F433745
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 397 | 273 | 360 | 252 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10034129|Ga0105240_100341293 |
| Length | 269 |
| Sequence | MIEGEKRFMLQQTSDAVDRAVYPSLRDKRVIVTGGGSGIGEGLVEAFAAQGARVAFLDIDDEASHSVVARLSADAPHQPVYRHCDVTDLDALATTIAELEQLLGGIDILANNAGNDDRHTIADVTPDYWNERLNVNLRHQFFAAKAVVPAMQRAGGGAILNFGSISWHLGLPDLVLYQTCKAAIEGLTRSLARDLGRDGIRVNTIVPGNVQTPRQEKWYTPQGEAEIVAGQCLDGRIQPSDVAALVLFLASDDARMCTGHEYWVDAGWR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 3 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 4 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 5 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 6 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 7 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 8 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 9 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 10 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 11 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 12 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 13 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 14 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 15 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 16 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 17 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 18 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 19 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 20 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 21 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 22 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 23 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 24 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 25 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 26 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 27 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 28 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 29 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 30 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 31 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 32 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 33 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 34 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 35 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 36 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 37 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 38 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 39 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 40 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 41 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 42 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 44 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 45 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 48 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 49 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 50 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 51 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 52 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 53 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 54 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 98 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 146 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 147 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 150 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 151 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 155 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 158 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 160 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 161 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 162 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 163 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 164 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 166 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 167 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 168 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 169 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 170 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 171 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 212 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 213 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 214 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 215 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 216 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 219 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 220 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 221 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 222 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 223 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 224 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 225 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 226 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 227 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 228 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 229 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 230 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 231 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 232 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 237 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 238 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 239 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 240 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 241 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 242 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 243 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 244 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 245 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 246 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 247 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 248 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 249 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 250 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 251 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 252 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 253 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 254 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 255 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 256 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 257 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 258 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 259 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 260 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 261 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 262 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 263 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 264 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 265 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 266 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 267 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 268 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 269 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 270 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 271 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 272 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 273 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.68 |
| Metatranscriptomes | 0 |
| Isolates | 9.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 1.26 |
| Bulb | 0 |
| Endosphere | 25.94 |
| Nodule | 0.25 |
| Rhizoplane | 3.53 |
| Rhizosphere | 56.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1635877 | 2162886007 | Bacteria | 7373 |
| 2 | JGI24741J21665_1001835 | 3300001915 | Bacteria | 5808 |
| 3 | JGI24740J21852_10000779 | 3300001979 | Bacteria | 13973 |
| 4 | JGI24737J22298_10001412 | 3300001990 | Bacteria | 8530 |
| 5 | JGI25406J46586_10016685 | 3300003203 | Bacteria | 3055 |
| 6 | Ga0055525_1000096 | 3300003759 | Bacteria | 137836 |
| 7 | Ga0055542_1000012 | 3300003762 | Bacteria | 391808 |
| 8 | Ga0055529_1000002 | 3300003763 | Bacteria | 537914 |
| 9 | Ga0055529_1000021 | 3300003763 | Bacteria | 321484 |
| 10 | Ga0055526_1010390 | 3300003771 | Bacteria | 4336 |
| 11 | Ga0055537_1001969 | 3300003773 | Bacteria | 7333 |
| 12 | Ga0055524_1010010 | 3300003775 | Bacteria | 3810 |
| 13 | Ga0055524_1011340 | 3300003775 | Bacteria | 3493 |
| 14 | Ga0055524_1021436 | 3300003775 | Bacteria | 2141 |
| 15 | Ga0055536_1000653 | 3300003781 | Bacteria | 23422 |
| 16 | Ga0055536_1000964 | 3300003781 | Bacteria | 18424 |
| 17 | Ga0055528_1004650 | 3300003790 | Bacteria | 6564 |
| 18 | Ga0055530_10000579 | 3300003791 | Bacteria | 31675 |
| 19 | Ga0055530_10001170 | 3300003791 | Bacteria | 20304 |
| 20 | Ga0055530_10001374 | 3300003791 | Bacteria | 18030 |
| 21 | Ga0055530_10018714 | 3300003791 | Bacteria | 2125 |
| 22 | Ga0055531_10000646 | 3300003794 | Bacteria | 30076 |
| 23 | Ga0055531_10003351 | 3300003794 | Bacteria | 10242 |
| 24 | Ga0055531_10006560 | 3300003794 | Bacteria | 6577 |
| 25 | Ga0055531_10015275 | 3300003794 | Bacteria | 3396 |
| 26 | Ga0055531_10020118 | 3300003794 | Bacteria | 2660 |
| 27 | Ga0055531_10036604 | 3300003794 | Bacteria | 1509 |
| 28 | Ga0065704_10070205 | 3300005289 | Bacteria | 83747 |
| 29 | Ga0070658_10000196 | 3300005327 | Bacteria | 53378 |
| 30 | Ga0070658_10002355 | 3300005327 | Bacteria | 15842 |
| 31 | Ga0070666_10008776 | 3300005335 | Bacteria | 6282 |
| 32 | Ga0070660_100016365 | 3300005339 | Bacteria | 5382 |
| 33 | Ga0070661_100002495 | 3300005344 | Bacteria | 12611 |
| 34 | Ga0070661_100006919 | 3300005344 | Bacteria | 7827 |
| 35 | Ga0070675_100308949 | 3300005354 | Bacteria | 1395 |
| 36 | Ga0070674_100118658 | 3300005356 | Bacteria | 1955 |
| 37 | Ga0070659_100016509 | 3300005366 | Bacteria | 5543 |
| 38 | Ga0070663_100270666 | 3300005455 | Bacteria | 1350 |
| 39 | Ga0070678_100000055 | 3300005456 | Bacteria | 40348 |
| 40 | Ga0068867_100002955 | 3300005459 | Bacteria | 11973 |
| 41 | Ga0070684_100059523 | 3300005535 | Bacteria | 3340 |
| 42 | Ga0068853_100074121 | 3300005539 | Bacteria | 2969 |
| 43 | Ga0070665_100002302 | 3300005548 | Bacteria | 21191 |
| 44 | Ga0068855_100000047 | 3300005563 | Bacteria | 145355 |
| 45 | Ga0068855_100027779 | 3300005563 | Bacteria | 6769 |
| 46 | Ga0070664_100006220 | 3300005564 | Bacteria | 9645 |
| 47 | Ga0068857_100384080 | 3300005577 | Bacteria | 1304 |
| 48 | Ga0068854_100023707 | 3300005578 | Bacteria | 4194 |
| 49 | Ga0068856_100006207 | 3300005614 | Bacteria | 11727 |
| 50 | Ga0068852_100174465 | 3300005616 | Bacteria | 2017 |
| 51 | Ga0068859_100002646 | 3300005617 | Bacteria | 18230 |
| 52 | Ga0068861_100000084 | 3300005719 | Bacteria | 45078 |
| 53 | Ga0075369_10037077 | 3300006186 | Bacteria | 2076 |
| 54 | Ga0075366_10007023 | 3300006195 | Bacteria | 6195 |
| 55 | Ga0075366_10138359 | 3300006195 | Bacteria | 1471 |
| 56 | Ga0097621_100028194 | 3300006237 | Bacteria | 4425 |
| 57 | Ga0075370_10083706 | 3300006353 | Bacteria | 1835 |
| 58 | Ga0075370_10100081 | 3300006353 | Bacteria | 1677 |
| 59 | Ga0068871_100333516 | 3300006358 | Bacteria | 1338 |
| 60 | Ga0068865_100095523 | 3300006881 | Bacteria | 2166 |
| 61 | Ga0097620_100002646 | 3300006931 | Bacteria | 18230 |
| 62 | Ga0105240_10000647 | 3300009093 | Bacteria | 64299 |
| 63 | Ga0105240_10002690 | 3300009093 | Bacteria | 28290 |
| 64 | Ga0105240_10034129 | 3300009093 | Bacteria | 6566 |
| 65 | Ga0105247_10045830 | 3300009101 | Bacteria | 2684 |
| 66 | Ga0105243_10000227 | 3300009148 | Bacteria | 64901 |
| 67 | Ga0105241_10000352 | 3300009174 | Bacteria | 34850 |
| 68 | Ga0105248_10003056 | 3300009177 | Bacteria | 18559 |
| 69 | Ga0105237_10001281 | 3300009545 | Bacteria | 33535 |
| 70 | Ga0105237_10067799 | 3300009545 | Bacteria | 3562 |
| 71 | Ga0105237_10120051 | 3300009545 | Bacteria | 2623 |
| 72 | Ga0105238_10247266 | 3300009551 | Bacteria | 1761 |
| 73 | Ga0105249_10630958 | 3300009553 | Bacteria | 1128 |
| 74 | Ga0105239_10000105 | 3300010375 | Bacteria | 117635 |
| 75 | Ga0105239_10001683 | 3300010375 | Bacteria | 29162 |
| 76 | Ga0105239_10100931 | 3300010375 | Bacteria | 3193 |
| 77 | Ga0157373_10010643 | 3300013100 | Bacteria | 6769 |
| 78 | Ga0157371_10000094 | 3300013102 | Bacteria | 139074 |
| 79 | Ga0157370_10151669 | 3300013104 | Bacteria | 2156 |
| 80 | Ga0157369_10010530 | 3300013105 | Bacteria | 10525 |
| 81 | Ga0157369_10112576 | 3300013105 | Bacteria | 2891 |
| 82 | Ga0157369_10134641 | 3300013105 | Bacteria | 2616 |
| 83 | Ga0157372_10075910 | 3300013307 | Bacteria | 3794 |
| 84 | Ga0157372_10449669 | 3300013307 | Bacteria | 1501 |
| 85 | Ga0157375_10386806 | 3300013308 | Bacteria | 1566 |
| 86 | Ga0183365_10005 | 3300015684 | Bacteria | 249619 |
| 87 | Ga0183363_1004 | 3300015690 | Bacteria | 416766 |
| 88 | Ga0163161_10189807 | 3300017792 | Bacteria | 1579 |
| 89 | Ga0209674_102709 | 3300025226 | Bacteria | 3629 |
| 90 | Ga0207425_1016036 | 3300025245 | Bacteria | 1669 |
| 91 | Ga0209646_1003506 | 3300025246 | Bacteria | 3086 |
| 92 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 93 | Ga0209565_1000140 | 3300025263 | Bacteria | 101561 |
| 94 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 95 | Ga0209673_1000630 | 3300025273 | Bacteria | 53635 |
| 96 | Ga0209130_1002498 | 3300025284 | Bacteria | 9091 |
| 97 | Ga0209675_1005092 | 3300025291 | Bacteria | 5613 |
| 98 | Ga0209675_1023894 | 3300025291 | Bacteria | 1572 |
| 99 | Ga0209676_1000043 | 3300025292 | Bacteria | 418680 |
| 100 | Ga0209676_1000712 | 3300025292 | Bacteria | 46015 |
| 101 | Ga0209676_1004038 | 3300025292 | Bacteria | 8449 |
| 102 | Ga0209025_1000864 | 3300025294 | Bacteria | 47865 |
| 103 | Ga0209564_1006541 | 3300025295 | Bacteria | 6261 |
| 104 | Ga0209564_1022706 | 3300025295 | Bacteria | 2206 |
| 105 | Ga0209564_1032062 | 3300025295 | Bacteria | 1590 |
| 106 | Ga0209758_1000924 | 3300025297 | Bacteria | 39688 |
| 107 | Ga0209050_1000049 | 3300025298 | Bacteria | 364096 |
| 108 | Ga0209050_1000559 | 3300025298 | Bacteria | 60902 |
| 109 | Ga0209050_1001103 | 3300025298 | Bacteria | 32702 |
| 110 | Ga0209050_1001731 | 3300025298 | Bacteria | 21722 |
| 111 | Ga0209050_1022876 | 3300025298 | Bacteria | 2223 |
| 112 | Ga0209256_1001549 | 3300025299 | Bacteria | 22921 |
| 113 | Ga0209256_1008649 | 3300025299 | Bacteria | 4663 |
| 114 | Ga0209256_1009010 | 3300025299 | Bacteria | 4471 |
| 115 | Ga0209256_1014548 | 3300025299 | Bacteria | 2822 |
| 116 | Ga0209051_1002278 | 3300025303 | Bacteria | 14056 |
| 117 | Ga0209257_1000134 | 3300025304 | Bacteria | 207628 |
| 118 | Ga0209257_1000200 | 3300025304 | Bacteria | 147538 |
| 119 | Ga0209257_1000452 | 3300025304 | Bacteria | 77144 |
| 120 | Ga0209257_1000692 | 3300025304 | Bacteria | 52346 |
| 121 | Ga0209257_1001064 | 3300025304 | Bacteria | 36288 |
| 122 | Ga0209257_1001841 | 3300025304 | Bacteria | 23124 |
| 123 | Ga0209257_1008106 | 3300025304 | Bacteria | 6106 |
| 124 | Ga0209257_1018216 | 3300025304 | Bacteria | 2716 |
| 125 | Ga0207656_10001687 | 3300025321 | Bacteria | 7342 |
| 126 | Ga0207647_10016955 | 3300025904 | Bacteria | 4959 |
| 127 | Ga0207647_10255250 | 3300025904 | Bacteria | 1005 |
| 128 | Ga0207705_10000183 | 3300025909 | Bacteria | 65457 |
| 129 | Ga0207654_10000020 | 3300025911 | Bacteria | 167053 |
| 130 | Ga0207654_10103877 | 3300025911 | Bacteria | 1755 |
| 131 | Ga0207695_10000003 | 3300025913 | Bacteria | 1368691 |
| 132 | Ga0207695_10009971 | 3300025913 | Bacteria | 11670 |
| 133 | Ga0207695_10038057 | 3300025913 | Bacteria | 5185 |
| 134 | Ga0207671_10028216 | 3300025914 | Bacteria | 4196 |
| 135 | Ga0207657_10000140 | 3300025919 | Bacteria | 74094 |
| 136 | Ga0207649_10002882 | 3300025920 | Bacteria | 9462 |
| 137 | Ga0207649_10013619 | 3300025920 | Bacteria | 4544 |
| 138 | Ga0207649_10496652 | 3300025920 | Bacteria | 927 |
| 139 | Ga0207694_10000011 | 3300025924 | Bacteria | 417640 |
| 140 | Ga0207694_10000878 | 3300025924 | Bacteria | 26740 |
| 141 | Ga0207659_10099885 | 3300025926 | Bacteria | 2186 |
| 142 | Ga0207690_10000063 | 3300025932 | Bacteria | 95620 |
| 143 | Ga0207706_10008063 | 3300025933 | Bacteria | 9723 |
| 144 | Ga0207686_10095705 | 3300025934 | Bacteria | 1971 |
| 145 | Ga0207709_10000093 | 3300025935 | Bacteria | 139110 |
| 146 | Ga0207669_10000086 | 3300025937 | Bacteria | 46934 |
| 147 | Ga0207704_10047594 | 3300025938 | Bacteria | 2564 |
| 148 | Ga0207711_10001846 | 3300025941 | Bacteria | 19327 |
| 149 | Ga0207667_10000006 | 3300025949 | Bacteria | 679876 |
| 150 | Ga0207667_10000050 | 3300025949 | Bacteria | 234390 |
| 151 | Ga0207640_10001108 | 3300025981 | Bacteria | 14880 |
| 152 | Ga0207640_10282439 | 3300025981 | Bacteria | 1305 |
| 153 | Ga0207677_10232238 | 3300026023 | Bacteria | 1487 |
| 154 | Ga0207639_10010063 | 3300026041 | Bacteria | 6541 |
| 155 | Ga0207678_10002329 | 3300026067 | Bacteria | 17206 |
| 156 | Ga0207702_10000713 | 3300026078 | Bacteria | 35789 |
| 157 | Ga0207702_10327762 | 3300026078 | Bacteria | 1460 |
| 158 | Ga0207648_10059597 | 3300026089 | Bacteria | 3329 |
| 159 | Ga0207674_10048345 | 3300026116 | Bacteria | 4354 |
| 160 | Ga0207675_100000166 | 3300026118 | Bacteria | 58837 |
| 161 | Ga0207683_10000181 | 3300026121 | Bacteria | 54142 |
| 162 | Ga0207698_10035277 | 3300026142 | Bacteria | 3657 |
| 163 | Ga0307517_10012028 | 3300028786 | Bacteria | 11940 |
| 164 | Ga0307517_10215329 | 3300028786 | Bacteria | 1176 |
| 165 | Ga0307515_10090947 | 3300028794 | Bacteria | 3820 |
| 166 | Ga0307515_10115900 | 3300028794 | Bacteria | 3081 |
| 167 | Ga0307515_10208156 | 3300028794 | Bacteria | 1809 |
| 168 | Ga0265338_10122560 | 3300028800 | Bacteria | 2069 |
| 169 | Ga0265320_10017331 | 3300031240 | Bacteria | 4002 |
| 170 | Ga0265331_10040923 | 3300031250 | Bacteria | 2253 |
| 171 | Ga0265327_10002310 | 3300031251 | Bacteria | 20381 |
| 172 | Ga0265316_10059336 | 3300031344 | Bacteria | 2976 |
| 173 | Ga0265313_10077845 | 3300031595 | Bacteria | 1513 |
| 174 | Ga0265314_10105653 | 3300031711 | Bacteria | 1800 |
| 175 | Ga0265342_10137823 | 3300031712 | Bacteria | 1363 |
| 176 | Ga0307516_10014691 | 3300031730 | Bacteria | 8273 |
| 177 | Ga0307405_10024087 | 3300031731 | Bacteria | 3471 |
| 178 | Ga0307413_10128946 | 3300031824 | Bacteria | 1727 |
| 179 | Ga0307412_10009508 | 3300031911 | Bacteria | 5581 |
| 180 | Ga0307409_100453356 | 3300031995 | Bacteria | 1238 |
| 181 | Ga0307416_100016230 | 3300032002 | Bacteria | 5168 |
| 182 | Ga0307510_10104057 | 3300033180 | Bacteria | 2614 |
| 183 | Ga0373943_0170055 | 3300035170 | Unclassified | 1192 |
| 184 | Ga0373927_0071414 | 3300035695 | Bacteria | 2247 |
| 185 | Ga0373925_0113756 | 3300037068 | Bacteria | 2093 |
| 186 | Ga0395905_0005061 | 3300037471 | Bacteria | 13571 |
| 187 | Ga0436364_0529752 | 3300037853 | Bacteria | 4663 |
| 188 | Ga0451800_1440841 | 3300041459 | Bacteria | 1433 |
| 189 | Ga0439435_0068059 | 3300042436 | Bacteria | 1049 |
| 190 | Ga0466961_0162879 | 3300044693 | Bacteria | 1390 |
| 191 | Ga0466959_0055331 | 3300045049 | Bacteria | 2897 |
| 192 | Ga0495627_002017 | 3300046453 | Bacteria | 10438 |
| 193 | Ga0495590_0002729 | 3300046457 | Bacteria | 7285 |
| 194 | Ga0495638_0000440 | 3300046460 | Bacteria | 50160 |
| 195 | Ga0495638_0001973 | 3300046460 | Bacteria | 17547 |
| 196 | Ga0495638_0005482 | 3300046460 | Bacteria | 9433 |
| 197 | Ga0495638_0019185 | 3300046460 | Bacteria | 4526 |
| 198 | Ga0495650_0000083 | 3300046471 | Bacteria | 237725 |
| 199 | Ga0495650_0000217 | 3300046471 | Bacteria | 120688 |
| 200 | Ga0495582_0168146 | 3300046473 | Bacteria | 1248 |
| 201 | Ga0495584_0010039 | 3300046491 | Bacteria | 4860 |
| 202 | Ga0495585_0149828 | 3300046492 | Bacteria | 1217 |
| 203 | Ga0495583_0000002 | 3300046506 | Bacteria | 782521 |
| 204 | Ga0495583_0000351 | 3300046506 | Bacteria | 72601 |
| 205 | Ga0495583_0026820 | 3300046506 | Bacteria | 2850 |
| 206 | Ga0495606_0010372 | 3300046507 | Bacteria | 7743 |
| 207 | Ga0495610_0000157 | 3300046512 | Bacteria | 75701 |
| 208 | Ga0495610_0010052 | 3300046512 | Bacteria | 5910 |
| 209 | Ga0495610_0013395 | 3300046512 | Bacteria | 4875 |
| 210 | Ga0495616_0000286 | 3300046513 | Bacteria | 40792 |
| 211 | Ga0495616_0117995 | 3300046513 | Bacteria | 1227 |
| 212 | Ga0495620_0024675 | 3300046515 | Bacteria | 2856 |
| 213 | Ga0495620_0033976 | 3300046515 | Bacteria | 2309 |
| 214 | Ga0495628_0250418 | 3300046516 | Bacteria | 1323 |
| 215 | Ga0495631_0009346 | 3300046518 | Bacteria | 4898 |
| 216 | Ga0495632_0044798 | 3300046519 | Bacteria | 2206 |
| 217 | Ga0495632_0180418 | 3300046519 | Bacteria | 967 |
| 218 | Ga0495637_0056566 | 3300046520 | Bacteria | 1623 |
| 219 | Ga0495637_0064825 | 3300046520 | Bacteria | 1489 |
| 220 | Ga0495643_0000093 | 3300046522 | Bacteria | 152412 |
| 221 | Ga0495643_0266437 | 3300046522 | Bacteria | 793 |
| 222 | Ga0495648_0000097 | 3300046524 | Bacteria | 109887 |
| 223 | Ga0495648_0003568 | 3300046524 | Bacteria | 13615 |
| 224 | Ga0495648_0032738 | 3300046524 | Bacteria | 3406 |
| 225 | Ga0495648_0201887 | 3300046524 | Bacteria | 994 |
| 226 | Ga0495663_0003193 | 3300046525 | Bacteria | 4775 |
| 227 | Ga0495663_0018377 | 3300046525 | Bacteria | 1991 |
| 228 | Ga0495654_0000042 | 3300046530 | Bacteria | 164346 |
| 229 | Ga0495654_0203913 | 3300046530 | Bacteria | 845 |
| 230 | Ga0495597_0128717 | 3300046542 | Bacteria | 1051 |
| 231 | Ga0495622_0000566 | 3300046557 | Bacteria | 22206 |
| 232 | Ga0495622_0000745 | 3300046557 | Bacteria | 18213 |
| 233 | Ga0495633_0032115 | 3300046558 | Bacteria | 2538 |
| 234 | Ga0495633_0047820 | 3300046558 | Bacteria | 2021 |
| 235 | Ga0495668_0000587 | 3300046616 | Bacteria | 44244 |
| 236 | Ga0495668_0006641 | 3300046616 | Bacteria | 7537 |
| 237 | Ga0495668_0013954 | 3300046616 | Bacteria | 4723 |
| 238 | Ga0495668_0021480 | 3300046616 | Bacteria | 3701 |
| 239 | Ga0495611_0004517 | 3300046648 | Bacteria | 6003 |
| 240 | Ga0495625_0000170 | 3300046660 | Bacteria | 102224 |
| 241 | Ga0495625_0003323 | 3300046660 | Bacteria | 16204 |
| 242 | Ga0495625_0004480 | 3300046660 | Bacteria | 13189 |
| 243 | Ga0495625_0004911 | 3300046660 | Bacteria | 12447 |
| 244 | Ga0495625_0015799 | 3300046660 | Bacteria | 5960 |
| 245 | Ga0495625_0043822 | 3300046660 | Bacteria | 3242 |
| 246 | Ga0495625_0048871 | 3300046660 | Bacteria | 3042 |
| 247 | Ga0495625_0186236 | 3300046660 | Bacteria | 1377 |
| 248 | Ga0495661_0123359 | 3300046665 | Bacteria | 1428 |
| 249 | Ga0495669_0000023 | 3300046684 | Bacteria | 117158 |
| 250 | Ga0495670_0256122 | 3300046691 | Bacteria | 933 |
| 251 | Ga0495671_0072336 | 3300046692 | Bacteria | 1693 |
| 252 | Ga0495671_0184213 | 3300046692 | Bacteria | 1014 |
| 253 | Ga0495600_0005725 | 3300046809 | Bacteria | 7506 |
| 254 | Ga0495660_0039095 | 3300046810 | Bacteria | 2636 |
| 255 | Ga0495660_0112512 | 3300046810 | Bacteria | 1387 |
| 256 | Ga0495660_0156982 | 3300046810 | Bacteria | 1119 |
| 257 | Ga0495672_0004122 | 3300047320 | Bacteria | 12099 |
| 258 | Ga0495683_0004660 | 3300047323 | Bacteria | 7727 |
| 259 | Ga0495687_000076 | 3300047443 | Bacteria | 149259 |
| 260 | Ga0495679_003056 | 3300047446 | Bacteria | 8223 |
| 261 | Ga0495673_0000147 | 3300047469 | Bacteria | 125742 |
| 262 | Ga0495673_0006447 | 3300047469 | Bacteria | 6895 |
| 263 | Ga0495673_0011747 | 3300047469 | Bacteria | 4688 |
| 264 | Ga0495673_0033295 | 3300047469 | Bacteria | 2393 |
| 265 | Ga0495686_0001764 | 3300047472 | Bacteria | 22143 |
| 266 | Ga0495686_0007138 | 3300047472 | Bacteria | 8412 |
| 267 | Ga0495686_0012743 | 3300047472 | Bacteria | 5867 |
| 268 | Ga0495686_0019911 | 3300047472 | Bacteria | 4478 |
| 269 | Ga0495686_0069581 | 3300047472 | Bacteria | 2169 |
| 270 | Ga0495686_0146979 | 3300047472 | Bacteria | 1386 |
| 271 | Ga0495602_0204078 | 3300048088 | Bacteria | 1506 |
| 272 | Ga0495615_0068097 | 3300048090 | Bacteria | 954 |
| 273 | Ga0496102_0000163 | 3300048905 | Bacteria | 89673 |
| 274 | Ga0496103_0000052 | 3300048906 | Bacteria | 149437 |
| 275 | Ga0496104_0073135 | 3300048907 | Bacteria | 3261 |
| 276 | Ga0496105_0001454 | 3300048908 | Bacteria | 16680 |
| 277 | Ga0496106_0014673 | 3300048909 | Bacteria | 5791 |
| 278 | Ga0496107_0000042 | 3300048910 | Bacteria | 75015 |
| 279 | Ga0496109_0448111 | 3300048912 | Bacteria | 1219 |
| 280 | Ga0496111_0023674 | 3300048914 | Bacteria | 4314 |
| 281 | Ga0496113_0019371 | 3300048916 | Bacteria | 4759 |
| 282 | Ga0496114_0019331 | 3300048917 | Bacteria | 5519 |
| 283 | Ga0496115_0000078 | 3300048918 | Bacteria | 89817 |
| 284 | Ga0496115_0062704 | 3300048918 | Bacteria | 2999 |
| 285 | Ga0496116_0009792 | 3300048919 | Bacteria | 8127 |
| 286 | Ga0496117_0000141 | 3300048920 | Bacteria | 158041 |
| 287 | Ga0496118_0000103 | 3300048921 | Bacteria | 158099 |
| 288 | Ga0496119_0048477 | 3300048922 | Bacteria | 2633 |
| 289 | Ga0496121_0000156 | 3300048924 | Bacteria | 149376 |
| 290 | Ga0496121_0000319 | 3300048924 | Bacteria | 100692 |
| 291 | Ga0496121_0000794 | 3300048924 | Bacteria | 57780 |
| 292 | Ga0496121_0004591 | 3300048924 | Bacteria | 18409 |
| 293 | Ga0496121_0027518 | 3300048924 | Bacteria | 5319 |
| 294 | Ga0496121_0194687 | 3300048924 | Bacteria | 1450 |
| 295 | Ga0496122_0005782 | 3300048925 | Bacteria | 14559 |
| 296 | Ga0496123_0007297 | 3300048926 | Bacteria | 10485 |
| 297 | Ga0496123_0209255 | 3300048926 | Bacteria | 993 |
| 298 | Ga0496124_0000041 | 3300048927 | Bacteria | 303887 |
| 299 | Ga0496124_0047707 | 3300048927 | Bacteria | 3663 |
| 300 | Ga0496125_0001443 | 3300048928 | Bacteria | 34571 |
| 301 | Ga0496125_0011591 | 3300048928 | Bacteria | 8807 |
| 302 | Ga0496126_0000155 | 3300048929 | Bacteria | 158816 |
| 303 | Ga0496126_0009898 | 3300048929 | Bacteria | 10074 |
| 304 | Ga0496126_0024130 | 3300048929 | Bacteria | 5875 |
| 305 | Ga0496126_0508007 | 3300048929 | Bacteria | 962 |
| 306 | Ga0495678_004170 | 3300049459 | Bacteria | 8525 |
| 307 | Ga0495682_0001113 | 3300049460 | Bacteria | 15638 |
| 308 | Ga0495682_0024811 | 3300049460 | Bacteria | 2234 |
| 309 | Ga0501034_0044040 | 3300049571 | Bacteria | 4514 |
| 310 | Ga0501047_0441166 | 3300049581 | Bacteria | 1132 |
| 311 | Ga0501198_003137 | 3300049649 | Bacteria | 2247 |
| 312 | Ga0501223_000106 | 3300049663 | Bacteria | 24016 |
| 313 | Ga0501224_000007 | 3300049664 | Bacteria | 127654 |
| 314 | Ga0501233_000050 | 3300049668 | Bacteria | 16101 |
| 315 | Ga0501235_000245 | 3300049669 | Bacteria | 9923 |
| 316 | Ga0501238_002676 | 3300049671 | Bacteria | 2146 |
| 317 | Ga0501225_0000100 | 3300049705 | Bacteria | 27639 |
| 318 | Ga0501234_003389 | 3300049707 | Bacteria | 2506 |
| 319 | Ga0501226_000025 | 3300049853 | Bacteria | 91197 |
| 320 | nmdc:mga0k408_126957_c1 | 3300050493 | Bacteria | 1513 |
| 321 | nmdc:mga0k408_150298_c1 | 3300050493 | Bacteria | 1387 |
| 322 | nmdc:mga0k408_16530_c1 | 3300050493 | Bacteria | 4095 |
| 323 | nmdc:mga0sz30_12805_c1 | 3300050516 | Bacteria | 3269 |
| 324 | Ga0500610_0000096 | 3300053079 | Bacteria | 26013 |
| 325 | Ga0500578_0000692 | 3300053086 | Bacteria | 40321 |
| 326 | Ga0500643_014159 | 3300053087 | Bacteria | 2784 |
| 327 | Ga0500643_018371 | 3300053087 | Bacteria | 2321 |
| 328 | Ga0500644_0000132 | 3300053088 | Bacteria | 45910 |
| 329 | Ga0500644_0063815 | 3300053088 | Bacteria | 1306 |
| 330 | Ga0500566_0251983 | 3300053094 | Bacteria | 858 |
| 331 | Ga0500641_0087874 | 3300053096 | Bacteria | 1325 |
| 332 | Ga0500650_0181632 | 3300053098 | Bacteria | 964 |
| 333 | Ga0500554_002279 | 3300053102 | Bacteria | 3747 |
| 334 | Ga0500556_0000013 | 3300053104 | Bacteria | 243797 |
| 335 | Ga0500556_0007202 | 3300053104 | Bacteria | 3177 |
| 336 | Ga0500594_0000944 | 3300053118 | Bacteria | 6251 |
| 337 | Ga0500595_001269 | 3300053119 | Bacteria | 13814 |
| 338 | Ga0500608_000079 | 3300053122 | Bacteria | 41088 |
| 339 | Ga0500614_014838 | 3300053123 | Bacteria | 1731 |
| 340 | Ga0500618_000059 | 3300053125 | Bacteria | 97360 |
| 341 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 342 | Ga0500642_0000837 | 3300053130 | Bacteria | 8979 |
| 343 | Ga0500655_024744 | 3300053133 | Bacteria | 1137 |
| 344 | Ga0500658_0001907 | 3300053134 | Bacteria | 8174 |
| 345 | Ga0500559_0000412 | 3300053136 | Bacteria | 30720 |
| 346 | Ga0500559_0009365 | 3300053136 | Bacteria | 4244 |
| 347 | Ga0500559_0111862 | 3300053136 | Bacteria | 1265 |
| 348 | Ga0500564_006325 | 3300053138 | Bacteria | 4933 |
| 349 | Ga0500577_0008989 | 3300053142 | Bacteria | 2880 |
| 350 | Ga0500616_0000074 | 3300053153 | Bacteria | 222910 |
| 351 | Ga0500622_0005946 | 3300053156 | Bacteria | 7187 |
| 352 | Ga0500622_0017816 | 3300053156 | Bacteria | 3778 |
| 353 | Ga0500624_000101 | 3300053157 | Bacteria | 41193 |
| 354 | Ga0500636_0004742 | 3300053177 | Bacteria | 7710 |
| 355 | Ga0500645_000003 | 3300053730 | Bacteria | 305887 |
| 356 | Ga0500645_000105 | 3300053730 | Bacteria | 67078 |
| 357 | Ga0500645_003611 | 3300053730 | Bacteria | 6198 |
| 358 | Ga0500645_006927 | 3300053730 | Bacteria | 3999 |
| 359 | Ga0500609_002580 | 3300053731 | Bacteria | 2579 |
| 360 | Ga0500601_000033 | 3300053737 | Bacteria | 29161 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031731 | Ga0307405_10024087 | Ga0307405_100240872 | 221 |
| 2 | 3300031824 | Ga0307413_10128946 | Ga0307413_101289462 | 221 |
| 3 | 3300031911 | Ga0307412_10009508 | Ga0307412_100095082 | 221 |
| 4 | 3300032002 | Ga0307416_100016230 | Ga0307416_1000162303 | 221 |
| 5 | 3300009553 | Ga0105249_10630958 | Ga0105249_106309582 | 227 |
| 6 | 3300035170 | Ga0373943_0170055 | Ga0373943_0170055_490_1176 | 227 |
| 7 | 3300037853 | Ga0436364_0529752 | Ga0436364_0529752_3526_4212 | 227 |
| 8 | 3300015684 | Ga0183365_10005 | Ga0183365_10005152 | 229 |
| 9 | 3300013104 | Ga0157370_10151669 | Ga0157370_101516692 | 230 |
| 10 | 3300003771 | Ga0055526_1010390 | Ga0055526_10103903 | 235 |
| 11 | 3300003775 | Ga0055524_1021436 | Ga0055524_10214361 | 235 |
| 12 | 3300003791 | Ga0055530_10001374 | Ga0055530_100013744 | 235 |
| 13 | 3300003794 | Ga0055531_10015275 | Ga0055531_100152752 | 235 |
| 14 | 3300046660 | Ga0495625_0003323 | Ga0495625_0003323_885_1637 | 237 |
| 15 | 3300046660 | Ga0495625_0004480 | Ga0495625_0004480_1198_1944 | 237 |
| 16 | 3300048909 | Ga0496106_0014673 | Ga0496106_0014673_3775_4527 | 237 |
| 17 | 3300048910 | Ga0496107_0000042 | Ga0496107_0000042_20983_21735 | 237 |
| 18 | 3300048924 | Ga0496121_0000794 | Ga0496121_0000794_53854_54606 | 237 |
| 19 | 3300046530 | Ga0495654_0203913 | Ga0495654_0203913_29_745 | 238 |
| 20 | 3300048090 | Ga0495615_0068097 | Ga0495615_0068097_36_752 | 238 |
| 21 | 3300025245 | Ga0207425_1016036 | Ga0207425_10160362 | 239 |
| 22 | 3300049460 | Ga0495682_0024811 | Ga0495682_0024811_417_1196 | 241 |
| 23 | 3300028786 | Ga0307517_10012028 | Ga0307517_1001202811 | 242 |
| 24 | 3300046512 | Ga0495610_0010052 | Ga0495610_0010052_3800_4546 | 242 |
| 25 | 3300046524 | Ga0495648_0032738 | Ga0495648_0032738_750_1529 | 242 |
| 26 | 3300046558 | Ga0495633_0047820 | Ga0495633_0047820_1073_1837 | 242 |
| 27 | 3300047472 | Ga0495686_0146979 | Ga0495686_0146979_234_980 | 242 |
| 28 | 3300053157 | Ga0500624_000101 | Ga0500624_000101_34408_35172 | 242 |
| 29 | 3300003781 | Ga0055536_1000653 | Ga0055536_100065316 | 243 |
| 30 | 3300003781 | Ga0055536_1000964 | Ga0055536_10009647 | 243 |
| 31 | 3300003791 | Ga0055530_10001170 | Ga0055530_1000117015 | 243 |
| 32 | 3300003791 | Ga0055530_10018714 | Ga0055530_100187142 | 243 |
| 33 | 3300003794 | Ga0055531_10000646 | Ga0055531_1000064618 | 243 |
| 34 | 3300003794 | Ga0055531_10036604 | Ga0055531_100366041 | 243 |
| 35 | 3300006186 | Ga0075369_10037077 | Ga0075369_100370772 | 243 |
| 36 | 3300006195 | Ga0075366_10007023 | Ga0075366_100070233 | 243 |
| 37 | 3300006353 | Ga0075370_10100081 | Ga0075370_101000812 | 243 |
| 38 | 3300025292 | Ga0209676_1000043 | Ga0209676_100004318 | 243 |
| 39 | 3300025292 | Ga0209676_1000712 | Ga0209676_100071216 | 243 |
| 40 | 3300025295 | Ga0209564_1022706 | Ga0209564_10227062 | 243 |
| 41 | 3300025298 | Ga0209050_1000559 | Ga0209050_100055916 | 243 |
| 42 | 3300025298 | Ga0209050_1001103 | Ga0209050_100110315 | 243 |
| 43 | 3300025303 | Ga0209051_1002278 | Ga0209051_10022789 | 243 |
| 44 | 3300025304 | Ga0209257_1000134 | Ga0209257_100013480 | 243 |
| 45 | 3300025304 | Ga0209257_1008106 | Ga0209257_10081067 | 243 |
| 46 | 3300046453 | Ga0495627_002017 | Ga0495627_002017_8170_8916 | 243 |
| 47 | 3300046460 | Ga0495638_0019185 | Ga0495638_0019185_655_1401 | 243 |
| 48 | 3300046616 | Ga0495668_0013954 | Ga0495668_0013954_2633_3382 | 243 |
| 49 | 3300046660 | Ga0495625_0000170 | Ga0495625_0000170_82545_83291 | 243 |
| 50 | 3300046660 | Ga0495625_0043822 | Ga0495625_0043822_513_1262 | 243 |
| 51 | 3300046810 | Ga0495660_0156982 | Ga0495660_0156982_41_787 | 243 |
| 52 | 3300047469 | Ga0495673_0000147 | Ga0495673_0000147_105568_106314 | 243 |
| 53 | 3300048917 | Ga0496114_0019331 | Ga0496114_0019331_2378_3109 | 243 |
| 54 | 3300048927 | Ga0496124_0047707 | Ga0496124_0047707_2804_3553 | 243 |
| 55 | 3300048928 | Ga0496125_0011591 | Ga0496125_0011591_5358_6107 | 243 |
| 56 | 3300048929 | Ga0496126_0009898 | Ga0496126_0009898_567_1316 | 243 |
| 57 | 3300050493 | nmdc:mga0k408_16530_c1 | nmdc:mga0k408_16530_c1_1300_2049 | 243 |
| 58 | 3300050516 | nmdc:mga0sz30_12805_c1 | nmdc:mga0sz30_12805_c1_870_1619 | 243 |
| 59 | 3300053094 | Ga0500566_0251983 | Ga0500566_0251983_26_772 | 243 |
| 60 | 3300053136 | Ga0500559_0009365 | Ga0500559_0009365_60_806 | 243 |
| 61 | 3300025284 | Ga0209130_1002498 | Ga0209130_10024986 | 244 |
| 62 | 3300025291 | Ga0209675_1023894 | Ga0209675_10238942 | 244 |
| 63 | 3300025292 | Ga0209676_1004038 | Ga0209676_10040383 | 244 |
| 64 | 3300025298 | Ga0209050_1001731 | Ga0209050_10017316 | 244 |
| 65 | 3300025299 | Ga0209256_1008649 | Ga0209256_10086494 | 244 |
| 66 | 3300025304 | Ga0209257_1000452 | Ga0209257_10004526 | 244 |
| 67 | 3300025304 | Ga0209257_1018216 | Ga0209257_10182163 | 244 |
| 68 | iso_pu_bacteria | 2510917020 | 2511123768 | 244 |
| 69 | iso_pu_bacteria | 2582581280 | 2585152040 | 244 |
| 70 | iso_pu_bacteria | 2582581293 | 2585194474 | 244 |
| 71 | iso_pu_bacteria | 2643221552 | 2643782942 | 244 |
| 72 | iso_pu_bacteria | 2643221584 | 2643928252 | 244 |
| 73 | iso_pu_bacteria | 2791355048 | 2792460473 | 244 |
| 74 | iso_pu_bacteria | 2818991435 | 2819539417 | 244 |
| 75 | iso_pu_bacteria | 2818991454 | 2819647709 | 244 |
| 76 | iso_pu_bacteria | 2843744320 | 2843744567 | 244 |
| 77 | iso_pu_bacteria | 2849560528 | 2849565535 | 244 |
| 78 | iso_pu_bacteria | 2849573788 | 2849575649 | 244 |
| 79 | iso_pu_bacteria | 2851153111 | 2851153249 | 244 |
| 80 | iso_pu_bacteria | 2857504554 | 2857507161 | 244 |
| 81 | iso_pu_bacteria | 2898329390 | 2898331711 | 244 |
| 82 | 3300003794 | Ga0055531_10020118 | Ga0055531_100201182 | 245 |
| 83 | 3300025294 | Ga0209025_1000864 | Ga0209025_10008646 | 245 |
| 84 | 3300025304 | Ga0209257_1001064 | Ga0209257_10010646 | 245 |
| 85 | 3300046515 | Ga0495620_0024675 | Ga0495620_0024675_1847_2626 | 245 |
| 86 | 3300046691 | Ga0495670_0256122 | Ga0495670_0256122_44_823 | 245 |
| 87 | 3300047472 | Ga0495686_0012743 | Ga0495686_0012743_3753_4532 | 245 |
| 88 | 3300047472 | Ga0495686_0069581 | Ga0495686_0069581_1022_1801 | 245 |
| 89 | 3300048924 | Ga0496121_0194687 | Ga0496121_0194687_280_1059 | 245 |
| 90 | 3300049671 | Ga0501238_002676 | Ga0501238_002676_618_1397 | 245 |
| 91 | 3300053102 | Ga0500554_002279 | Ga0500554_002279_2886_3668 | 245 |
| 92 | 3300053123 | Ga0500614_014838 | Ga0500614_014838_661_1443 | 245 |
| 93 | iso_pu_bacteria | 2582581279 | 2585147639 | 245 |
| 94 | iso_pu_bacteria | 2585428106 | 2587917588 | 245 |
| 95 | iso_pu_bacteria | 2643221640 | 2644226887 | 245 |
| 96 | iso_pu_bacteria | 2643221642 | 2644233645 | 245 |
| 97 | iso_pu_bacteria | 2884960567 | 2884961859 | 245 |
| 98 | iso_pu_bacteria | 2928531327 | 2928536028 | 245 |
| 99 | 3300033180 | Ga0307510_10104057 | Ga0307510_101040572 | 247 |
| 100 | 3300046471 | Ga0495650_0000083 | Ga0495650_0000083_166511_167308 | 247 |
| 101 | 3300046473 | Ga0495582_0168146 | Ga0495582_0168146_303_1100 | 247 |
| 102 | 3300046506 | Ga0495583_0000351 | Ga0495583_0000351_64758_65555 | 247 |
| 103 | 3300046557 | Ga0495622_0000745 | Ga0495622_0000745_13809_14606 | 247 |
| 104 | 3300046558 | Ga0495633_0032115 | Ga0495633_0032115_995_1792 | 247 |
| 105 | 3300046665 | Ga0495661_0123359 | Ga0495661_0123359_570_1367 | 247 |
| 106 | 3300046809 | Ga0495600_0005725 | Ga0495600_0005725_619_1416 | 247 |
| 107 | 3300053119 | Ga0500595_001269 | Ga0500595_001269_12888_13685 | 247 |
| 108 | 3300053177 | Ga0500636_0004742 | Ga0500636_0004742_4846_5643 | 247 |
| 109 | 3300003794 | Ga0055531_10006560 | Ga0055531_100065602 | 248 |
| 110 | 3300005344 | Ga0070661_100006919 | Ga0070661_1000069195 | 248 |
| 111 | 3300005563 | Ga0068855_100000047 | Ga0068855_10000004742 | 248 |
| 112 | 3300005617 | Ga0068859_100002646 | Ga0068859_1000026464 | 248 |
| 113 | 3300005719 | Ga0068861_100000084 | Ga0068861_10000008426 | 248 |
| 114 | 3300006353 | Ga0075370_10083706 | Ga0075370_100837062 | 248 |
| 115 | 3300006358 | Ga0068871_100333516 | Ga0068871_1003335162 | 248 |
| 116 | 3300006931 | Ga0097620_100002646 | Ga0097620_1000026464 | 248 |
| 117 | 3300009093 | Ga0105240_10000647 | Ga0105240_1000064724 | 248 |
| 118 | 3300009101 | Ga0105247_10045830 | Ga0105247_100458302 | 248 |
| 119 | 3300009177 | Ga0105248_10003056 | Ga0105248_1000305612 | 248 |
| 120 | 3300009545 | Ga0105237_10120051 | Ga0105237_101200512 | 248 |
| 121 | 3300010375 | Ga0105239_10001683 | Ga0105239_1000168324 | 248 |
| 122 | 3300013105 | Ga0157369_10010530 | Ga0157369_100105302 | 248 |
| 123 | 3300013307 | Ga0157372_10449669 | Ga0157372_104496692 | 248 |
| 124 | 3300017792 | Ga0163161_10189807 | Ga0163161_101898072 | 248 |
| 125 | 3300025298 | Ga0209050_1022876 | Ga0209050_10228762 | 248 |
| 126 | 3300025299 | Ga0209256_1014548 | Ga0209256_10145482 | 248 |
| 127 | 3300025304 | Ga0209257_1000200 | Ga0209257_100020071 | 248 |
| 128 | 3300025911 | Ga0207654_10103877 | Ga0207654_101038772 | 248 |
| 129 | 3300025913 | Ga0207695_10000003 | Ga0207695_10000003736 | 248 |
| 130 | 3300025920 | Ga0207649_10013619 | Ga0207649_100136192 | 248 |
| 131 | 3300025920 | Ga0207649_10496652 | Ga0207649_104966521 | 248 |
| 132 | 3300025924 | Ga0207694_10000011 | Ga0207694_1000001185 | 248 |
| 133 | 3300025941 | Ga0207711_10001846 | Ga0207711_100018468 | 248 |
| 134 | 3300025949 | Ga0207667_10000050 | Ga0207667_10000050120 | 248 |
| 135 | 3300026118 | Ga0207675_100000166 | Ga0207675_10000016648 | 248 |
| 136 | 3300028786 | Ga0307517_10215329 | Ga0307517_102153292 | 248 |
| 137 | 3300028794 | Ga0307515_10090947 | Ga0307515_100909473 | 248 |
| 138 | 3300028794 | Ga0307515_10115900 | Ga0307515_101159003 | 248 |
| 139 | 3300031240 | Ga0265320_10017331 | Ga0265320_100173313 | 248 |
| 140 | 3300031730 | Ga0307516_10014691 | Ga0307516_100146915 | 248 |
| 141 | 3300042436 | Ga0439435_0068059 | Ga0439435_0068059_110_856 | 248 |
| 142 | 3300044693 | Ga0466961_0162879 | Ga0466961_0162879_475_1221 | 248 |
| 143 | 3300045049 | Ga0466959_0055331 | Ga0466959_0055331_2074_2820 | 248 |
| 144 | 3300046457 | Ga0495590_0002729 | Ga0495590_0002729_1291_2037 | 248 |
| 145 | 3300046460 | Ga0495638_0001973 | Ga0495638_0001973_1410_2156 | 248 |
| 146 | 3300046460 | Ga0495638_0005482 | Ga0495638_0005482_1208_1954 | 248 |
| 147 | 3300046492 | Ga0495585_0149828 | Ga0495585_0149828_207_953 | 248 |
| 148 | 3300046507 | Ga0495606_0010372 | Ga0495606_0010372_5005_5757 | 248 |
| 149 | 3300046512 | Ga0495610_0013395 | Ga0495610_0013395_105_851 | 248 |
| 150 | 3300046513 | Ga0495616_0000286 | Ga0495616_0000286_38078_38824 | 248 |
| 151 | 3300046513 | Ga0495616_0117995 | Ga0495616_0117995_69_815 | 248 |
| 152 | 3300046519 | Ga0495632_0044798 | Ga0495632_0044798_50_796 | 248 |
| 153 | 3300046519 | Ga0495632_0180418 | Ga0495632_0180418_157_909 | 248 |
| 154 | 3300046520 | Ga0495637_0056566 | Ga0495637_0056566_674_1426 | 248 |
| 155 | 3300046520 | Ga0495637_0064825 | Ga0495637_0064825_401_1147 | 248 |
| 156 | 3300046522 | Ga0495643_0266437 | Ga0495643_0266437_22_768 | 248 |
| 157 | 3300046524 | Ga0495648_0201887 | Ga0495648_0201887_191_943 | 248 |
| 158 | 3300046525 | Ga0495663_0018377 | Ga0495663_0018377_322_1074 | 248 |
| 159 | 3300046616 | Ga0495668_0000587 | Ga0495668_0000587_15379_16125 | 248 |
| 160 | 3300046616 | Ga0495668_0006641 | Ga0495668_0006641_4861_5607 | 248 |
| 161 | 3300046660 | Ga0495625_0048871 | Ga0495625_0048871_1785_2537 | 248 |
| 162 | 3300046660 | Ga0495625_0186236 | Ga0495625_0186236_67_819 | 248 |
| 163 | 3300046692 | Ga0495671_0184213 | Ga0495671_0184213_148_894 | 248 |
| 164 | 3300046810 | Ga0495660_0039095 | Ga0495660_0039095_1049_1795 | 248 |
| 165 | 3300046810 | Ga0495660_0112512 | Ga0495660_0112512_567_1313 | 248 |
| 166 | 3300047320 | Ga0495672_0004122 | Ga0495672_0004122_1470_2222 | 248 |
| 167 | 3300047446 | Ga0495679_003056 | Ga0495679_003056_6146_6898 | 248 |
| 168 | 3300047472 | Ga0495686_0001764 | Ga0495686_0001764_18980_19726 | 248 |
| 169 | 3300047472 | Ga0495686_0019911 | Ga0495686_0019911_2280_3026 | 248 |
| 170 | 3300048088 | Ga0495602_0204078 | Ga0495602_0204078_408_1154 | 248 |
| 171 | 3300049459 | Ga0495678_004170 | Ga0495678_004170_3993_4739 | 248 |
| 172 | 3300049460 | Ga0495682_0001113 | Ga0495682_0001113_13314_14060 | 248 |
| 173 | 3300049581 | Ga0501047_0441166 | Ga0501047_0441166_259_1005 | 248 |
| 174 | 3300050493 | nmdc:mga0k408_126957_c1 | nmdc:mga0k408_126957_c1_73_819 | 248 |
| 175 | 3300053086 | Ga0500578_0000692 | Ga0500578_0000692_21382_22128 | 248 |
| 176 | 3300053088 | Ga0500644_0063815 | Ga0500644_0063815_507_1253 | 248 |
| 177 | 3300053104 | Ga0500556_0007202 | Ga0500556_0007202_1776_2528 | 248 |
| 178 | 3300053118 | Ga0500594_0000944 | Ga0500594_0000944_3995_4741 | 248 |
| 179 | 3300053122 | Ga0500608_000079 | Ga0500608_000079_22411_23157 | 248 |
| 180 | 3300053125 | Ga0500618_000059 | Ga0500618_000059_12362_13114 | 248 |
| 181 | 3300053133 | Ga0500655_024744 | Ga0500655_024744_269_1015 | 248 |
| 182 | 3300053134 | Ga0500658_0001907 | Ga0500658_0001907_6982_7734 | 248 |
| 183 | 3300053136 | Ga0500559_0000412 | Ga0500559_0000412_15240_15992 | 248 |
| 184 | 3300053136 | Ga0500559_0111862 | Ga0500559_0111862_151_897 | 248 |
| 185 | 3300053142 | Ga0500577_0008989 | Ga0500577_0008989_1937_2683 | 248 |
| 186 | 3300053156 | Ga0500622_0005946 | Ga0500622_0005946_3978_4724 | 248 |
| 187 | 3300053156 | Ga0500622_0017816 | Ga0500622_0017816_947_1693 | 248 |
| 188 | 3300053730 | Ga0500645_006927 | Ga0500645_006927_1443_2195 | 248 |
| 189 | 3300053731 | Ga0500609_002580 | Ga0500609_002580_1200_1946 | 248 |
| 190 | iso_pu_bacteria | 2830075706 | 2830076957 | 248 |
| 191 | iso_pu_bacteria | 2990265787 | 2990266009 | 248 |
| 192 | iso_pu_bacteria | 2993693658 | 2993696199 | 248 |
| 193 | 3300031250 | Ga0265331_10040923 | Ga0265331_100409232 | 249 |
| 194 | 3300031344 | Ga0265316_10059336 | Ga0265316_100593362 | 249 |
| 195 | 3300031595 | Ga0265313_10077845 | Ga0265313_100778452 | 249 |
| 196 | 3300031712 | Ga0265342_10137823 | Ga0265342_101378232 | 249 |
| 197 | 3300046524 | Ga0495648_0003568 | Ga0495648_0003568_10087_10836 | 249 |
| 198 | 3300047469 | Ga0495673_0011747 | Ga0495673_0011747_1221_1970 | 249 |
| 199 | 3300053087 | Ga0500643_014159 | Ga0500643_014159_1120_1869 | 249 |
| 200 | 3300053088 | Ga0500644_0000132 | Ga0500644_0000132_256_1005 | 249 |
| 201 | 3300053138 | Ga0500564_006325 | Ga0500564_006325_1374_2123 | 249 |
| 202 | 3300003773 | Ga0055537_1001969 | Ga0055537_10019694 | 251 |
| 203 | 3300003775 | Ga0055524_1010010 | Ga0055524_10100103 | 251 |
| 204 | 3300003790 | Ga0055528_1004650 | Ga0055528_10046503 | 251 |
| 205 | 3300025263 | Ga0209565_1000140 | Ga0209565_100014046 | 251 |
| 206 | 3300025273 | Ga0209673_1000630 | Ga0209673_100063038 | 251 |
| 207 | 3300025291 | Ga0209675_1005092 | Ga0209675_10050923 | 251 |
| 208 | 3300025295 | Ga0209564_1032062 | Ga0209564_10320621 | 251 |
| 209 | 3300025299 | Ga0209256_1009010 | Ga0209256_10090103 | 251 |
| 210 | 3300047469 | Ga0495673_0006447 | Ga0495673_0006447_6043_6822 | 251 |
| 211 | 3300013105 | Ga0157369_10112576 | Ga0157369_101125763 | 252 |
| 212 | 3300026078 | Ga0207702_10327762 | Ga0207702_103277622 | 252 |
| 213 | 3300028800 | Ga0265338_10122560 | Ga0265338_101225602 | 252 |
| 214 | 3300037471 | Ga0395905_0005061 | Ga0395905_0005061_11944_12702 | 252 |
| 215 | 3300046515 | Ga0495620_0033976 | Ga0495620_0033976_198_956 | 252 |
| 216 | 3300048926 | Ga0496123_0209255 | Ga0496123_0209255_159_926 | 252 |
| 217 | 3300048929 | Ga0496126_0508007 | Ga0496126_0508007_15_773 | 252 |
| 218 | iso_pu_bacteria | 2599185354 | 2600202855 | 252 |
| 219 | iso_pu_bacteria | 2643221545 | 2643748655 | 252 |
| 220 | iso_pu_bacteria | 2643221691 | 2644510330 | 252 |
| 221 | iso_pu_bacteria | 2889306138 | 2889310544 | 252 |
| 222 | 3300046506 | Ga0495583_0000002 | Ga0495583_0000002_528198_528992 | 253 |
| 223 | 3300049571 | Ga0501034_0044040 | Ga0501034_0044040_2413_3174 | 253 |
| 224 | 3300053737 | Ga0500601_000033 | Ga0500601_000033_22827_23594 | 253 |
| 225 | 3300031251 | Ga0265327_10002310 | Ga0265327_100023106 | 254 |
| 226 | 3300031711 | Ga0265314_10105653 | Ga0265314_101056532 | 254 |
| 227 | 3300041459 | Ga0451800_1440841 | Ga0451800_1440841_328_1098 | 254 |
| 228 | 3300046516 | Ga0495628_0250418 | Ga0495628_0250418_295_1059 | 254 |
| 229 | iso_pu_bacteria | 2595698237 | 2596374570 | 254 |
| 230 | iso_pu_bacteria | 2902330777 | 2902335762 | 254 |
| 231 | iso_pu_bacteria | 2919138771 | 2919143511 | 254 |
| 232 | iso_pu_bacteria | 2928125067 | 2928125133 | 254 |
| 233 | 3300048924 | Ga0496121_0027518 | Ga0496121_0027518_1767_2534 | 255 |
| 234 | 3300003775 | Ga0055524_1011340 | Ga0055524_10113404 | 256 |
| 235 | 3300025295 | Ga0209564_1006541 | Ga0209564_10065413 | 256 |
| 236 | 3300025299 | Ga0209256_1001549 | Ga0209256_100154924 | 256 |
| 237 | 3300025981 | Ga0207640_10282439 | Ga0207640_102824391 | 256 |
| 238 | 3300028794 | Ga0307515_10208156 | Ga0307515_102081562 | 256 |
| 239 | 3300046471 | Ga0495650_0000217 | Ga0495650_0000217_8875_9654 | 256 |
| 240 | 3300046512 | Ga0495610_0000157 | Ga0495610_0000157_34543_35322 | 256 |
| 241 | 3300046530 | Ga0495654_0000042 | Ga0495654_0000042_31858_32637 | 256 |
| 242 | 3300046542 | Ga0495597_0128717 | Ga0495597_0128717_174_944 | 256 |
| 243 | 3300046616 | Ga0495668_0021480 | Ga0495668_0021480_2637_3407 | 256 |
| 244 | 3300046660 | Ga0495625_0004911 | Ga0495625_0004911_3509_4279 | 256 |
| 245 | 3300048918 | Ga0496115_0062704 | Ga0496115_0062704_631_1410 | 256 |
| 246 | 3300050493 | nmdc:mga0k408_150298_c1 | nmdc:mga0k408_150298_c1_265_1050 | 256 |
| 247 | 3300053087 | Ga0500643_018371 | Ga0500643_018371_1496_2266 | 256 |
| 248 | 3300053098 | Ga0500650_0181632 | Ga0500650_0181632_41_811 | 256 |
| 249 | 3300053104 | Ga0500556_0000013 | Ga0500556_0000013_88159_88929 | 256 |
| 250 | 3300053130 | Ga0500642_0000002 | Ga0500642_0000002_316564_317334 | 256 |
| 251 | 3300053730 | Ga0500645_000105 | Ga0500645_000105_6321_7091 | 256 |
| 252 | iso_pu_bacteria | 2643221583 | 2643924054 | 256 |
| 253 | 3300035695 | Ga0373927_0071414 | Ga0373927_0071414_1174_1950 | 257 |
| 254 | 3300037068 | Ga0373925_0113756 | Ga0373925_0113756_1014_1790 | 257 |
| 255 | iso_pu_bacteria | 2928027323 | 2928030147 | 257 |
| 256 | iso_pu_bacteria | 2984555340 | 2984556854 | 257 |
| 257 | iso_pu_bacteria | 2984564862 | 2984564986 | 257 |
| 258 | iso_pu_bacteria | 2993356040 | 2993356050 | 257 |
| 259 | 3300001915 | JGI24741J21665_1001835 | JGI24741J21665_10018354 | 258 |
| 260 | 3300001979 | JGI24740J21852_10000779 | JGI24740J21852_100007793 | 258 |
| 261 | 3300001990 | JGI24737J22298_10001412 | JGI24737J22298_100014123 | 258 |
| 262 | 3300003759 | Ga0055525_1000096 | Ga0055525_100009633 | 258 |
| 263 | 3300003762 | Ga0055542_1000012 | Ga0055542_1000012332 | 258 |
| 264 | 3300003763 | Ga0055529_1000002 | Ga0055529_1000002248 | 258 |
| 265 | 3300003763 | Ga0055529_1000021 | Ga0055529_1000021233 | 258 |
| 266 | 3300003791 | Ga0055530_10000579 | Ga0055530_1000057929 | 258 |
| 267 | 3300003794 | Ga0055531_10003351 | Ga0055531_100033514 | 258 |
| 268 | 3300005327 | Ga0070658_10000196 | Ga0070658_1000019633 | 258 |
| 269 | 3300005339 | Ga0070660_100016365 | Ga0070660_1000163652 | 258 |
| 270 | 3300005344 | Ga0070661_100002495 | Ga0070661_1000024957 | 258 |
| 271 | 3300005354 | Ga0070675_100308949 | Ga0070675_1003089491 | 258 |
| 272 | 3300005356 | Ga0070674_100118658 | Ga0070674_1001186582 | 258 |
| 273 | 3300005366 | Ga0070659_100016509 | Ga0070659_1000165092 | 258 |
| 274 | 3300005455 | Ga0070663_100270666 | Ga0070663_1002706661 | 258 |
| 275 | 3300005456 | Ga0070678_100000055 | Ga0070678_10000005532 | 258 |
| 276 | 3300005459 | Ga0068867_100002955 | Ga0068867_1000029552 | 258 |
| 277 | 3300005535 | Ga0070684_100059523 | Ga0070684_1000595233 | 258 |
| 278 | 3300005539 | Ga0068853_100074121 | Ga0068853_1000741213 | 258 |
| 279 | 3300005563 | Ga0068855_100027779 | Ga0068855_1000277793 | 258 |
| 280 | 3300005564 | Ga0070664_100006220 | Ga0070664_1000062203 | 258 |
| 281 | 3300005577 | Ga0068857_100384080 | Ga0068857_1003840802 | 258 |
| 282 | 3300005578 | Ga0068854_100023707 | Ga0068854_1000237074 | 258 |
| 283 | 3300005616 | Ga0068852_100174465 | Ga0068852_1001744652 | 258 |
| 284 | 3300006237 | Ga0097621_100028194 | Ga0097621_1000281942 | 258 |
| 285 | 3300006881 | Ga0068865_100095523 | Ga0068865_1000955232 | 258 |
| 286 | 3300009093 | Ga0105240_10002690 | Ga0105240_1000269022 | 258 |
| 287 | 3300009148 | Ga0105243_10000227 | Ga0105243_1000022736 | 258 |
| 288 | 3300009174 | Ga0105241_10000352 | Ga0105241_100003527 | 258 |
| 289 | 3300009545 | Ga0105237_10067799 | Ga0105237_100677993 | 258 |
| 290 | 3300010375 | Ga0105239_10100931 | Ga0105239_101009313 | 258 |
| 291 | 3300013100 | Ga0157373_10010643 | Ga0157373_100106432 | 258 |
| 292 | 3300013102 | Ga0157371_10000094 | Ga0157371_1000009415 | 258 |
| 293 | 3300013105 | Ga0157369_10134641 | Ga0157369_101346412 | 258 |
| 294 | 3300013307 | Ga0157372_10075910 | Ga0157372_100759104 | 258 |
| 295 | 3300013308 | Ga0157375_10386806 | Ga0157375_103868061 | 258 |
| 296 | 3300025226 | Ga0209674_102709 | Ga0209674_1027093 | 258 |
| 297 | 3300025246 | Ga0209646_1003506 | Ga0209646_10035063 | 258 |
| 298 | 3300025254 | Ga0209148_1000008 | Ga0209148_1000008965 | 258 |
| 299 | 3300025272 | Ga0209455_1000002 | Ga0209455_1000002460 | 258 |
| 300 | 3300025297 | Ga0209758_1000924 | Ga0209758_10009243 | 258 |
| 301 | 3300025298 | Ga0209050_1000049 | Ga0209050_100004938 | 258 |
| 302 | 3300025304 | Ga0209257_1000692 | Ga0209257_100069242 | 258 |
| 303 | 3300025304 | Ga0209257_1001841 | Ga0209257_100184117 | 258 |
| 304 | 3300025321 | Ga0207656_10001687 | Ga0207656_100016872 | 258 |
| 305 | 3300025904 | Ga0207647_10016955 | Ga0207647_100169552 | 258 |
| 306 | 3300025909 | Ga0207705_10000183 | Ga0207705_1000018336 | 258 |
| 307 | 3300025911 | Ga0207654_10000020 | Ga0207654_1000002063 | 258 |
| 308 | 3300025913 | Ga0207695_10009971 | Ga0207695_100099713 | 258 |
| 309 | 3300025914 | Ga0207671_10028216 | Ga0207671_100282162 | 258 |
| 310 | 3300025919 | Ga0207657_10000140 | Ga0207657_1000014049 | 258 |
| 311 | 3300025920 | Ga0207649_10002882 | Ga0207649_100028823 | 258 |
| 312 | 3300025924 | Ga0207694_10000878 | Ga0207694_100008785 | 258 |
| 313 | 3300025926 | Ga0207659_10099885 | Ga0207659_100998852 | 258 |
| 314 | 3300025932 | Ga0207690_10000063 | Ga0207690_1000006320 | 258 |
| 315 | 3300025933 | Ga0207706_10008063 | Ga0207706_100080637 | 258 |
| 316 | 3300025934 | Ga0207686_10095705 | Ga0207686_100957052 | 258 |
| 317 | 3300025935 | Ga0207709_10000093 | Ga0207709_1000009348 | 258 |
| 318 | 3300025937 | Ga0207669_10000086 | Ga0207669_100000864 | 258 |
| 319 | 3300025938 | Ga0207704_10047594 | Ga0207704_100475943 | 258 |
| 320 | 3300025949 | Ga0207667_10000006 | Ga0207667_10000006137 | 258 |
| 321 | 3300025981 | Ga0207640_10001108 | Ga0207640_100011089 | 258 |
| 322 | 3300026023 | Ga0207677_10232238 | Ga0207677_102322382 | 258 |
| 323 | 3300026041 | Ga0207639_10010063 | Ga0207639_100100634 | 258 |
| 324 | 3300026067 | Ga0207678_10002329 | Ga0207678_100023293 | 258 |
| 325 | 3300026078 | Ga0207702_10000713 | Ga0207702_100007137 | 258 |
| 326 | 3300026089 | Ga0207648_10059597 | Ga0207648_100595973 | 258 |
| 327 | 3300026116 | Ga0207674_10048345 | Ga0207674_100483453 | 258 |
| 328 | 3300026121 | Ga0207683_10000181 | Ga0207683_1000018123 | 258 |
| 329 | 3300026142 | Ga0207698_10035277 | Ga0207698_100352774 | 258 |
| 330 | 3300046460 | Ga0495638_0000440 | Ga0495638_0000440_39763_40557 | 258 |
| 331 | 3300046491 | Ga0495584_0010039 | Ga0495584_0010039_2328_3104 | 258 |
| 332 | 3300046506 | Ga0495583_0026820 | Ga0495583_0026820_1159_1935 | 258 |
| 333 | 3300046518 | Ga0495631_0009346 | Ga0495631_0009346_829_1605 | 258 |
| 334 | 3300046524 | Ga0495648_0000097 | Ga0495648_0000097_94186_94962 | 258 |
| 335 | 3300046525 | Ga0495663_0003193 | Ga0495663_0003193_1809_2585 | 258 |
| 336 | 3300046648 | Ga0495611_0004517 | Ga0495611_0004517_2147_2923 | 258 |
| 337 | 3300046660 | Ga0495625_0015799 | Ga0495625_0015799_4764_5540 | 258 |
| 338 | 3300046684 | Ga0495669_0000023 | Ga0495669_0000023_71448_72224 | 258 |
| 339 | 3300046692 | Ga0495671_0072336 | Ga0495671_0072336_729_1505 | 258 |
| 340 | 3300047323 | Ga0495683_0004660 | Ga0495683_0004660_1517_2293 | 258 |
| 341 | 3300047443 | Ga0495687_000076 | Ga0495687_000076_66448_67224 | 258 |
| 342 | 3300047469 | Ga0495673_0033295 | Ga0495673_0033295_1476_2252 | 258 |
| 343 | 3300047472 | Ga0495686_0007138 | Ga0495686_0007138_463_1239 | 258 |
| 344 | 3300048905 | Ga0496102_0000163 | Ga0496102_0000163_2237_3013 | 258 |
| 345 | 3300048906 | Ga0496103_0000052 | Ga0496103_0000052_70636_71412 | 258 |
| 346 | 3300048907 | Ga0496104_0073135 | Ga0496104_0073135_1923_2699 | 258 |
| 347 | 3300048908 | Ga0496105_0001454 | Ga0496105_0001454_736_1512 | 258 |
| 348 | 3300048912 | Ga0496109_0448111 | Ga0496109_0448111_106_882 | 258 |
| 349 | 3300048914 | Ga0496111_0023674 | Ga0496111_0023674_1992_2768 | 258 |
| 350 | 3300048916 | Ga0496113_0019371 | Ga0496113_0019371_2821_3597 | 258 |
| 351 | 3300048918 | Ga0496115_0000078 | Ga0496115_0000078_86694_87470 | 258 |
| 352 | 3300048919 | Ga0496116_0009792 | Ga0496116_0009792_4775_5551 | 258 |
| 353 | 3300048920 | Ga0496117_0000141 | Ga0496117_0000141_86629_87405 | 258 |
| 354 | 3300048921 | Ga0496118_0000103 | Ga0496118_0000103_86687_87463 | 258 |
| 355 | 3300048922 | Ga0496119_0048477 | Ga0496119_0048477_1108_1884 | 258 |
| 356 | 3300048924 | Ga0496121_0000156 | Ga0496121_0000156_70618_71394 | 258 |
| 357 | 3300048925 | Ga0496122_0005782 | Ga0496122_0005782_4558_5334 | 258 |
| 358 | 3300048926 | Ga0496123_0007297 | Ga0496123_0007297_7735_8511 | 258 |
| 359 | 3300048927 | Ga0496124_0000041 | Ga0496124_0000041_72509_73285 | 258 |
| 360 | 3300048928 | Ga0496125_0001443 | Ga0496125_0001443_28875_29651 | 258 |
| 361 | 3300048929 | Ga0496126_0000155 | Ga0496126_0000155_86681_87457 | 258 |
| 362 | 3300053079 | Ga0500610_0000096 | Ga0500610_0000096_4370_5146 | 258 |
| 363 | 3300053130 | Ga0500642_0000837 | Ga0500642_0000837_650_1426 | 258 |
| 364 | 3300053730 | Ga0500645_000003 | Ga0500645_000003_168327_169103 | 258 |
| 365 | 3300053730 | Ga0500645_003611 | Ga0500645_003611_236_1012 | 258 |
| 366 | 3300003203 | JGI25406J46586_10016685 | JGI25406J46586_100166853 | 260 |
| 367 | 3300005327 | Ga0070658_10002355 | Ga0070658_100023554 | 260 |
| 368 | 3300005548 | Ga0070665_100002302 | Ga0070665_1000023023 | 260 |
| 369 | 3300015690 | Ga0183363_1004 | Ga0183363_1004177 | 260 |
| 370 | 3300046557 | Ga0495622_0000566 | Ga0495622_0000566_19251_20048 | 260 |
| 371 | 3300053096 | Ga0500641_0087874 | Ga0500641_0087874_160_957 | 260 |
| 372 | 3300053153 | Ga0500616_0000074 | Ga0500616_0000074_88692_89489 | 260 |
| 373 | 3300005335 | Ga0070666_10008776 | Ga0070666_100087762 | 261 |
| 374 | 3300009545 | Ga0105237_10001281 | Ga0105237_100012813 | 261 |
| 375 | 3300046522 | Ga0495643_0000093 | Ga0495643_0000093_93682_94473 | 261 |
| 376 | 3300049649 | Ga0501198_003137 | Ga0501198_003137_158_943 | 261 |
| 377 | 3300049663 | Ga0501223_000106 | Ga0501223_000106_5835_6620 | 261 |
| 378 | 3300049664 | Ga0501224_000007 | Ga0501224_000007_84408_85193 | 261 |
| 379 | 3300049668 | Ga0501233_000050 | Ga0501233_000050_5805_6590 | 261 |
| 380 | 3300049669 | Ga0501235_000245 | Ga0501235_000245_4733_5518 | 261 |
| 381 | 3300049705 | Ga0501225_0000100 | Ga0501225_0000100_25085_25870 | 261 |
| 382 | 3300049707 | Ga0501234_003389 | Ga0501234_003389_1386_2171 | 261 |
| 383 | 3300049853 | Ga0501226_000025 | Ga0501226_000025_5999_6784 | 261 |
| 384 | iso_pu_bacteria | 2842333319 | 2842337140 | 261 |
| 385 | 3300031995 | Ga0307409_100453356 | Ga0307409_1004533562 | 262 |
| 386 | 3300005614 | Ga0068856_100006207 | Ga0068856_1000062078 | 263 |
| 387 | 2162886007 | SwRhRL2b_contig_1635877 | SwRhRL2b_0990.00005460 | 268 |
| 388 | 3300005289 | Ga0065704_10070205 | Ga0065704_100702057 | 268 |
| 389 | 3300006195 | Ga0075366_10138359 | Ga0075366_101383592 | 268 |
| 390 | 3300009093 | Ga0105240_10034129 | Ga0105240_100341293 | 268 |
| 391 | 3300009551 | Ga0105238_10247266 | Ga0105238_102472662 | 268 |
| 392 | 3300010375 | Ga0105239_10000105 | Ga0105239_1000010515 | 268 |
| 393 | 3300025904 | Ga0207647_10255250 | Ga0207647_102552502 | 268 |
| 394 | 3300025913 | Ga0207695_10038057 | Ga0207695_100380573 | 268 |
| 395 | 3300048924 | Ga0496121_0000319 | Ga0496121_0000319_90456_91265 | 268 |
| 396 | 3300048924 | Ga0496121_0004591 | Ga0496121_0004591_13482_14291 | 268 |
| 397 | 3300048929 | Ga0496126_0024130 | Ga0496126_0024130_258_1067 | 268 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7wwx-assembly1.cif.gz_A | crystal structure of herbaspirillum huttiense l-arabinose 1-dehydrogenase (nad bound form) | 0.9783 | 16 | 268 |
| 5wjs-assembly1.cif.gz_B | crystal structure of oxidoreductase (short chain dehydrogenase/reductase family) from burkholderia thailandensis complexed with nadh | 0.9778 | 19 | 268 |
| 4lvu-assembly1.cif.gz_B-2 | crystal structure of a putative short chain dehydrogenase from burkholderia thailandensis | 0.972 | 19 | 268 |
| 7wwx-assembly1.cif.gz_A | crystal structure of herbaspirillum huttiense l-arabinose 1-dehydrogenase (nad bound form) | 0.9707 | 16 | 268 |
| 2d1y-assembly1.cif.gz_B | crystal structure of tt0321 from thermus thermophilus hb8 | 0.9674 | 25 | 266 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AET8_1_255_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9615 | 24 | 267 | 3.40.50.720 |
| 4lvuA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9609 | 19 | 268 | 3.40.50.720 |
| 3grpC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9472 | 24 | 268 | 3.40.50.720 |
| 3rihC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9458 | 24 | 265 | 3.40.50.720 |
| af_I1LJY0_35_302_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9448 | 24 | 265 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0L0MBF5-F1-model_v4 | D-xylose 1-dehydrogenase (EC 1.1.1.175) | 0.9868 | 16 | 266 |
GO:0047838
|
| AF-A0A2T2PSP7-F1-model_v4 | 3-oxoacyl-ACP reductase | 0.9853 | 16 | 266 |
GO:0016491
|
| AF-A0A1M5K9F9-F1-model_v4 | NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family | 0.9828 | 16 | 268 |
GO:0016491
|
| AF-A0A2G6YA75-F1-model_v4 | NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) | 0.9808 | 19 | 268 |
GO:0016491
|
| AF-A0A1H1HW12-F1-model_v4 | NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family (SDR family oxidoreductase) | 0.9732 | 16 | 268 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar