 Ga0500566_0251983_26_772 243
60 3300053136 Ga0500559_0009365 Ga0500559_0009365_60_806 243
61 3300025284 Ga0209130_1002498 Ga0209130_10024986 244
62 3300025291 Ga0209675_1023894 Ga0209675_10238942 244
63 3300025292 Ga0209676_1004038 Ga0209676_10040383 244
64 3300025298 Ga0209050_1001731 Ga0209050_10017316 244
65 3300025299 Ga0209256_1008649 Ga0209256_10086494 244
66 3300025304 Ga0209257_1000452 Ga0209257_10004526 244
67 3300025304 Ga0209257_1018216 Ga0209257_10182163 244
68 iso_pu_bacteria 2510917020 2511123768 244
69 iso_pu_bacteria 2582581280 2585152040 244
70 iso_pu_bacteria 2582581293 2585194474 244
71 iso_pu_bacteria 2643221552 2643782942 244
72 iso_pu_bacteria 2643221584 2643928252 244
73 iso_pu_bacteria 2791355048 2792460473 244
74 iso_pu_bacteria 2818991435 2819539417 244
75 iso_pu_bacteria 2818991454 2819647709 244
76 iso_pu_bacteria 2843744320 2843744567 244
77 iso_pu_bacteria 2849560528 2849565535 244
78 iso_pu_bacteria 2849573788 2849575649 244
79 iso_pu_bacteria 2851153111 2851153249 244
80 iso_pu_bacteria 2857504554 2857507161 244
81 iso_pu_bacteria 2898329390 2898331711 244
82 3300003794 Ga0055531_10020118 Ga0055531_100201182 245
83 3300025294 Ga0209025_1000864 Ga0209025_10008646 245
84 3300025304 Ga0209257_1001064 Ga0209257_10010646 245
85 3300046515 Ga0495620_0024675 Ga0495620_0024675_1847_2626 245
86 3300046691 Ga0495670_0256122 Ga0495670_0256122_44_823 245
87 3300047472 Ga0495686_0012743 Ga0495686_0012743_3753_4532 245
88 3300047472 Ga0495686_0069581 Ga0495686_0069581_1022_1801 245
89 3300048924 Ga0496121_0194687 Ga0496121_0194687_280_1059 245
90 3300049671 Ga0501238_002676 Ga0501238_002676_618_1397 245
91 3300053102 Ga0500554_002279 Ga0500554_002279_2886_3668 245
92 3300053123 Ga0500614_014838 Ga0500614_014838_661_1443 245
93 iso_pu_bacteria 2582581279 2585147639 245
94 iso_pu_bacteria 2585428106 2587917588 245
95 iso_pu_bacteria 2643221640 2644226887 245
96 iso_pu_bacteria 2643221642 2644233645 245
97 iso_pu_bacteria 2884960567 2884961859 245
98 iso_pu_bacteria 2928531327 2928536028 245
99 3300033180 Ga0307510_10104057 Ga0307510_101040572 247
100 3300046471 Ga0495650_0000083 Ga0495650_0000083_166511_167308 247
101 3300046473 Ga0495582_0168146 Ga0495582_0168146_303_1100 247
102 3300046506 Ga0495583_0000351 Ga0495583_0000351_64758_65555 247
103 3300046557 Ga0495622_0000745 Ga0495622_0000745_13809_14606 247
104 3300046558 Ga0495633_0032115 Ga0495633_0032115_995_1792 247
105 3300046665 Ga0495661_0123359 Ga0495661_0123359_570_1367 247
106 3300046809 Ga0495600_0005725 Ga0495600_0005725_619_1416 247
107 3300053119 Ga0500595_001269 Ga0500595_001269_12888_13685 247
108 3300053177 Ga0500636_0004742 Ga0500636_0004742_4846_5643 247
109 3300003794 Ga0055531_10006560 Ga0055531_100065602 248
110 3300005344 Ga0070661_100006919 Ga0070661_1000069195 248
111 3300005563 Ga0068855_100000047 Ga0068855_10000004742 248
112 3300005617 Ga0068859_100002646 Ga0068859_1000026464 248
113 3300005719 Ga0068861_100000084 Ga0068861_10000008426 248
114 3300006353 Ga0075370_10083706 Ga0075370_100837062 248
115 3300006358 Ga0068871_100333516 Ga0068871_1003335162 248
116 3300006931 Ga0097620_100002646 Ga0097620_1000026464 248
117 3300009093 Ga0105240_10000647 Ga0105240_1000064724 248
118 3300009101 Ga0105247_10045830 Ga0105247_100458302 248
119 3300009177 Ga0105248_10003056 Ga0105248_1000305612 248
120 3300009545 Ga0105237_10120051 Ga0105237_101200512 248
121 3300010375 Ga0105239_10001683 Ga0105239_1000168324 248
122 3300013105 Ga0157369_10010530 Ga0157369_100105302 248
123 3300013307 Ga0157372_10449669 Ga0157372_104496692 248
124 3300017792 Ga0163161_10189807 Ga0163161_101898072 248
125 3300025298 Ga0209050_1022876 Ga0209050_10228762 248
126 3300025299 Ga0209256_1014548 Ga0209256_10145482 248
127 3300025304 Ga0209257_1000200 Ga0209257_100020071 248
128 3300025911 Ga0207654_10103877 Ga0207654_101038772 248
129 3300025913 Ga0207695_10000003 Ga0207695_10000003736 248
130 3300025920 Ga0207649_10013619 Ga0207649_100136192 248
131 3300025920 Ga0207649_10496652 Ga0207649_104966521 248
132 3300025924 Ga0207694_10000011 Ga0207694_1000001185 248
133 3300025941 Ga0207711_10001846 Ga0207711_100018468 248
134 3300025949 Ga0207667_10000050 Ga0207667_10000050120 248
135 3300026118 Ga0207675_100000166 Ga0207675_10000016648 248
136 3300028786 Ga0307517_10215329 Ga0307517_102153292 248
137 3300028794 Ga0307515_10090947 Ga0307515_100909473 248
138 3300028794 Ga0307515_10115900 Ga0307515_101159003 248
139 3300031240 Ga0265320_10017331 Ga0265320_100173313 248
140 3300031730 Ga0307516_10014691 Ga0307516_100146915 248
141 3300042436 Ga0439435_0068059 Ga0439435_0068059_110_856 248
142 3300044693 Ga0466961_0162879 Ga0466961_0162879_475_1221 248
143 3300045049 Ga0466959_0055331 Ga0466959_0055331_2074_2820 248
144 3300046457 Ga0495590_0002729 Ga0495590_0002729_1291_2037 248
145 3300046460 Ga0495638_0001973 Ga0495638_0001973_1410_2156 248
146 3300046460 Ga0495638_0005482 Ga0495638_0005482_1208_1954 248
147 3300046492 Ga0495585_0149828 Ga0495585_0149828_207_953 248
148 3300046507 Ga0495606_0010372 Ga0495606_0010372_5005_5757 248
149 3300046512 Ga0495610_0013395 Ga0495610_0013395_105_851 248
150 3300046513 Ga0495616_0000286 Ga0495616_0000286_38078_38824 248
151 3300046513 Ga0495616_0117995 Ga0495616_0117995_69_815 248
152 3300046519 Ga0495632_0044798 Ga0495632_0044798_50_796 248
153 3300046519 Ga0495632_0180418 Ga0495632_0180418_157_909 248
154 3300046520 Ga0495637_0056566 Ga0495637_0056566_674_1426 248
155 3300046520 Ga0495637_0064825 Ga0495637_0064825_401_1147 248
156 3300046522 Ga0495643_0266437 Ga0495643_0266437_22_768 248
157 3300046524 Ga0495648_0201887 Ga0495648_0201887_191_943 248
158 3300046525 Ga0495663_0018377 Ga0495663_0018377_322_1074 248
159 3300046616 Ga0495668_0000587 Ga0495668_0000587_15379_16125 248
160 3300046616 Ga0495668_0006641 Ga0495668_0006641_4861_5607 248
161 3300046660 Ga0495625_0048871 Ga0495625_0048871_1785_2537 248
162 3300046660 Ga0495625_0186236 Ga0495625_0186236_67_819 248
163 3300046692 Ga0495671_0184213 Ga0495671_0184213_148_894 248
164 3300046810 Ga0495660_0039095 Ga0495660_0039095_1049_1795 248
165 3300046810 Ga0495660_0112512 Ga0495660_0112512_567_1313 248
166 3300047320 Ga0495672_0004122 Ga0495672_0004122_1470_2222 248
167 3300047446 Ga0495679_003056 Ga0495679_003056_6146_6898 248
168 3300047472 Ga0495686_0001764 Ga0495686_0001764_18980_19726 248
169 3300047472 Ga0495686_0019911 Ga0495686_0019911_2280_3026 248
170 3300048088 Ga0495602_0204078 Ga0495602_0204078_408_1154 248
171 3300049459 Ga0495678_004170 Ga0495678_004170_3993_4739 248
172 3300049460 Ga0495682_0001113 Ga0495682_0001113_13314_14060 248
173 3300049581 Ga0501047_0441166 Ga0501047_0441166_259_1005 248
174 3300050493 nmdc:mga0k408_126957_c1 nmdc:mga0k408_126957_c1_73_819 248
175 3300053086 Ga0500578_0000692 Ga0500578_0000692_21382_22128 248
176 3300053088 Ga0500644_0063815 Ga0500644_0063815_507_1253 248
177 3300053104 Ga0500556_0007202 Ga0500556_0007202_1776_2528 248
178 3300053118 Ga0500594_0000944 Ga0500594_0000944_3995_4741 248
179 3300053122 Ga0500608_000079 Ga0500608_000079_22411_23157 248
180 3300053125 Ga0500618_000059 Ga0500618_000059_12362_13114 248
181 3300053133 Ga0500655_024744 Ga0500655_024744_269_1015 248
182 3300053134 Ga0500658_0001907 Ga0500658_0001907_6982_7734 248
183 3300053136 Ga0500559_0000412 Ga0500559_0000412_15240_15992 248
184 3300053136 Ga0500559_0111862 Ga0500559_0111862_151_897 248
185 3300053142 Ga0500577_0008989 Ga0500577_0008989_1937_2683 248
186 3300053156 Ga0500622_0005946 Ga0500622_0005946_3978_4724 248
187 3300053156 Ga0500622_0017816 Ga0500622_0017816_947_1693 248
188 3300053730 Ga0500645_006927 Ga0500645_006927_1443_2195 248
189 3300053731 Ga0500609_002580 Ga0500609_002580_1200_1946 248
190 iso_pu_bacteria 2830075706 2830076957 248
191 iso_pu_bacteria 2990265787 2990266009 248
192 iso_pu_bacteria 2993693658 2993696199 248
193 3300031250 Ga0265331_10040923 Ga0265331_100409232 249
194 3300031344 Ga0265316_10059336 Ga0265316_100593362 249
195 3300031595 Ga0265313_10077845 Ga0265313_100778452 249
196 3300031712 Ga0265342_10137823 Ga0265342_101378232 249
197 3300046524 Ga0495648_0003568 Ga0495648_0003568_10087_10836 249
198 3300047469 Ga0495673_0011747 Ga0495673_0011747_1221_1970 249
199 3300053087 Ga0500643_014159 Ga0500643_014159_1120_1869 249
200 3300053088 Ga0500644_0000132 Ga0500644_0000132_256_1005 249
201 3300053138 Ga0500564_006325 Ga0500564_006325_1374_2123 249
202 3300003773 Ga0055537_1001969 Ga0055537_10019694 251
203 3300003775 Ga0055524_1010010 Ga0055524_10100103 251
204 3300003790 Ga0055528_1004650 Ga0055528_10046503 251
205 3300025263 Ga0209565_1000140 Ga0209565_100014046 251
206 3300025273 Ga0209673_1000630 Ga0209673_100063038 251
207 3300025291 Ga0209675_1005092 Ga0209675_10050923 251
208 3300025295 Ga0209564_1032062 Ga0209564_10320621 251
209 3300025299 Ga0209256_1009010 Ga0209256_10090103 251
210 3300047469 Ga0495673_0006447 Ga0495673_0006447_6043_6822 251
211 3300013105 Ga0157369_10112576 Ga0157369_101125763 252
212 3300026078 Ga0207702_10327762 Ga0207702_103277622 252
213 3300028800 Ga0265338_10122560 Ga0265338_101225602 252
214 3300037471 Ga0395905_0005061 Ga0395905_0005061_11944_12702 252
215 3300046515 Ga0495620_0033976 Ga0495620_0033976_198_956 252
216 3300048926 Ga0496123_0209255 Ga0496123_0209255_159_926 252
217 3300048929 Ga0496126_0508007 Ga0496126_0508007_15_773 252
218 iso_pu_bacteria 2599185354 2600202855 252
219 iso_pu_bacteria 2643221545 2643748655 252
220 iso_pu_bacteria 2643221691 2644510330 252
221 iso_pu_bacteria 2889306138 2889310544 252
222 3300046506 Ga0495583_0000002 Ga0495583_0000002_528198_528992 253
223 3300049571 Ga0501034_0044040 Ga0501034_0044040_2413_3174 253
224 3300053737 Ga0500601_000033 Ga0500601_000033_22827_23594 253
225 3300031251 Ga0265327_10002310 Ga0265327_100023106 254
226 3300031711 Ga0265314_10105653 Ga0265314_101056532 254
227 3300041459 Ga0451800_1440841 Ga0451800_1440841_328_1098 254
228 3300046516 Ga0495628_0250418 Ga0495628_0250418_295_1059 254
229 iso_pu_bacteria 2595698237 2596374570 254
230 iso_pu_bacteria 2902330777 2902335762 254
231 iso_pu_bacteria 2919138771 2919143511 254
232 iso_pu_bacteria 2928125067 2928125133 254
233 3300048924 Ga0496121_0027518 Ga0496121_0027518_1767_2534 255
234 3300003775 Ga0055524_1011340 Ga0055524_10113404 256
235 3300025295 Ga0209564_1006541 Ga0209564_10065413 256
236 3300025299 Ga0209256_1001549 Ga0209256_100154924 256
237 3300025981 Ga0207640_10282439 Ga0207640_102824391 256
238 3300028794 Ga0307515_10208156 Ga0307515_102081562 256
239 3300046471 Ga0495650_0000217 Ga0495650_0000217_8875_9654 256
240 3300046512 Ga0495610_0000157 Ga0495610_0000157_34543_35322 256
241 3300046530 Ga0495654_0000042 Ga0495654_0000042_31858_32637 256
242 3300046542 Ga0495597_0128717 Ga0495597_0128717_174_944 256
243 3300046616 Ga0495668_0021480 Ga0495668_0021480_2637_3407 256
244 3300046660 Ga0495625_0004911 Ga0495625_0004911_3509_4279 256
245 3300048918 Ga0496115_0062704 Ga0496115_0062704_631_1410 256
246 3300050493 nmdc:mga0k408_150298_c1 nmdc:mga0k408_150298_c1_265_1050 256
247 3300053087 Ga0500643_018371 Ga0500643_018371_1496_2266 256
248 3300053098 Ga0500650_0181632 Ga0500650_0181632_41_811 256
249 3300053104 Ga0500556_0000013 Ga0500556_0000013_88159_88929 256
250 3300053130 Ga0500642_0000002 Ga0500642_0000002_316564_317334 256
251 3300053730 Ga0500645_000105 Ga0500645_000105_6321_7091 256
252 iso_pu_bacteria 2643221583 2643924054 256
253 3300035695 Ga0373927_0071414 Ga0373927_0071414_1174_1950 257
254 3300037068 Ga0373925_0113756 Ga0373925_0113756_1014_1790 257
255 iso_pu_bacteria 2928027323 2928030147 257
256 iso_pu_bacteria 2984555340 2984556854 257
257 iso_pu_bacteria 2984564862 2984564986 257
258 iso_pu_bacteria 2993356040 2993356050 257
259 3300001915 JGI24741J21665_1001835 JGI24741J21665_10018354 258
260 3300001979 JGI24740J21852_10000779 JGI24740J21852_100007793 258
261 3300001990 JGI24737J22298_10001412 JGI24737J22298_100014123 258
262 3300003759 Ga0055525_1000096 Ga0055525_100009633 258
263 3300003762 Ga0055542_1000012 Ga0055542_1000012332 258
264 3300003763 Ga0055529_1000002 Ga0055529_1000002248 258
265 3300003763 Ga0055529_1000021 Ga0055529_1000021233 258
266 3300003791 Ga0055530_10000579 Ga0055530_1000057929 258
267 3300003794 Ga0055531_10003351 Ga0055531_100033514 258
268 3300005327 Ga0070658_10000196 Ga0070658_1000019633 258
269 3300005339 Ga0070660_100016365 Ga0070660_1000163652 258
270 3300005344 Ga0070661_100002495 Ga0070661_1000024957 258
271 3300005354 Ga0070675_100308949 Ga0070675_1003089491 258
272 3300005356 Ga0070674_100118658 Ga0070674_1001186582 258
273 3300005366 Ga0070659_100016509 Ga0070659_1000165092 258
274 3300005455 Ga0070663_100270666 Ga0070663_1002706661 258
275 3300005456 Ga0070678_100000055 Ga0070678_10000005532 258
276 3300005459 Ga0068867_100002955 Ga0068867_1000029552 258
277 3300005535 Ga0070684_100059523 Ga0070684_1000595233 258
278 3300005539 Ga0068853_100074121 Ga0068853_1000741213 258
279 3300005563 Ga0068855_100027779 Ga0068855_1000277793 258
280 3300005564 Ga0070664_100006220 Ga0070664_1000062203 258
281 3300005577 Ga0068857_100384080 Ga0068857_1003840802 258
282 3300005578 Ga0068854_100023707 Ga0068854_1000237074 258
283 3300005616 Ga0068852_100174465 Ga0068852_1001744652 258
284 3300006237 Ga0097621_100028194 Ga0097621_1000281942 258
285 3300006881 Ga0068865_100095523 Ga0068865_1000955232 258
286 3300009093 Ga0105240_10002690 Ga0105240_1000269022 258
287 3300009148 Ga0105243_10000227 Ga0105243_1000022736 258
288 3300009174 Ga0105241_10000352 Ga0105241_100003527 258
289 3300009545 Ga0105237_10067799 Ga0105237_100677993 258
290 3300010375 Ga0105239_10100931 Ga0105239_101009313 258
291 3300013100 Ga0157373_10010643 Ga0157373_100106432 258
292 3300013102 Ga0157371_10000094 Ga0157371_1000009415 258
293 3300013105 Ga0157369_10134641 Ga0157369_101346412 258
294 3300013307 Ga0157372_10075910 Ga0157372_100759104 258
295 3300013308 Ga0157375_10386806 Ga0157375_103868061 258
296 3300025226 Ga0209674_102709 Ga0209674_1027093 258
297 3300025246 Ga0209646_1003506 Ga0209646_10035063 258
298 3300025254 Ga0209148_1000008 Ga0209148_1000008965 258
299 3300025272 Ga0209455_1000002 Ga0209455_1000002460 258
300 3300025297 Ga0209758_1000924 Ga0209758_10009243 258
301 3300025298 Ga0209050_1000049 Ga0209050_100004938 258
302 3300025304 Ga0209257_1000692 Ga0209257_100069242 258
303 3300025304 Ga0209257_1001841 Ga0209257_100184117 258
304 3300025321 Ga0207656_10001687 Ga0207656_100016872 258
305 3300025904 Ga0207647_10016955 Ga0207647_100169552 258
306 3300025909 Ga0207705_10000183 Ga0207705_1000018336 258
307 3300025911 Ga0207654_10000020 Ga0207654_1000002063 258
308 3300025913 Ga0207695_10009971 Ga0207695_100099713 258
309 3300025914 Ga0207671_10028216 Ga0207671_100282162 258
310 3300025919 Ga0207657_10000140 Ga0207657_1000014049 258
311 3300025920 Ga0207649_10002882 Ga0207649_100028823 258
312 3300025924 Ga0207694_10000878 Ga0207694_100008785 258
313 3300025926 Ga0207659_10099885 Ga0207659_100998852 258
314 3300025932 Ga0207690_10000063 Ga0207690_1000006320 258
315 3300025933 Ga0207706_10008063 Ga0207706_100080637 258
316 3300025934 Ga0207686_10095705 Ga0207686_100957052 258
317 3300025935 Ga0207709_10000093 Ga0207709_1000009348 258
318 3300025937 Ga0207669_10000086 Ga0207669_100000864 258
319 3300025938 Ga0207704_10047594 Ga0207704_100475943 258
320 3300025949 Ga0207667_10000006 Ga0207667_10000006137 258
321 3300025981 Ga0207640_10001108 Ga0207640_100011089 258
322 3300026023 Ga0207677_10232238 Ga0207677_102322382 258
323 3300026041 Ga0207639_10010063 Ga0207639_100100634 258
324 3300026067 Ga0207678_10002329 Ga0207678_100023293 258
325 3300026078 Ga0207702_10000713 Ga0207702_100007137 258
326 3300026089 Ga0207648_10059597 Ga0207648_100595973 258
327 3300026116 Ga0207674_10048345 Ga0207674_100483453 258
328 3300026121 Ga0207683_10000181 Ga0207683_1000018123 258
329 3300026142 Ga0207698_10035277 Ga0207698_100352774 258
330 3300046460 Ga0495638_0000440 Ga0495638_0000440_39763_40557 258
331 3300046491 Ga0495584_0010039 Ga0495584_0010039_2328_3104 258
332 3300046506 Ga0495583_0026820 Ga0495583_0026820_1159_1935 258
333 3300046518 Ga0495631_0009346 Ga0495631_0009346_829_1605 258
334 3300046524 Ga0495648_0000097 Ga0495648_0000097_94186_94962 258
335 3300046525 Ga0495663_0003193 Ga0495663_0003193_1809_2585 258
336 3300046648 Ga0495611_0004517 Ga0495611_0004517_2147_2923 258
337 3300046660 Ga0495625_0015799 Ga0495625_0015799_4764_5540 258
338 3300046684 Ga0495669_0000023 Ga0495669_0000023_71448_72224 258
339 3300046692 Ga0495671_0072336 Ga0495671_0072336_729_1505 258
340 3300047323 Ga0495683_0004660 Ga0495683_0004660_1517_2293 258
341 3300047443 Ga0495687_000076 Ga0495687_000076_66448_67224 258
342 3300047469 Ga0495673_0033295 Ga0495673_0033295_1476_2252 258
343 3300047472 Ga0495686_0007138 Ga0495686_0007138_463_1239 258
344 3300048905 Ga0496102_0000163 Ga0496102_0000163_2237_3013 258
345 3300048906 Ga0496103_0000052 Ga0496103_0000052_70636_71412 258
346 3300048907 Ga0496104_0073135 Ga0496104_0073135_1923_2699 258
347 3300048908 Ga0496105_0001454 Ga0496105_0001454_736_1512 258
348 3300048912 Ga0496109_0448111 Ga0496109_0448111_106_882 258
349 3300048914 Ga0496111_0023674 Ga0496111_0023674_1992_2768 258
350 3300048916 Ga0496113_0019371 Ga0496113_0019371_2821_3597 258
351 3300048918 Ga0496115_0000078 Ga0496115_0000078_86694_87470 258
352 3300048919 Ga0496116_0009792 Ga0496116_0009792_4775_5551 258
353 3300048920 Ga0496117_0000141 Ga0496117_0000141_86629_87405 258
354 3300048921 Ga0496118_0000103 Ga0496118_0000103_86687_87463 258
355 3300048922 Ga0496119_0048477 Ga0496119_0048477_1108_1884 258
356 3300048924 Ga0496121_0000156 Ga0496121_0000156_70618_71394 258
357 3300048925 Ga0496122_0005782 Ga0496122_0005782_4558_5334 258
358 3300048926 Ga0496123_0007297 Ga0496123_0007297_7735_8511 258
359 3300048927 Ga0496124_0000041 Ga0496124_0000041_72509_73285 258
360 3300048928 Ga0496125_0001443 Ga0496125_0001443_28875_29651 258
361 3300048929 Ga0496126_0000155 Ga0496126_0000155_86681_87457 258
362 3300053079 Ga0500610_0000096 Ga0500610_0000096_4370_5146 258
363 3300053130 Ga0500642_0000837 Ga0500642_0000837_650_1426 258
364 3300053730 Ga0500645_000003 Ga0500645_000003_168327_169103 258
365 3300053730 Ga0500645_003611 Ga0500645_003611_236_1012 258
366 3300003203 JGI25406J46586_10016685 JGI25406J46586_100166853 260
367 3300005327 Ga0070658_10002355 Ga0070658_100023554 260
368 3300005548 Ga0070665_100002302 Ga0070665_1000023023 260
369 3300015690 Ga0183363_1004 Ga0183363_1004177 260
370 3300046557 Ga0495622_0000566 Ga0495622_0000566_19251_20048 260
371 3300053096 Ga0500641_0087874 Ga0500641_0087874_160_957 260
372 3300053153 Ga0500616_0000074 Ga0500616_0000074_88692_89489 260
373 3300005335 Ga0070666_10008776 Ga0070666_100087762 261
374 3300009545 Ga0105237_10001281 Ga0105237_100012813 261
375 3300046522 Ga0495643_0000093 Ga0495643_0000093_93682_94473 261
376 3300049649 Ga0501198_003137 Ga0501198_003137_158_943 261
377 3300049663 Ga0501223_000106 Ga0501223_000106_5835_6620 261
378 3300049664 Ga0501224_000007 Ga0501224_000007_84408_85193 261
379 3300049668 Ga0501233_000050 Ga0501233_000050_5805_6590 261
380 3300049669 Ga0501235_000245 Ga0501235_000245_4733_5518 261
381 3300049705 Ga0501225_0000100 Ga0501225_0000100_25085_25870 261
382 3300049707 Ga0501234_003389 Ga0501234_003389_1386_2171 261
383 3300049853 Ga0501226_000025 Ga0501226_000025_5999_6784 261
384 iso_pu_bacteria 2842333319 2842337140 261
385 3300031995 Ga0307409_100453356 Ga0307409_1004533562 262
386 3300005614 Ga0068856_100006207 Ga0068856_1000062078 263
387 2162886007 SwRhRL2b_contig_1635877 SwRhRL2b_0990.00005460 268
388 3300005289 Ga0065704_10070205 Ga0065704_100702057 268
389 3300006195 Ga0075366_10138359 Ga0075366_101383592 268
390 3300009093 Ga0105240_10034129 Ga0105240_100341293 268
391 3300009551 Ga0105238_10247266 Ga0105238_102472662 268
392 3300010375 Ga0105239_10000105 Ga0105239_1000010515 268
393 3300025904 Ga0207647_10255250 Ga0207647_102552502 268
394 3300025913 Ga0207695_10038057 Ga0207695_100380573 268
395 3300048924 Ga0496121_0000319 Ga0496121_0000319_90456_91265 268
396 3300048924 Ga0496121_0004591 Ga0496121_0004591_13482_14291 268
397 3300048929 Ga0496126_0024130 Ga0496126_0024130_258_1067 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

28

223

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

34

269

0.97

PF08659

KR

KR domain

29

206

0.85

PF23441

23

234

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wwx-assembly1.cif.gz_A crystal structure of herbaspirillum huttiense l-arabinose 1-dehydrogenase (nad bound form) 0.9783 16 268
5wjs-assembly1.cif.gz_B crystal structure of oxidoreductase (short chain dehydrogenase/reductase family) from burkholderia thailandensis complexed with nadh 0.9778 19 268
4lvu-assembly1.cif.gz_B-2 crystal structure of a putative short chain dehydrogenase from burkholderia thailandensis 0.972 19 268
7wwx-assembly1.cif.gz_A crystal structure of herbaspirillum huttiense l-arabinose 1-dehydrogenase (nad bound form) 0.9707 16 268
2d1y-assembly1.cif.gz_B crystal structure of tt0321 from thermus thermophilus hb8 0.9674 25 266
ID Description Score Start End Superfamily
af_P0AET8_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9615 24 267 3.40.50.720
4lvuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9609 19 268 3.40.50.720
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9472 24 268 3.40.50.720
3rihC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9458 24 265 3.40.50.720
af_I1LJY0_35_302_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9448 24 265 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0L0MBF5-F1-model_v4 D-xylose 1-dehydrogenase (EC 1.1.1.175) 0.9868 16 266 GO:0047838
AF-A0A2T2PSP7-F1-model_v4 3-oxoacyl-ACP reductase 0.9853 16 266 GO:0016491
AF-A0A1M5K9F9-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9828 16 268 GO:0016491
AF-A0A2G6YA75-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9808 19 268 GO:0016491
AF-A0A1H1HW12-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family (SDR family oxidoreductase) 0.9732 16 268 GO:0016491

Feature Viewer

pLDDT pTM Quality
92 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map