F433732

General Info

Members Datasets Scaffolds Average Seq Length
397 269 388 153

Family's Representative Sequence

Representative Sequence 3300006177|Ga0075362_10312028|Ga0075362_103120282
Length 165
Sequence MATRLMILNGPNLNLLGIREPHIYGKTTLDEIEAACRKAAELLGVDLAFHQSNHEGQIVDLIQAARTAADAIIINPAALSFTSISIIDALKVFEGPIIELHVSNIHARDELHRHSKTSTAATAVICGLGPYGYTVAMLAAVQRLGKVPAALPASLRLSPGSEATP

Samples

Sample ID Description Type Environment
1 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
2 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
3 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
4 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
5 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
6 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
7 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
8 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
102 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
103 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
106 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
107 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
194 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
232 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
233 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
234 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
235 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
236 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
237 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
238 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
239 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
240 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
241 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
242 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
243 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
244 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
245 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
246 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
247 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
248 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
249 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
250 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
251 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
252 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
253 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
254 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
255 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
256 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
257 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
258 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
259 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
260 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
261 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
262 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
263 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
264 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
265 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
269 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 0.25
Isolates 2.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.41
Nodule 1.01
Rhizoplane 0.5
Rhizosphere 70.53
Stem 0
Stem Tuber 0
Unclassified 6.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1041148 3300003214 Bacteria 593
2 Ga0055543_1003801 3300004625 Bacteria 4295
3 Ga0065165_1000435 3300005262 Bacteria 65756
4 Ga0070676_10233172 3300005328 Bacteria 1221
5 Ga0070690_100185042 3300005330 Bacteria 1441
6 Ga0070670_100811703 3300005331 Bacteria 845
7 Ga0068869_100396224 3300005334 Bacteria 1134
8 Ga0070689_100145286 3300005340 Bacteria 1910
9 Ga0070714_100231973 3300005435 Bacteria 1701
10 Ga0070713_100092897 3300005436 Bacteria 2599
11 Ga0070713_100193423 3300005436 Bacteria 1834
12 Ga0070711_100899793 3300005439 Bacteria 755
13 Ga0070711_101142160 3300005439 Bacteria 672
14 Ga0070705_100052727 3300005440 Bacteria 2378
15 Ga0070694_100006411 3300005444 Bacteria 7137
16 Ga0070663_100132323 3300005455 Bacteria 1895
17 Ga0070663_100245074 3300005455 Bacteria 1416
18 Ga0070685_11027105 3300005466 Bacteria 620
19 Ga0070706_101965008 3300005467 Bacteria 530
20 Ga0070679_100282023 3300005530 Bacteria 1614
21 Ga0070695_100119043 3300005545 Bacteria 1804
22 Ga0070693_100463989 3300005547 Bacteria 891
23 Ga0070665_101503619 3300005548 Bacteria 682
24 Ga0068855_101517806 3300005563 Bacteria 687
25 Ga0068857_100568335 3300005577 Unclassified 1069
26 Ga0068854_100002522 3300005578 Bacteria 11340
27 Ga0068856_100053587 3300005614 Bacteria 3977
28 Ga0068852_100005022 3300005616 Bacteria 9405
29 Ga0068864_100201077 3300005618 Bacteria 1830
30 Ga0068851_10033147 3300005834 Bacteria 2573
31 Ga0068863_100632363 3300005841 Bacteria 1061
32 Ga0068858_100700066 3300005842 Bacteria 986
33 Ga0068858_100719092 3300005842 Bacteria 972
34 Ga0081455_10250914 3300005937 Bacteria 1294
35 Ga0081455_10589944 3300005937 Bacteria 726
36 Ga0081538_10028093 3300005981 Bacteria 3880
37 Ga0081540_1017245 3300005983 Bacteria 4477
38 Ga0081539_10196288 3300005985 Bacteria 936
39 Ga0070717_10777190 3300006028 Bacteria 871
40 Ga0075365_10037179 3300006038 Bacteria 3159
41 Ga0075363_100179167 3300006048 Bacteria 1205
42 Ga0075363_100395128 3300006048 Bacteria 812
43 Ga0075364_10046725 3300006051 Bacteria 2819
44 Ga0075364_10200738 3300006051 Bacteria 1352
45 Ga0070715_10112061 3300006163 Bacteria 1288
46 Ga0075362_10169405 3300006177 Bacteria 1054
47 Ga0075362_10312028 3300006177 Bacteria 782
48 Ga0075362_10681746 3300006177 Bacteria 535
49 Ga0075367_10007984 3300006178 Bacteria 5456
50 Ga0075369_10061664 3300006186 Bacteria 1637
51 Ga0075369_10234203 3300006186 Bacteria 851
52 Ga0075369_10507263 3300006186 Unclassified 574
53 Ga0075366_10012158 3300006195 Bacteria 4877
54 Ga0075434_102092595 3300006871 Bacteria 571
55 Ga0105240_10020276 3300009093 Bacteria 8874
56 Ga0105245_11251887 3300009098 Bacteria 790
57 Ga0105247_10226458 3300009101 Bacteria 1268
58 Ga0114129_10200718 3300009147 Bacteria 2701
59 Ga0105241_10003863 3300009174 Bacteria 11105
60 Ga0105241_10267269 3300009174 Bacteria 1456
61 Ga0105248_10351476 3300009177 Bacteria 1660
62 Ga0105237_10615845 3300009545 Bacteria 1092
63 Ga0105238_10031939 3300009551 Bacteria 5357
64 Ga0105249_10600182 3300009553 Unclassified 1155
65 Ga0105239_12089369 3300010375 Bacteria 658
66 Ga0157378_10381590 3300013297 Bacteria 1384
67 Ga0157378_10740448 3300013297 Bacteria 1005
68 Ga0163163_10318270 3300014325 Bacteria 1609
69 Ga0209564_1014814 3300025295 Bacteria 3214
70 Ga0207656_10171894 3300025321 Bacteria 1036
71 Ga0207653_10084124 3300025885 Bacteria 1106
72 Ga0207685_10150219 3300025905 Bacteria 1053
73 Ga0207654_10000811 3300025911 Bacteria 17219
74 Ga0207695_10004350 3300025913 Bacteria 19398
75 Ga0207671_10130337 3300025914 Bacteria 1930
76 Ga0207663_10790213 3300025916 Bacteria 755
77 Ga0207660_10147028 3300025917 Bacteria 1807
78 Ga0207681_10189789 3300025923 Bacteria 1571
79 Ga0207694_10001415 3300025924 Bacteria 20567
80 Ga0207659_10454968 3300025926 Bacteria 1079
81 Ga0207700_10024448 3300025928 Bacteria 4181
82 Ga0207700_10293614 3300025928 Bacteria 1401
83 Ga0207686_11167778 3300025934 Bacteria 629
84 Ga0207670_10016640 3300025936 Bacteria 4425
85 Ga0207689_10179972 3300025942 Bacteria 1743
86 Ga0207667_10011741 3300025949 Bacteria 10158
87 Ga0207640_10049935 3300025981 Bacteria 2711
88 Ga0207640_10500331 3300025981 Bacteria 1012
89 Ga0207703_10467527 3300026035 Bacteria 1180
90 Ga0207703_10879761 3300026035 Bacteria 857
91 Ga0207639_10541222 3300026041 Bacteria 1068
92 Ga0207678_10267611 3300026067 Bacteria 1465
93 Ga0207678_11382241 3300026067 Bacteria 623
94 Ga0207702_10000003 3300026078 Bacteria 434196
95 Ga0207641_10592898 3300026088 Bacteria 1084
96 Ga0207648_10460535 3300026089 Bacteria 1159
97 Ga0207676_10082898 3300026095 Bacteria 2610
98 Ga0207676_10389831 3300026095 Bacteria 1299
99 Ga0207676_10844212 3300026095 Bacteria 896
100 Ga0207674_10009035 3300026116 Bacteria 11446
101 Ga0207675_100705297 3300026118 Bacteria 1018
102 Ga0207698_10497090 3300026142 Bacteria 1186
103 Ga0207428_10017894 3300027907 Bacteria 6074
104 Ga0268266_10279469 3300028379 Bacteria 1552
105 Ga0268264_10097439 3300028381 Bacteria 2549
106 Ga0268264_10099849 3300028381 Bacteria 2520
107 Ga0265334_10129053 3300028573 Bacteria 900
108 Ga0307515_10240527 3300028794 Bacteria 1582
109 Ga0265332_10082656 3300031238 Bacteria 1362
110 Ga0265316_10061278 3300031344 Bacteria 2923
111 Ga0307513_10536355 3300031456 Bacteria 884
112 Ga0307410_11226694 3300031852 Bacteria 654
113 Ga0373926_0008850 3300035083 Bacteria 3354
114 Ga0373934_0013015 3300035086 Bacteria 3142
115 Ga0373944_0115531 3300035089 Bacteria 920
116 Ga0373923_0031353 3300035111 Bacteria 2143
117 Ga0373932_0102513 3300035112 Bacteria 933
118 Ga0373945_0094065 3300035116 Bacteria 1164
119 Ga0373953_0155825 3300035117 Bacteria 980
120 Ga0373954_0013573 3300035118 Bacteria 3631
121 Ga0373954_0310799 3300035118 Bacteria 778
122 Ga0373956_0015694 3300035119 Bacteria 3175
123 Ga0373957_0024769 3300035120 Bacteria 2157
124 Ga0373943_0000221 3300035170 Bacteria 23249
125 Ga0373955_0005668 3300035172 Bacteria 5623
126 Ga0373924_0011222 3300035410 Bacteria 3322
127 Ga0373927_0001024 3300035695 Bacteria 21270
128 Ga0373927_0444008 3300035695 Bacteria 857
129 Ga0373933_0010450 3300035724 Bacteria 5089
130 Ga0373947_0028495 3300035725 Bacteria 3275
131 Ga0373947_0029741 3300035725 Bacteria 3206
132 Ga0373937_0263710 3300036401 Bacteria 1625
133 Ga0372808_060163 3300036459 Bacteria 546
134 Ga0373925_0001261 3300037068 Bacteria 22350
135 Ga0373925_0086820 3300037068 Bacteria 2387
136 Ga0373925_0500812 3300037068 Bacteria 997
137 Ga0436364_0150342 3300037853 Bacteria 870
138 Ga0436360_0961766 3300039438 Bacteria 3215
139 Ga0436361_0334695 3300039447 Bacteria 1556
140 Ga0436362_0303526 3300039453 Bacteria 799
141 Ga0451843_0505448 3300041509 Bacteria 502
142 Ga0451577_0359994 3300042876 Bacteria 1320
143 Ga0466966_0029119 3300044684 Bacteria 3595
144 Ga0466957_0316533 3300044842 Bacteria 1052
145 Ga0451576_1260387 3300045051 Bacteria 771
146 Ga0466958_0058221 3300045836 Bacteria 2349
147 Ga0495592_0000678 3300046454 Bacteria 23715
148 Ga0495592_0018339 3300046454 Bacteria 5321
149 Ga0495592_0071260 3300046454 Bacteria 2530
150 Ga0495629_0001117 3300046459 Bacteria 21242
151 Ga0495638_0383457 3300046460 Bacteria 733
152 Ga0495651_0005001 3300046462 Bacteria 10126
153 Ga0495651_0451491 3300046462 Bacteria 830
154 Ga0495653_0003431 3300046463 Bacteria 12744
155 Ga0495653_0006249 3300046463 Bacteria 9775
156 Ga0495653_0111779 3300046463 Bacteria 1962
157 Ga0495582_0115546 3300046473 Bacteria 1509
158 Ga0495662_0001783 3300046476 Bacteria 10780
159 Ga0495662_0112822 3300046476 Bacteria 1332
160 Ga0495664_0000500 3300046477 Bacteria 19536
161 Ga0495664_0227241 3300046477 Bacteria 1129
162 Ga0495664_0257589 3300046477 Bacteria 1055
163 Ga0495607_0114593 3300046501 Bacteria 1424
164 Ga0495606_0204497 3300046507 Bacteria 1123
165 Ga0495608_0000255 3300046511 Bacteria 38655
166 Ga0495608_0094758 3300046511 Bacteria 1929
167 Ga0495608_0473501 3300046511 Bacteria 760
168 Ga0495610_0156375 3300046512 Bacteria 968
169 Ga0495616_0231006 3300046513 Bacteria 802
170 Ga0495618_0001353 3300046514 Bacteria 16474
171 Ga0495618_0090321 3300046514 Bacteria 1959
172 Ga0495618_0159751 3300046514 Bacteria 1437
173 Ga0495618_0532375 3300046514 Bacteria 705
174 Ga0495618_0832931 3300046514 Bacteria 536
175 Ga0495628_0060053 3300046516 Bacteria 2984
176 Ga0495628_0089370 3300046516 Bacteria 2386
177 Ga0495628_0152424 3300046516 Bacteria 1760
178 Ga0495630_0005930 3300046517 Bacteria 8639
179 Ga0495630_0011300 3300046517 Bacteria 6459
180 Ga0495631_0086713 3300046518 Bacteria 1348
181 Ga0495632_0073451 3300046519 Bacteria 1640
182 Ga0495637_0132188 3300046520 Bacteria 952
183 Ga0495643_0134499 3300046522 Bacteria 1238
184 Ga0495648_0032067 3300046524 Bacteria 3453
185 Ga0495648_0196978 3300046524 Bacteria 1012
186 Ga0495666_0044795 3300046526 Bacteria 2135
187 Ga0495652_0004491 3300046529 Bacteria 13321
188 Ga0495652_0022114 3300046529 Bacteria 5647
189 Ga0495652_0036456 3300046529 Bacteria 4276
190 Ga0495654_0016304 3300046530 Bacteria 3931
191 Ga0495665_0044031 3300046531 Bacteria 2372
192 Ga0495640_0003333 3300046533 Bacteria 12927
193 Ga0495640_0060528 3300046533 Bacteria 2574
194 Ga0495586_0202486 3300046535 Bacteria 1125
195 Ga0495645_0001258 3300046543 Bacteria 17280
196 Ga0495645_0003933 3300046543 Bacteria 10132
197 Ga0495645_0079217 3300046543 Bacteria 2360
198 Ga0495622_0018272 3300046557 Bacteria 3266
199 Ga0495667_0021813 3300046559 Bacteria 4319
200 Ga0495667_0038472 3300046559 Bacteria 3185
201 Ga0495634_0006118 3300046642 Bacteria 9164
202 Ga0495634_0012354 3300046642 Bacteria 6184
203 Ga0495634_0156106 3300046642 Bacteria 1440
204 Ga0495634_0349932 3300046642 Bacteria 885
205 Ga0495611_0386471 3300046648 Bacteria 640
206 Ga0495611_0431758 3300046648 Bacteria 601
207 Ga0495625_0075548 3300046660 Bacteria 2357
208 Ga0495635_0003030 3300046663 Bacteria 11546
209 Ga0495635_0006966 3300046663 Bacteria 7896
210 Ga0495635_0202482 3300046663 Bacteria 1346
211 Ga0495635_0493705 3300046663 Bacteria 806
212 Ga0495661_0242640 3300046665 Bacteria 923
213 Ga0495661_0293566 3300046665 Bacteria 816
214 Ga0495657_0002141 3300046675 Bacteria 16768
215 Ga0495657_0004450 3300046675 Bacteria 11195
216 Ga0495599_0013466 3300046678 Bacteria 5053
217 Ga0495623_0020644 3300046679 Bacteria 4257
218 Ga0495623_0022111 3300046679 Bacteria 4107
219 Ga0495646_0031052 3300046680 Bacteria 3333
220 Ga0495646_0077856 3300046680 Bacteria 1939
221 Ga0495646_0337087 3300046680 Bacteria 792
222 Ga0495613_0493586 3300046689 Bacteria 825
223 Ga0495624_0004076 3300046690 Bacteria 10749
224 Ga0495624_0029201 3300046690 Bacteria 3599
225 Ga0495671_0408791 3300046692 Bacteria 649
226 Ga0495649_0032906 3300046694 Bacteria 2855
227 Ga0495600_0002862 3300046809 Bacteria 10046
228 Ga0495600_0012728 3300046809 Bacteria 5267
229 Ga0495660_0121799 3300046810 Bacteria 1319
230 Ga0495581_0025529 3300047315 Bacteria 3426
231 Ga0495581_0192161 3300047315 Bacteria 1194
232 Ga0495604_0005254 3300047317 Bacteria 10261
233 Ga0495604_0007044 3300047317 Bacteria 8916
234 Ga0495604_0285092 3300047317 Bacteria 1114
235 Ga0495674_0000595 3300047319 Bacteria 33874
236 Ga0495674_0018548 3300047319 Bacteria 6476
237 Ga0495672_0145633 3300047320 Bacteria 1233
238 Ga0495676_0083087 3300047321 Bacteria 2422
239 Ga0495676_0083572 3300047321 Bacteria 2412
240 Ga0495676_0186005 3300047321 Bacteria 1452
241 Ga0495680_0004989 3300047322 Bacteria 12548
242 Ga0495680_0011212 3300047322 Bacteria 7959
243 Ga0495675_0009337 3300047444 Bacteria 6099
244 Ga0495675_0158247 3300047444 Bacteria 1396
245 Ga0495677_0128903 3300047445 Bacteria 968
246 Ga0495684_0001677 3300047471 Bacteria 17797
247 Ga0495684_0001832 3300047471 Bacteria 17072
248 Ga0495684_0039059 3300047471 Bacteria 3638
249 Ga0495684_0080508 3300047471 Bacteria 2473
250 Ga0495686_0098398 3300047472 Bacteria 1768
251 Ga0495593_0013484 3300047673 Bacteria 4661
252 Ga0495602_0045740 3300048088 Bacteria 3959
253 Ga0495602_0050980 3300048088 Bacteria 3691
254 Ga0496112_0276869 3300048915 Bacteria 1626
255 Ga0496116_0006171 3300048919 Bacteria 10957
256 Ga0496117_0062647 3300048920 Bacteria 2547
257 Ga0496118_0058337 3300048921 Bacteria 2885
258 Ga0496118_0067566 3300048921 Bacteria 2601
259 Ga0496118_0118805 3300048921 Bacteria 1730
260 Ga0496120_0046768 3300048923 Bacteria 2499
261 Ga0496121_0013412 3300048924 Bacteria 8809
262 Ga0496121_0023327 3300048924 Bacteria 5964
263 Ga0496121_0292478 3300048924 Bacteria 1109
264 Ga0496122_0125916 3300048925 Bacteria 1640
265 Ga0496123_0009986 3300048926 Bacteria 8458
266 Ga0496123_0068600 3300048926 Bacteria 2232
267 Ga0496125_0020013 3300048928 Bacteria 6291
268 Ga0496125_0064275 3300048928 Bacteria 2917
269 Ga0496126_0033621 3300048929 Bacteria 4822
270 Ga0496126_0235893 3300048929 Bacteria 1530
271 Ga0496126_0267083 3300048929 Bacteria 1421
272 Ga0496126_0528342 3300048929 Bacteria 939
273 Ga0495678_062761 3300049459 Bacteria 1390
274 Ga0501033_0341292 3300049570 Bacteria 1050
275 Ga0501036_0122317 3300049572 Bacteria 2198
276 Ga0501036_1419009 3300049572 Bacteria 563
277 Ga0501039_0073081 3300049575 Bacteria 2665
278 Ga0501040_0227528 3300049576 Bacteria 1328
279 Ga0501041_0046673 3300049577 Bacteria 2636
280 Ga0501041_0119614 3300049577 Bacteria 1636
281 Ga0501041_0626187 3300049577 Bacteria 687
282 Ga0501042_0024332 3300049578 Bacteria 4247
283 Ga0501043_0254569 3300049579 Bacteria 1352
284 Ga0501048_0240246 3300049582 Bacteria 1285
285 Ga0501072_0138584 3300049588 Bacteria 1940
286 Ga0501072_0639572 3300049588 Bacteria 838
287 Ga0501072_1003840 3300049588 Bacteria 650
288 Ga0501073_0219097 3300049589 Bacteria 1315
289 Ga0501074_0177746 3300049590 Bacteria 1519
290 Ga0501074_0677632 3300049590 Bacteria 728
291 Ga0501075_0022112 3300049591 Bacteria 4643
292 Ga0501075_0030254 3300049591 Bacteria 4010
293 Ga0501075_0693671 3300049591 Bacteria 776
294 Ga0501076_0005645 3300049592 Bacteria 9017
295 Ga0501076_0055520 3300049592 Bacteria 3141
296 Ga0501076_0254793 3300049592 Bacteria 1436
297 Ga0501076_0806065 3300049592 Bacteria 775
298 Ga0501077_0206724 3300049593 Bacteria 1247
299 Ga0501079_0030905 3300049741 Bacteria 4115
300 Ga0501080_0067477 3300049742 Bacteria 3327
301 Ga0501080_0800333 3300049742 Bacteria 827
302 Ga0501081_0015411 3300049743 Bacteria 5044
303 Ga0501083_0081534 3300049744 Bacteria 2144
304 nmdc:mga03683_132022_c1 3300050489 Bacteria 1118
305 nmdc:mga03683_282301_c1 3300050489 Bacteria 776
306 nmdc:mga03n38_147392_c1 3300050490 Bacteria 1181
307 nmdc:mga03n38_199920_c1 3300050490 Bacteria 1034
308 nmdc:mga00v17_1081908_c1 3300050491 Bacteria 503
309 nmdc:mga00v17_79158_c1 3300050491 Bacteria 2049
310 nmdc:mga0yw44_21809_c1 3300050492 Bacteria 3581
311 nmdc:mga0yw44_470963_c1 3300050492 Bacteria 852
312 nmdc:mga0yw44_77735_c1 3300050492 Bacteria 2074
313 nmdc:mga0k408_5032_c1 3300050493 Bacteria 6999
314 nmdc:mga0k408_619709_c1 3300050493 Bacteria 637
315 nmdc:mga06z11_285343_c1 3300050494 Bacteria 979
316 nmdc:mga04h51_35939_c1 3300050495 Bacteria 1591
317 nmdc:mga05p37_319976_c1 3300050507 Bacteria 1836
318 nmdc:mga08y16_166650_c1 3300050511 Bacteria 2289
319 nmdc:mga0a205_368186_c1 3300050515 Bacteria 1303
320 nmdc:mga0sz30_11825_c1 3300050516 Bacteria 3382
321 nmdc:mga0sz30_135136_c1 3300050516 Bacteria 1088
322 nmdc:mga0sz30_456649_c1 3300050516 Unclassified 574
323 nmdc:mga0sz30_470060_c1 3300050516 Bacteria 565
324 nmdc:mga0sz30_59715_c1 3300050516 Bacteria 1627
325 Ga0495601_0010587 3300053077 Bacteria 5493
326 Ga0495601_0035207 3300053077 Bacteria 3124
327 Ga0495612_0003396 3300053078 Bacteria 6596
328 Ga0495595_0010537 3300053084 Bacteria 3844
329 Ga0495619_0007046 3300053085 Bacteria 7114
330 Ga0495619_0019063 3300053085 Bacteria 4359
331 Ga0495619_0396282 3300053085 Bacteria 953
332 Ga0500578_0272046 3300053086 Bacteria 1013
333 Ga0500643_000085 3300053087 Bacteria 98026
334 Ga0500643_074561 3300053087 Bacteria 938
335 Ga0500646_0001150 3300053090 Bacteria 7153
336 Ga0500583_0056943 3300053092 Bacteria 1833
337 Ga0500651_0173462 3300053093 Bacteria 1284
338 Ga0500566_0001138 3300053094 Bacteria 15446
339 Ga0500566_0152756 3300053094 Bacteria 1212
340 Ga0500641_0010572 3300053096 Bacteria 3337
341 Ga0500641_0295863 3300053096 Bacteria 666
342 Ga0500650_0007164 3300053098 Bacteria 4321
343 Ga0500554_045373 3300053102 Bacteria 1365
344 Ga0500555_002436 3300053103 Bacteria 5389
345 Ga0500556_0000004 3300053104 Bacteria 666287
346 Ga0500569_020075 3300053109 Bacteria 1747
347 Ga0500572_070880 3300053111 Bacteria 1077
348 Ga0500592_002107 3300053116 Bacteria 3206
349 Ga0500594_0116166 3300053118 Bacteria 836
350 Ga0500595_022777 3300053119 Bacteria 2210
351 Ga0500618_011643 3300053125 Bacteria 2327
352 Ga0500642_0000036 3300053130 Bacteria 104249
353 Ga0500642_0001998 3300053130 Bacteria 5921
354 Ga0500642_0086538 3300053130 Bacteria 1445
355 Ga0500652_000042 3300053131 Bacteria 67099
356 Ga0500652_001282 3300053131 Bacteria 7967
357 Ga0500658_0029998 3300053134 Bacteria 2119
358 Ga0500559_0000835 3300053136 Bacteria 19960
359 Ga0500559_0010835 3300053136 Bacteria 3908
360 Ga0500568_0000881 3300053139 Bacteria 21071
361 Ga0500568_0008498 3300053139 Bacteria 4940
362 Ga0500577_0052482 3300053142 Bacteria 1537
363 Ga0500590_033885 3300053148 Bacteria 2646
364 Ga0500590_236646 3300053148 Bacteria 739
365 Ga0500604_0017287 3300053151 Bacteria 1994
366 Ga0500616_0000014 3300053153 Bacteria 637918
367 Ga0500619_225413 3300053154 Bacteria 623
368 Ga0500622_0001597 3300053156 Bacteria 17813
369 Ga0500627_0005113 3300053158 Bacteria 4312
370 Ga0500627_0115859 3300053158 Bacteria 1207
371 Ga0500627_0357162 3300053158 Bacteria 629
372 Ga0500633_0129936 3300053160 Bacteria 940
373 Ga0500633_0273181 3300053160 Bacteria 626
374 Ga0500634_0101283 3300053161 Bacteria 1441
375 Ga0500634_0125719 3300053161 Bacteria 1240
376 Ga0500636_0002134 3300053177 Bacteria 10915
377 Ga0500636_0213616 3300053177 Bacteria 1010
378 Ga0500637_0166652 3300053178 Bacteria 1268
379 Ga0500570_097752 3300053724 Bacteria 1249
380 Ga0500645_016041 3300053730 Bacteria 2365
381 Ga0500645_117054 3300053730 Bacteria 745
382 Ga0501084_0020372 3300054114 Bacteria 5531
383 Ga0501084_0110741 3300054114 Bacteria 2307
384 Ga0501084_0226806 3300054114 Bacteria 1576
385 Ga0501082_0011070 3300060353 Bacteria 7756
386 Ga0501082_0089387 3300060353 Bacteria 2659
387 Ga0530510_0148752 3300061734 Bacteria 1728
388 Ga0530510_0295640 3300061734 Bacteria 1211

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_0150342 Ga0436364_0150342_129_611 134
2 iso_pu_bacteria 2602042107 2603859412 140
3 iso_pu_bacteria 2893066018 2893071289 140
4 iso_pu_bacteria 2919073203 2919076684 141
5 3300048921 Ga0496118_0118805 Ga0496118_0118805_556_987 143
6 3300050511 nmdc:mga08y16_166650_c1 nmdc:mga08y16_166650_c1_1848_2279 143
7 3300005331 Ga0070670_100811703 Ga0070670_1008117031 144
8 3300005455 Ga0070663_100132323 Ga0070663_1001323232 144
9 3300006038 Ga0075365_10037179 Ga0075365_100371794 144
10 3300006048 Ga0075363_100395128 Ga0075363_1003951282 144
11 3300006051 Ga0075364_10200738 Ga0075364_102007382 144
12 3300006186 Ga0075369_10061664 Ga0075369_100616642 144
13 3300025295 Ga0209564_1014814 Ga0209564_10148143 144
14 3300026067 Ga0207678_10267611 Ga0207678_102676112 144
15 3300028379 Ga0268266_10279469 Ga0268266_102794691 144
16 3300028573 Ga0265334_10129053 Ga0265334_101290531 144
17 3300028794 Ga0307515_10240527 Ga0307515_102405272 144
18 3300031238 Ga0265332_10082656 Ga0265332_100826562 144
19 3300031344 Ga0265316_10061278 Ga0265316_100612783 144
20 3300031456 Ga0307513_10536355 Ga0307513_105363552 144
21 3300035086 Ga0373934_0013015 Ga0373934_0013015_2594_3034 144
22 3300035111 Ga0373923_0031353 Ga0373923_0031353_574_1014 144
23 3300035117 Ga0373953_0155825 Ga0373953_0155825_140_580 144
24 3300035118 Ga0373954_0013573 Ga0373954_0013573_1639_2079 144
25 3300035119 Ga0373956_0015694 Ga0373956_0015694_2176_2616 144
26 3300035120 Ga0373957_0024769 Ga0373957_0024769_892_1332 144
27 3300035172 Ga0373955_0005668 Ga0373955_0005668_1800_2240 144
28 3300035410 Ga0373924_0011222 Ga0373924_0011222_892_1332 144
29 3300035724 Ga0373933_0010450 Ga0373933_0010450_2286_2726 144
30 3300036459 Ga0372808_060163 Ga0372808_060163_45_485 144
31 3300046454 Ga0495592_0000678 Ga0495592_0000678_2460_2900 144
32 3300046459 Ga0495629_0001117 Ga0495629_0001117_5493_5933 144
33 3300046460 Ga0495638_0383457 Ga0495638_0383457_26_463 144
34 3300046462 Ga0495651_0451491 Ga0495651_0451491_296_736 144
35 3300046463 Ga0495653_0003431 Ga0495653_0003431_3794_4234 144
36 3300046477 Ga0495664_0257589 Ga0495664_0257589_531_971 144
37 3300046501 Ga0495607_0114593 Ga0495607_0114593_721_1158 144
38 3300046511 Ga0495608_0000255 Ga0495608_0000255_2868_3308 144
39 3300046512 Ga0495610_0156375 Ga0495610_0156375_76_513 144
40 3300046513 Ga0495616_0231006 Ga0495616_0231006_179_616 144
41 3300046514 Ga0495618_0159751 Ga0495618_0159751_605_1045 144
42 3300046516 Ga0495628_0060053 Ga0495628_0060053_876_1316 144
43 3300046519 Ga0495632_0073451 Ga0495632_0073451_128_565 144
44 3300046524 Ga0495648_0032067 Ga0495648_0032067_2812_3249 144
45 3300046529 Ga0495652_0022114 Ga0495652_0022114_2922_3362 144
46 3300046530 Ga0495654_0016304 Ga0495654_0016304_2526_2963 144
47 3300046533 Ga0495640_0060528 Ga0495640_0060528_1919_2359 144
48 3300046543 Ga0495645_0003933 Ga0495645_0003933_6845_7285 144
49 3300046557 Ga0495622_0018272 Ga0495622_0018272_2264_2701 144
50 3300046559 Ga0495667_0021813 Ga0495667_0021813_209_649 144
51 3300046642 Ga0495634_0006118 Ga0495634_0006118_1932_2372 144
52 3300046648 Ga0495611_0431758 Ga0495611_0431758_17_454 144
53 3300046660 Ga0495625_0075548 Ga0495625_0075548_951_1388 144
54 3300046663 Ga0495635_0006966 Ga0495635_0006966_346_786 144
55 3300046665 Ga0495661_0242640 Ga0495661_0242640_118_555 144
56 3300046678 Ga0495599_0013466 Ga0495599_0013466_1677_2117 144
57 3300046679 Ga0495623_0020644 Ga0495623_0020644_2141_2581 144
58 3300046680 Ga0495646_0077856 Ga0495646_0077856_706_1146 144
59 3300046692 Ga0495671_0408791 Ga0495671_0408791_33_470 144
60 3300046809 Ga0495600_0002862 Ga0495600_0002862_5705_6145 144
61 3300046810 Ga0495660_0121799 Ga0495660_0121799_447_884 144
62 3300047317 Ga0495604_0005254 Ga0495604_0005254_3571_4011 144
63 3300047319 Ga0495674_0018548 Ga0495674_0018548_5067_5507 144
64 3300047320 Ga0495672_0145633 Ga0495672_0145633_582_1019 144
65 3300047322 Ga0495680_0004989 Ga0495680_0004989_5324_5764 144
66 3300047444 Ga0495675_0009337 Ga0495675_0009337_209_649 144
67 3300047471 Ga0495684_0001832 Ga0495684_0001832_5595_6035 144
68 3300047472 Ga0495686_0098398 Ga0495686_0098398_1042_1479 144
69 3300047673 Ga0495593_0013484 Ga0495593_0013484_1837_2277 144
70 3300048088 Ga0495602_0050980 Ga0495602_0050980_1811_2251 144
71 3300048919 Ga0496116_0006171 Ga0496116_0006171_3300_3746 144
72 3300048920 Ga0496117_0062647 Ga0496117_0062647_1718_2164 144
73 3300048921 Ga0496118_0058337 Ga0496118_0058337_1086_1532 144
74 3300048921 Ga0496118_0067566 Ga0496118_0067566_78_515 144
75 3300048923 Ga0496120_0046768 Ga0496120_0046768_1972_2409 144
76 3300048924 Ga0496121_0013412 Ga0496121_0013412_47_484 144
77 3300048925 Ga0496122_0125916 Ga0496122_0125916_966_1412 144
78 3300048926 Ga0496123_0068600 Ga0496123_0068600_727_1173 144
79 3300048928 Ga0496125_0064275 Ga0496125_0064275_1018_1464 144
80 3300048929 Ga0496126_0235893 Ga0496126_0235893_462_899 144
81 3300048929 Ga0496126_0267083 Ga0496126_0267083_243_680 144
82 3300048929 Ga0496126_0528342 Ga0496126_0528342_337_783 144
83 3300050490 nmdc:mga03n38_199920_c1 nmdc:mga03n38_199920_c1_582_1019 144
84 3300050491 nmdc:mga00v17_79158_c1 nmdc:mga00v17_79158_c1_438_884 144
85 3300050492 nmdc:mga0yw44_77735_c1 nmdc:mga0yw44_77735_c1_1393_1839 144
86 3300050516 nmdc:mga0sz30_11825_c1 nmdc:mga0sz30_11825_c1_752_1198 144
87 3300053077 Ga0495601_0035207 Ga0495601_0035207_2590_3030 144
88 3300053084 Ga0495595_0010537 Ga0495595_0010537_346_786 144
89 3300053086 Ga0500578_0272046 Ga0500578_0272046_423_860 144
90 3300053094 Ga0500566_0001138 Ga0500566_0001138_6465_6902 144
91 3300053096 Ga0500641_0010572 Ga0500641_0010572_1416_1853 144
92 3300053098 Ga0500650_0007164 Ga0500650_0007164_355_792 144
93 3300053102 Ga0500554_045373 Ga0500554_045373_376_813 144
94 3300053104 Ga0500556_0000004 Ga0500556_0000004_358678_359115 144
95 3300053116 Ga0500592_002107 Ga0500592_002107_339_776 144
96 3300053125 Ga0500618_011643 Ga0500618_011643_1486_1923 144
97 3300053130 Ga0500642_0000036 Ga0500642_0000036_32244_32681 144
98 3300053131 Ga0500652_001282 Ga0500652_001282_4671_5108 144
99 3300053136 Ga0500559_0000835 Ga0500559_0000835_8324_8761 144
100 3300053139 Ga0500568_0000881 Ga0500568_0000881_16401_16838 144
101 3300053148 Ga0500590_033885 Ga0500590_033885_1160_1597 144
102 3300053151 Ga0500604_0017287 Ga0500604_0017287_362_799 144
103 3300053153 Ga0500616_0000014 Ga0500616_0000014_385973_386410 144
104 3300053154 Ga0500619_225413 Ga0500619_225413_106_543 144
105 3300053156 Ga0500622_0001597 Ga0500622_0001597_2624_3061 144
106 3300053158 Ga0500627_0005113 Ga0500627_0005113_1145_1582 144
107 3300053160 Ga0500633_0129936 Ga0500633_0129936_462_899 144
108 3300053177 Ga0500636_0002134 Ga0500636_0002134_5104_5541 144
109 3300053178 Ga0500637_0166652 Ga0500637_0166652_465_902 144
110 3300053724 Ga0500570_097752 Ga0500570_097752_130_567 144
111 3300053730 Ga0500645_016041 Ga0500645_016041_352_789 144
112 3300046507 Ga0495606_0204497 Ga0495606_0204497_456_896 145
113 3300046518 Ga0495631_0086713 Ga0495631_0086713_808_1248 145
114 3300046520 Ga0495637_0132188 Ga0495637_0132188_388_828 145
115 3300046522 Ga0495643_0134499 Ga0495643_0134499_597_1037 145
116 3300047445 Ga0495677_0128903 Ga0495677_0128903_443_883 145
117 3300048926 Ga0496123_0009986 Ga0496123_0009986_47_487 145
118 3300048928 Ga0496125_0020013 Ga0496125_0020013_2538_2978 145
119 3300049459 Ga0495678_062761 Ga0495678_062761_566_1006 145
120 3300050492 nmdc:mga0yw44_470963_c1 nmdc:mga0yw44_470963_c1_194_634 145
121 3300053087 Ga0500643_074561 Ga0500643_074561_157_597 145
122 3300053090 Ga0500646_0001150 Ga0500646_0001150_1512_1952 145
123 3300053109 Ga0500569_020075 Ga0500569_020075_1182_1622 145
124 3300053161 Ga0500634_0101283 Ga0500634_0101283_273_713 145
125 3300006048 Ga0075363_100179167 Ga0075363_1001791672 147
126 3300006177 Ga0075362_10681746 Ga0075362_106817461 147
127 3300050490 nmdc:mga03n38_147392_c1 nmdc:mga03n38_147392_c1_605_1048 147
128 3300005435 Ga0070714_100231973 Ga0070714_1002319731 148
129 3300005436 Ga0070713_100092897 Ga0070713_1000928973 148
130 3300005436 Ga0070713_100193423 Ga0070713_1001934232 148
131 3300005439 Ga0070711_101142160 Ga0070711_1011421601 148
132 3300005467 Ga0070706_101965008 Ga0070706_1019650081 148
133 3300006028 Ga0070717_10777190 Ga0070717_107771902 148
134 3300006051 Ga0075364_10046725 Ga0075364_100467252 148
135 3300006178 Ga0075367_10007984 Ga0075367_100079844 148
136 3300025928 Ga0207700_10024448 Ga0207700_100244482 148
137 3300025928 Ga0207700_10293614 Ga0207700_102936142 148
138 3300035083 Ga0373926_0008850 Ga0373926_0008850_2651_3106 148
139 3300035089 Ga0373944_0115531 Ga0373944_0115531_283_732 148
140 3300035116 Ga0373945_0094065 Ga0373945_0094065_401_850 148
141 3300035170 Ga0373943_0000221 Ga0373943_0000221_15632_16081 148
142 3300035695 Ga0373927_0001024 Ga0373927_0001024_18209_18658 148
143 3300035695 Ga0373927_0444008 Ga0373927_0444008_312_761 148
144 3300035725 Ga0373947_0028495 Ga0373947_0028495_2708_3157 148
145 3300035725 Ga0373947_0029741 Ga0373947_0029741_2127_2576 148
146 3300036401 Ga0373937_0263710 Ga0373937_0263710_13_462 148
147 3300037068 Ga0373925_0001261 Ga0373925_0001261_7012_7461 148
148 3300037068 Ga0373925_0086820 Ga0373925_0086820_95_544 148
149 3300041509 Ga0451843_0505448 Ga0451843_0505448_18_467 148
150 3300046454 Ga0495592_0071260 Ga0495592_0071260_1291_1740 148
151 3300046463 Ga0495653_0006249 Ga0495653_0006249_4508_4957 148
152 3300046473 Ga0495582_0115546 Ga0495582_0115546_552_1001 148
153 3300046476 Ga0495662_0001783 Ga0495662_0001783_2049_2498 148
154 3300046476 Ga0495662_0112822 Ga0495662_0112822_385_834 148
155 3300046477 Ga0495664_0000500 Ga0495664_0000500_11965_12414 148
156 3300046514 Ga0495618_0001353 Ga0495618_0001353_8354_8803 148
157 3300046514 Ga0495618_0832931 Ga0495618_0832931_56_505 148
158 3300046516 Ga0495628_0152424 Ga0495628_0152424_251_700 148
159 3300046517 Ga0495630_0005930 Ga0495630_0005930_5513_5962 148
160 3300046517 Ga0495630_0011300 Ga0495630_0011300_1073_1522 148
161 3300046526 Ga0495666_0044795 Ga0495666_0044795_238_687 148
162 3300046531 Ga0495665_0044031 Ga0495665_0044031_1574_2023 148
163 3300046533 Ga0495640_0003333 Ga0495640_0003333_11965_12414 148
164 3300046535 Ga0495586_0202486 Ga0495586_0202486_51_500 148
165 3300046543 Ga0495645_0001258 Ga0495645_0001258_11868_12317 148
166 3300046642 Ga0495634_0012354 Ga0495634_0012354_5530_5979 148
167 3300046642 Ga0495634_0156106 Ga0495634_0156106_408_857 148
168 3300046663 Ga0495635_0003030 Ga0495635_0003030_10584_11033 148
169 3300046663 Ga0495635_0493705 Ga0495635_0493705_81_530 148
170 3300046680 Ga0495646_0031052 Ga0495646_0031052_1289_1738 148
171 3300046690 Ga0495624_0004076 Ga0495624_0004076_9649_10098 148
172 3300046690 Ga0495624_0029201 Ga0495624_0029201_516_965 148
173 3300047315 Ga0495581_0025529 Ga0495581_0025529_68_517 148
174 3300047319 Ga0495674_0000595 Ga0495674_0000595_3467_3916 148
175 3300047321 Ga0495676_0083572 Ga0495676_0083572_871_1320 148
176 3300047321 Ga0495676_0186005 Ga0495676_0186005_475_924 148
177 3300047471 Ga0495684_0001677 Ga0495684_0001677_9127_9576 148
178 3300047471 Ga0495684_0039059 Ga0495684_0039059_2683_3132 148
179 3300049577 Ga0501041_0119614 Ga0501041_0119614_1108_1557 148
180 3300049588 Ga0501072_0138584 Ga0501072_0138584_376_825 148
181 3300049590 Ga0501074_0177746 Ga0501074_0177746_349_798 148
182 3300049591 Ga0501075_0022112 Ga0501075_0022112_348_797 148
183 3300049592 Ga0501076_0005645 Ga0501076_0005645_1221_1670 148
184 3300049593 Ga0501077_0206724 Ga0501077_0206724_507_956 148
185 3300049741 Ga0501079_0030905 Ga0501079_0030905_2906_3355 148
186 3300049742 Ga0501080_0067477 Ga0501080_0067477_1092_1541 148
187 3300049743 Ga0501081_0015411 Ga0501081_0015411_3942_4391 148
188 3300050491 nmdc:mga00v17_1081908_c1 nmdc:mga00v17_1081908_c1_22_471 148
189 3300050492 nmdc:mga0yw44_21809_c1 nmdc:mga0yw44_21809_c1_1547_1996 148
190 3300050494 nmdc:mga06z11_285343_c1 nmdc:mga06z11_285343_c1_498_947 148
191 3300050495 nmdc:mga04h51_35939_c1 nmdc:mga04h51_35939_c1_1099_1548 148
192 3300050516 nmdc:mga0sz30_135136_c1 nmdc:mga0sz30_135136_c1_363_812 148
193 3300053077 Ga0495601_0010587 Ga0495601_0010587_255_704 148
194 3300053078 Ga0495612_0003396 Ga0495612_0003396_1181_1630 148
195 3300053085 Ga0495619_0007046 Ga0495619_0007046_2695_3144 148
196 3300053085 Ga0495619_0396282 Ga0495619_0396282_222_671 148
197 3300053094 Ga0500566_0152756 Ga0500566_0152756_68_517 148
198 3300053119 Ga0500595_022777 Ga0500595_022777_901_1350 148
199 3300053130 Ga0500642_0086538 Ga0500642_0086538_271_720 148
200 3300053131 Ga0500652_000042 Ga0500652_000042_40949_41398 148
201 3300053177 Ga0500636_0213616 Ga0500636_0213616_208_657 148
202 3300053730 Ga0500645_117054 Ga0500645_117054_113_562 148
203 3300054114 Ga0501084_0020372 Ga0501084_0020372_4627_5076 148
204 3300060353 Ga0501082_0011070 Ga0501082_0011070_4959_5408 148
205 3300005530 Ga0070679_100282023 Ga0070679_1002820232 149
206 3300005937 Ga0081455_10250914 Ga0081455_102509141 149
207 3300005983 Ga0081540_1017245 Ga0081540_10172454 149
208 3300013297 Ga0157378_10740448 Ga0157378_107404482 150
209 3300031852 Ga0307410_11226694 Ga0307410_112266941 150
210 3300049572 Ga0501036_1419009 Ga0501036_1419009_32_487 150
211 3300049744 Ga0501083_0081534 Ga0501083_0081534_608_1063 150
212 3300054114 Ga0501084_0226806 Ga0501084_0226806_876_1331 150
213 3300060353 Ga0501082_0089387 Ga0501082_0089387_1514_1966 150
214 3300005985 Ga0081539_10196288 Ga0081539_101962882 151
215 3300009147 Ga0114129_10200718 Ga0114129_102007182 152
216 3300044684 Ga0466966_0029119 Ga0466966_0029119_2757_3218 152
217 3300044842 Ga0466957_0316533 Ga0466957_0316533_446_907 152
218 3300045836 Ga0466958_0058221 Ga0466958_0058221_159_620 152
219 3300050507 nmdc:mga05p37_319976_c1 nmdc:mga05p37_319976_c1_888_1349 152
220 3300048915 Ga0496112_0276869 Ga0496112_0276869_394_858 153
221 3300050516 nmdc:mga0sz30_470060_c1 nmdc:mga0sz30_470060_c1_82_546 154
222 3300009553 Ga0105249_10600182 Ga0105249_106001822 155
223 3300035118 Ga0373954_0310799 Ga0373954_0310799_288_767 155
224 3300049592 Ga0501076_0806065 Ga0501076_0806065_269_736 155
225 iso_pu_bacteria 2511231028 2511399482 156
226 iso_pu_bacteria 2617270735 2617351879 156
227 iso_pu_bacteria 2874628541 2874629806 156
228 iso_pu_bacteria 2932801729 2932803128 156
229 iso_pu_bacteria 3005718088 3005722030 156
230 iso_pu_bacteria 8019648815 8019656930 156
231 3300005439 Ga0070711_100899793 Ga0070711_1008997931 158
232 3300005455 Ga0070663_100245074 Ga0070663_1002450742 158
233 3300005466 Ga0070685_11027105 Ga0070685_110271051 158
234 3300005547 Ga0070693_100463989 Ga0070693_1004639892 158
235 3300005563 Ga0068855_101517806 Ga0068855_1015178061 158
236 3300005577 Ga0068857_100568335 Ga0068857_1005683352 158
237 3300005578 Ga0068854_100002522 Ga0068854_1000025228 158
238 3300005614 Ga0068856_100053587 Ga0068856_1000535875 158
239 3300005616 Ga0068852_100005022 Ga0068852_1000050227 158
240 3300005834 Ga0068851_10033147 Ga0068851_100331472 158
241 3300006163 Ga0070715_10112061 Ga0070715_101120612 158
242 3300009093 Ga0105240_10020276 Ga0105240_1002027610 158
243 3300009174 Ga0105241_10003863 Ga0105241_1000386310 158
244 3300009545 Ga0105237_10615845 Ga0105237_106158452 158
245 3300009551 Ga0105238_10031939 Ga0105238_100319392 158
246 3300025321 Ga0207656_10171894 Ga0207656_101718942 158
247 3300025885 Ga0207653_10084124 Ga0207653_100841241 158
248 3300025905 Ga0207685_10150219 Ga0207685_101502192 158
249 3300025911 Ga0207654_10000811 Ga0207654_1000081111 158
250 3300025913 Ga0207695_10004350 Ga0207695_100043509 158
251 3300025914 Ga0207671_10130337 Ga0207671_101303371 158
252 3300025916 Ga0207663_10790213 Ga0207663_107902131 158
253 3300025917 Ga0207660_10147028 Ga0207660_101470283 158
254 3300025923 Ga0207681_10189789 Ga0207681_101897893 158
255 3300025924 Ga0207694_10001415 Ga0207694_1000141518 158
256 3300025926 Ga0207659_10454968 Ga0207659_104549682 158
257 3300025936 Ga0207670_10016640 Ga0207670_100166404 158
258 3300025942 Ga0207689_10179972 Ga0207689_101799722 158
259 3300025949 Ga0207667_10011741 Ga0207667_1001174112 158
260 3300025981 Ga0207640_10049935 Ga0207640_100499351 158
261 3300025981 Ga0207640_10500331 Ga0207640_105003312 158
262 3300026035 Ga0207703_10467527 Ga0207703_104675272 158
263 3300026041 Ga0207639_10541222 Ga0207639_105412222 158
264 3300026067 Ga0207678_11382241 Ga0207678_113822411 158
265 3300026078 Ga0207702_10000003 Ga0207702_1000000329 158
266 3300026089 Ga0207648_10460535 Ga0207648_104605352 158
267 3300026095 Ga0207676_10082898 Ga0207676_100828983 158
268 3300026116 Ga0207674_10009035 Ga0207674_1000903515 158
269 3300026118 Ga0207675_100705297 Ga0207675_1007052972 158
270 3300026142 Ga0207698_10497090 Ga0207698_104970901 158
271 3300028381 Ga0268264_10097439 Ga0268264_100974393 158
272 3300049570 Ga0501033_0341292 Ga0501033_0341292_412_888 158
273 3300049572 Ga0501036_0122317 Ga0501036_0122317_182_658 158
274 3300049575 Ga0501039_0073081 Ga0501039_0073081_1833_2309 158
275 3300049576 Ga0501040_0227528 Ga0501040_0227528_132_608 158
276 3300049577 Ga0501041_0046673 Ga0501041_0046673_2053_2529 158
277 3300049577 Ga0501041_0626187 Ga0501041_0626187_170_646 158
278 3300049578 Ga0501042_0024332 Ga0501042_0024332_2414_2890 158
279 3300049579 Ga0501043_0254569 Ga0501043_0254569_788_1264 158
280 3300049582 Ga0501048_0240246 Ga0501048_0240246_140_616 158
281 3300049588 Ga0501072_1003840 Ga0501072_1003840_87_563 158
282 3300049589 Ga0501073_0219097 Ga0501073_0219097_260_736 158
283 3300049591 Ga0501075_0030254 Ga0501075_0030254_694_1170 158
284 3300049592 Ga0501076_0055520 Ga0501076_0055520_2001_2477 158
285 3300049592 Ga0501076_0254793 Ga0501076_0254793_701_1177 158
286 3300049742 Ga0501080_0800333 Ga0501080_0800333_20_496 158
287 3300053118 Ga0500594_0116166 Ga0500594_0116166_190_672 158
288 3300053130 Ga0500642_0001998 Ga0500642_0001998_4177_4659 158
289 3300053158 Ga0500627_0357162 Ga0500627_0357162_118_600 158
290 3300054114 Ga0501084_0110741 Ga0501084_0110741_1686_2162 158
291 3300061734 Ga0530510_0148752 Ga0530510_0148752_600_1076 158
292 3300061734 Ga0530510_0295640 Ga0530510_0295640_643_1119 158
293 3300006186 Ga0075369_10234203 Ga0075369_102342032 159
294 3300009177 Ga0105248_10351476 Ga0105248_103514762 159
295 3300050516 nmdc:mga0sz30_59715_c1 nmdc:mga0sz30_59715_c1_341_826 159
296 3300003214 JGI25165J46597_1041148 JGI25165J46597_10411481 160
297 3300004625 Ga0055543_1003801 Ga0055543_10038014 160
298 3300005262 Ga0065165_1000435 Ga0065165_10004359 160
299 3300005328 Ga0070676_10233172 Ga0070676_102331721 160
300 3300005330 Ga0070690_100185042 Ga0070690_1001850422 160
301 3300005334 Ga0068869_100396224 Ga0068869_1003962242 160
302 3300005340 Ga0070689_100145286 Ga0070689_1001452863 160
303 3300005440 Ga0070705_100052727 Ga0070705_1000527273 160
304 3300005444 Ga0070694_100006411 Ga0070694_1000064114 160
305 3300005545 Ga0070695_100119043 Ga0070695_1001190433 160
306 3300005548 Ga0070665_101503619 Ga0070665_1015036192 160
307 3300005618 Ga0068864_100201077 Ga0068864_1002010772 160
308 3300005841 Ga0068863_100632363 Ga0068863_1006323632 160
309 3300005842 Ga0068858_100700066 Ga0068858_1007000662 160
310 3300005842 Ga0068858_100719092 Ga0068858_1007190921 160
311 3300005937 Ga0081455_10589944 Ga0081455_105899441 160
312 3300005981 Ga0081538_10028093 Ga0081538_100280934 160
313 3300006177 Ga0075362_10169405 Ga0075362_101694051 160
314 3300006177 Ga0075362_10312028 Ga0075362_103120282 160
315 3300006186 Ga0075369_10507263 Ga0075369_105072631 160
316 3300006195 Ga0075366_10012158 Ga0075366_100121582 160
317 3300006871 Ga0075434_102092595 Ga0075434_1020925951 160
318 3300009098 Ga0105245_11251887 Ga0105245_112518872 160
319 3300009101 Ga0105247_10226458 Ga0105247_102264582 160
320 3300009174 Ga0105241_10267269 Ga0105241_102672691 160
321 3300010375 Ga0105239_12089369 Ga0105239_120893691 160
322 3300013297 Ga0157378_10381590 Ga0157378_103815902 160
323 3300014325 Ga0163163_10318270 Ga0163163_103182702 160
324 3300025934 Ga0207686_11167778 Ga0207686_111677781 160
325 3300026035 Ga0207703_10879761 Ga0207703_108797612 160
326 3300026088 Ga0207641_10592898 Ga0207641_105928982 160
327 3300026095 Ga0207676_10389831 Ga0207676_103898312 160
328 3300026095 Ga0207676_10844212 Ga0207676_108442122 160
329 3300027907 Ga0207428_10017894 Ga0207428_100178944 160
330 3300028381 Ga0268264_10099849 Ga0268264_100998493 160
331 3300035112 Ga0373932_0102513 Ga0373932_0102513_14_496 160
332 3300037068 Ga0373925_0500812 Ga0373925_0500812_336_818 160
333 3300039438 Ga0436360_0961766 Ga0436360_0961766_2226_2708 160
334 3300039447 Ga0436361_0334695 Ga0436361_0334695_955_1437 160
335 3300039453 Ga0436362_0303526 Ga0436362_0303526_129_611 160
336 3300042876 Ga0451577_0359994 Ga0451577_0359994_415_897 160
337 3300045051 Ga0451576_1260387 Ga0451576_1260387_152_634 160
338 3300046454 Ga0495592_0018339 Ga0495592_0018339_4424_4918 160
339 3300046462 Ga0495651_0005001 Ga0495651_0005001_2876_3370 160
340 3300046463 Ga0495653_0111779 Ga0495653_0111779_1054_1548 160
341 3300046477 Ga0495664_0227241 Ga0495664_0227241_196_690 160
342 3300046511 Ga0495608_0094758 Ga0495608_0094758_64_558 160
343 3300046511 Ga0495608_0473501 Ga0495608_0473501_35_529 160
344 3300046514 Ga0495618_0090321 Ga0495618_0090321_271_765 160
345 3300046514 Ga0495618_0532375 Ga0495618_0532375_24_518 160
346 3300046516 Ga0495628_0089370 Ga0495628_0089370_1167_1661 160
347 3300046524 Ga0495648_0196978 Ga0495648_0196978_406_900 160
348 3300046529 Ga0495652_0004491 Ga0495652_0004491_65_559 160
349 3300046529 Ga0495652_0036456 Ga0495652_0036456_2876_3370 160
350 3300046543 Ga0495645_0079217 Ga0495645_0079217_367_861 160
351 3300046559 Ga0495667_0038472 Ga0495667_0038472_945_1439 160
352 3300046642 Ga0495634_0349932 Ga0495634_0349932_25_519 160
353 3300046648 Ga0495611_0386471 Ga0495611_0386471_124_618 160
354 3300046663 Ga0495635_0202482 Ga0495635_0202482_218_712 160
355 3300046665 Ga0495661_0293566 Ga0495661_0293566_203_697 160
356 3300046675 Ga0495657_0002141 Ga0495657_0002141_364_858 160
357 3300046675 Ga0495657_0004450 Ga0495657_0004450_3959_4453 160
358 3300046679 Ga0495623_0022111 Ga0495623_0022111_2955_3449 160
359 3300046680 Ga0495646_0337087 Ga0495646_0337087_148_642 160
360 3300046689 Ga0495613_0493586 Ga0495613_0493586_239_733 160
361 3300046694 Ga0495649_0032906 Ga0495649_0032906_1304_1798 160
362 3300046809 Ga0495600_0012728 Ga0495600_0012728_844_1338 160
363 3300047315 Ga0495581_0192161 Ga0495581_0192161_423_917 160
364 3300047317 Ga0495604_0007044 Ga0495604_0007044_7759_8253 160
365 3300047317 Ga0495604_0285092 Ga0495604_0285092_301_795 160
366 3300047321 Ga0495676_0083087 Ga0495676_0083087_1791_2285 160
367 3300047322 Ga0495680_0011212 Ga0495680_0011212_4520_5014 160
368 3300047444 Ga0495675_0158247 Ga0495675_0158247_329_823 160
369 3300047471 Ga0495684_0080508 Ga0495684_0080508_690_1184 160
370 3300048088 Ga0495602_0045740 Ga0495602_0045740_1349_1843 160
371 3300048924 Ga0496121_0023327 Ga0496121_0023327_889_1371 160
372 3300048924 Ga0496121_0292478 Ga0496121_0292478_586_1080 160
373 3300048929 Ga0496126_0033621 Ga0496126_0033621_2194_2688 160
374 3300049588 Ga0501072_0639572 Ga0501072_0639572_248_730 160
375 3300049590 Ga0501074_0677632 Ga0501074_0677632_136_618 160
376 3300049591 Ga0501075_0693671 Ga0501075_0693671_186_680 160
377 3300050489 nmdc:mga03683_132022_c1 nmdc:mga03683_132022_c1_525_1019 160
378 3300050489 nmdc:mga03683_282301_c1 nmdc:mga03683_282301_c1_113_610 160
379 3300050493 nmdc:mga0k408_5032_c1 nmdc:mga0k408_5032_c1_1713_2210 160
380 3300050493 nmdc:mga0k408_619709_c1 nmdc:mga0k408_619709_c1_128_622 160
381 3300050515 nmdc:mga0a205_368186_c1 nmdc:mga0a205_368186_c1_585_1067 160
382 3300050516 nmdc:mga0sz30_456649_c1 nmdc:mga0sz30_456649_c1_43_528 160
383 3300053085 Ga0495619_0019063 Ga0495619_0019063_525_1019 160
384 3300053087 Ga0500643_000085 Ga0500643_000085_38440_38934 160
385 3300053092 Ga0500583_0056943 Ga0500583_0056943_951_1445 160
386 3300053093 Ga0500651_0173462 Ga0500651_0173462_462_944 160
387 3300053096 Ga0500641_0295863 Ga0500641_0295863_144_638 160
388 3300053103 Ga0500555_002436 Ga0500555_002436_120_614 160
389 3300053111 Ga0500572_070880 Ga0500572_070880_506_988 160
390 3300053134 Ga0500658_0029998 Ga0500658_0029998_1381_1875 160
391 3300053136 Ga0500559_0010835 Ga0500559_0010835_435_917 160
392 3300053139 Ga0500568_0008498 Ga0500568_0008498_4413_4907 160
393 3300053142 Ga0500577_0052482 Ga0500577_0052482_101_595 160
394 3300053148 Ga0500590_236646 Ga0500590_236646_138_632 160
395 3300053158 Ga0500627_0115859 Ga0500627_0115859_493_987 160
396 3300053160 Ga0500633_0273181 Ga0500633_0273181_41_535 160
397 3300053161 Ga0500634_0125719 Ga0500634_0125719_50_544 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01220

DHquinase_II

Dehydroquinase class II

4

141

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hs9-assembly1.cif.gz_A the crystal structure of type ii dehydroquinase from butyrivibrio crossotus dsm 2876 0.9892 2 137
1gqo-assembly2.cif.gz_V type ii dehydroquinase from bacillus subtilis 0.9758 4 141
1gqo-assembly1.cif.gz_K type ii dehydroquinase from bacillus subtilis 0.9754 4 141
3n8k-assembly2.cif.gz_M type ii dehydroquinase from mycobacterium tuberculosis complexed with citrazinic acid 0.9738 4 143
3n59-assembly2.cif.gz_N type ii dehydroquinase from mycobacterium tuberculosis complexed with 3-dehydroshikimate 0.9731 4 137
ID Description Score Start End Superfamily
1gqoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9705 4 141 3.40.50.9100
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.954 4 142 3.40.50.9100
2c57B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9538 4 144 3.40.50.9100
1gqoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9438 4 141 3.40.50.9100
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9335 4 142 3.40.50.9100
ID Description Score Start End GO Terms
AF-A0A383BXM7-F1-model_v4 3-dehydroquinate dehydratase (EC 4.2.1.10) 0.9959 2 132 GO:0003855
GO:0019631
AF-A0A844SA87-F1-model_v4 deleted 0.9958 3 139
AF-A8ES39-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9958 4 142 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A2M8RAI0-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9949 3 139 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0016020
GO:0019631
AF-A0A1M5IIH2-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9945 3 142 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631

Feature Viewer

pLDDT pTM Quality
93.58 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map