F433651

General Info

Members Datasets Scaffolds Average Seq Length
396 258 372 303

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2904434214|2904438230
Length 358
Sequence IKKMRVEYAVFADSGLYVVTPVLYKWHFMLTSDIPMERKSGNLKPLLFQDGNSGERDVRDIDLKTLRLFVAVCDHGNIKRAAEEEHIEPSAISKRIAHLEADLGVPLLARSRRGVEPTPAGVALVEHGRNVLFTLERIGSDVAVFGDGLRGRVSVCASVSAIAETLLDDIASFMGESANKNIRVDIEERLSTDLVRQLREGTASVGVCWDNVDLQGLEHRPYRSDKLALAVHPAHPLANQKKLSFSQTLDYEHVGLLPSTAVHTMLRRAAASAGKTLSYRVIVSNFDAAFRVVASGLGISVIPVEVATTYQSVFKVKIIPLTDTWTKRNFVVCFKQFNFLQAPAKALVEHLTRRAEKA

Samples

Sample ID Description Type Environment
1 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
2 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
3 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
4 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
5 2643221569 Achromobacter sp. Root565 Isolate Unclassified
6 2643221594 Achromobacter sp. Root170 Isolate Unclassified
7 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
8 2721755523 Delftia sp. HK171 Isolate Unclassified
9 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
10 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
11 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
12 2818991450 Burkholderia sp. 604 Isolate Unclassified
13 2842733646 Variovorax sp. R-72446 Isolate Unclassified
14 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
15 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
16 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
17 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
18 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
19 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
20 2928163908 Burkholderia sp. 567 Isolate Unclassified
21 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
22 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
78 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
123 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
136 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
137 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
138 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
139 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
140 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
141 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
142 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
143 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
144 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
145 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
146 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
147 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
148 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
149 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
150 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
151 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
152 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
155 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
156 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
191 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
202 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
203 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
212 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
215 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
219 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
246 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
247 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
248 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
249 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
250 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
254 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
255 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
256 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
257 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
258 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.69
Metatranscriptomes 0.25
Isolates 6.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.82
Nodule 1.01
Rhizoplane 9.34
Rhizosphere 69.7
Stem 0
Stem Tuber 0
Unclassified 13.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10002019 3300002067 Bacteria 7141
2 rootL2_10006840 3300003322 Bacteria 9226
3 Ga0055534_1000581 3300003784 Bacteria 19193
4 Ga0065165_1000445 3300005262 Bacteria 64885
5 Ga0070676_10007458 3300005328 Bacteria 5872
6 Ga0070670_100004577 3300005331 Bacteria 11604
7 Ga0070670_100505899 3300005331 Bacteria 1075
8 Ga0070680_100010840 3300005336 Bacteria 7038
9 Ga0070682_100240476 3300005337 Bacteria 1299
10 Ga0070661_100163622 3300005344 Bacteria 1686
11 Ga0070668_100019098 3300005347 Bacteria 5153
12 Ga0070669_100049515 3300005353 Bacteria 3067
13 Ga0070671_100002269 3300005355 Bacteria 14840
14 Ga0070674_100009788 3300005356 Bacteria 5763
15 Ga0070673_100005422 3300005364 Bacteria 8162
16 Ga0070667_100458768 3300005367 Bacteria 1165
17 Ga0070663_100003236 3300005455 Bacteria 9366
18 Ga0070663_100115149 3300005455 Bacteria 2025
19 Ga0070678_100014490 3300005456 Bacteria 4976
20 Ga0070678_100180587 3300005456 Bacteria 1727
21 Ga0068867_100016411 3300005459 Bacteria 5257
22 Ga0068867_100059876 3300005459 Bacteria 2823
23 Ga0070679_100009552 3300005530 Bacteria 9175
24 Ga0068853_100450244 3300005539 Bacteria 1211
25 Ga0070672_100008793 3300005543 Bacteria 6933
26 Ga0068855_100032274 3300005563 Bacteria 6253
27 Ga0070664_100033215 3300005564 Bacteria 4320
28 Ga0070664_100264861 3300005564 Bacteria 1547
29 Ga0068852_100022429 3300005616 Bacteria 5063
30 Ga0068852_100108952 3300005616 Bacteria 2514
31 Ga0068852_100297502 3300005616 Bacteria 1561
32 Ga0068864_100079637 3300005618 Bacteria 2869
33 Ga0068861_100016333 3300005719 Bacteria 5251
34 Ga0068861_100445681 3300005719 Bacteria 1159
35 Ga0068851_10025815 3300005834 Bacteria 2884
36 Ga0068860_100304661 3300005843 Bacteria 1562
37 Ga0068862_100034165 3300005844 Bacteria 4301
38 Ga0075363_100051837 3300006048 Bacteria 2189
39 Ga0075363_100168321 3300006048 Bacteria 1243
40 Ga0075362_10052306 3300006177 Bacteria 1830
41 Ga0075366_10083001 3300006195 Bacteria 1915
42 Ga0075366_10262117 3300006195 Bacteria 1055
43 Ga0097621_100042713 3300006237 Bacteria 3653
44 Ga0075370_10002282 3300006353 Bacteria 8844
45 Ga0075370_10005093 3300006353 Bacteria 6478
46 Ga0105251_10000029 3300009011 Bacteria 125097
47 Ga0105251_10007715 3300009011 Bacteria 6572
48 Ga0105244_10043858 3300009036 Bacteria 2305
49 Ga0105250_10008770 3300009092 Bacteria 4282
50 Ga0105240_10060145 3300009093 Bacteria 4737
51 Ga0105240_10114575 3300009093 Bacteria 3256
52 Ga0105247_10102130 3300009101 Bacteria 1834
53 Ga0105243_10005581 3300009148 Bacteria 9799
54 Ga0105237_10244868 3300009545 Bacteria 1794
55 Ga0105238_10127924 3300009551 Bacteria 2518
56 Ga0105238_10434283 3300009551 Bacteria 1309
57 Ga0105239_10005253 3300010375 Bacteria 15232
58 Ga0157373_10000863 3300013100 Bacteria 23540
59 Ga0157371_10111198 3300013102 Bacteria 1945
60 Ga0157370_10001259 3300013104 Bacteria 31648
61 Ga0157370_10264172 3300013104 Bacteria 1590
62 Ga0157369_10012465 3300013105 Bacteria 9645
63 Ga0157374_10153434 3300013296 Bacteria 2240
64 Ga0157378_10251000 3300013297 Bacteria 1694
65 Ga0157378_10437406 3300013297 Bacteria 1296
66 Ga0163162_10007402 3300013306 Bacteria 10676
67 Ga0163162_10226646 3300013306 Bacteria 1999
68 Ga0163162_10454465 3300013306 Bacteria 1413
69 Ga0157372_10326478 3300013307 Bacteria 1787
70 Ga0182008_10001106 3300014497 Bacteria 18562
71 Ga0182006_1037796 3300015261 Bacteria 1912
72 Ga0182007_10000694 3300015262 Bacteria 19233
73 Ga0182005_1034615 3300015265 Bacteria 1374
74 Ga0183362_10003 3300015683 Bacteria 977584
75 Ga0163161_10050685 3300017792 Bacteria 3005
76 Ga0163161_10097397 3300017792 Bacteria 2185
77 Ga0197907_10794738 3300020069 Bacteria 2406
78 Ga0209130_1001847 3300025284 Bacteria 12171
79 Ga0209675_1001683 3300025291 Bacteria 12287
80 Ga0209675_1031803 3300025291 Bacteria 1244
81 Ga0209050_1004495 3300025298 Bacteria 9385
82 Ga0209050_1041394 3300025298 Bacteria 1271
83 Ga0207426_1000004 3300025302 Bacteria 1047900
84 Ga0207426_1003394 3300025302 Bacteria 8718
85 Ga0209051_1007980 3300025303 Bacteria 5684
86 Ga0209051_1010322 3300025303 Bacteria 4733
87 Ga0209257_1011627 3300025304 Bacteria 4206
88 Ga0207697_10002827 3300025315 Bacteria 8833
89 Ga0207656_10028799 3300025321 Bacteria 2282
90 Ga0207713_1000112 3300025735 Bacteria 133341
91 Ga0207713_1035662 3300025735 Bacteria 2144
92 Ga0207682_10018107 3300025893 Bacteria 2752
93 Ga0207642_10057804 3300025899 Bacteria 1786
94 Ga0207710_10089014 3300025900 Bacteria 1442
95 Ga0207647_10011320 3300025904 Bacteria 6261
96 Ga0207647_10236589 3300025904 Bacteria 1050
97 Ga0207645_10005701 3300025907 Bacteria 8996
98 Ga0207695_10093196 3300025913 Bacteria 3022
99 Ga0207660_10014565 3300025917 Bacteria 5174
100 Ga0207662_10009515 3300025918 Bacteria 5352
101 Ga0207681_10003007 3300025923 Bacteria 10599
102 Ga0207650_10000667 3300025925 Bacteria 26981
103 Ga0207659_10002251 3300025926 Bacteria 11481
104 Ga0207644_10010722 3300025931 Bacteria 6043
105 Ga0207644_10058191 3300025931 Bacteria 2793
106 Ga0207644_10139943 3300025931 Bacteria 1863
107 Ga0207706_10012120 3300025933 Bacteria 7852
108 Ga0207669_10010117 3300025937 Bacteria 4528
109 Ga0207691_10009271 3300025940 Bacteria 9442
110 Ga0207691_10012304 3300025940 Bacteria 8203
111 Ga0207689_10007011 3300025942 Bacteria 9908
112 Ga0207679_10018081 3300025945 Bacteria 4714
113 Ga0207667_10011546 3300025949 Bacteria 10260
114 Ga0207651_10005663 3300025960 Bacteria 6442
115 Ga0207712_10044080 3300025961 Bacteria 3081
116 Ga0207668_10014756 3300025972 Bacteria 4842
117 Ga0207658_10081372 3300025986 Bacteria 2483
118 Ga0207658_10306920 3300025986 Bacteria 1369
119 Ga0207677_10076393 3300026023 Bacteria 2384
120 Ga0207678_10003427 3300026067 Bacteria 14284
121 Ga0207678_10039769 3300026067 Bacteria 4079
122 Ga0207708_10017835 3300026075 Bacteria 5342
123 Ga0207648_10024639 3300026089 Bacteria 5367
124 Ga0207676_10188217 3300026095 Bacteria 1814
125 Ga0207675_100013220 3300026118 Bacteria 7705
126 Ga0207683_10029034 3300026121 Bacteria 4787
127 Ga0207698_10057793 3300026142 Bacteria 3003
128 Ga0207698_10122782 3300026142 Bacteria 2202
129 Ga0207698_10192396 3300026142 Bacteria 1819
130 Ga0209371_1000431 3300027312 Bacteria 42664
131 Ga0268265_10063210 3300028380 Bacteria 2847
132 Ga0307517_10160610 3300028786 Bacteria 1510
133 Ga0268256_1000370 3300030500 Bacteria 42664
134 Ga0307513_10103009 3300031456 Bacteria 2872
135 Ga0307513_10132037 3300031456 Bacteria 2441
136 Ga0307405_10043306 3300031731 Bacteria 2746
137 Ga0307413_10118666 3300031824 Bacteria 1787
138 Ga0307412_10106738 3300031911 Bacteria 1991
139 Ga0307412_10257893 3300031911 Bacteria 1357
140 Ga0307409_100052353 3300031995 Bacteria 3129
141 Ga0307416_100044043 3300032002 Bacteria 3500
142 Ga0307416_100113762 3300032002 Bacteria 2392
143 Ga0307411_10156416 3300032005 Bacteria 1701
144 Ga0307411_10374233 3300032005 Bacteria 1169
145 Ga0307415_100000567 3300032126 Bacteria 16191
146 Ga0395898_0292098 3300037466 Bacteria 1555
147 Ga0395905_0003277 3300037471 Bacteria 17381
148 Ga0395905_0013387 3300037471 Bacteria 7859
149 Ga0395905_0111401 3300037471 Bacteria 2570
150 Ga0395905_0137195 3300037471 Bacteria 2302
151 Ga0436361_0757428 3300039447 Bacteria 38736
152 Ga0439436_0005538 3300041404 Bacteria 3867
153 Ga0439447_016686 3300041407 Bacteria 2011
154 Ga0439466_0002163 3300041411 Bacteria 7702
155 Ga0439465_0000917 3300041413 Bacteria 9321
156 Ga0451793_0920642 3300041452 Bacteria 1043
157 Ga0439431_0001260 3300041997 Bacteria 5553
158 Ga0439433_0003173 3300041999 Bacteria 3522
159 Ga0439433_0012228 3300041999 Bacteria 1882
160 Ga0439442_001908 3300042002 Bacteria 4091
161 Ga0439445_0003666 3300042004 Bacteria 3447
162 Ga0439445_0025685 3300042004 Bacteria 1504
163 Ga0439445_0060665 3300042004 Bacteria 1034
164 Ga0439448_0000493 3300042005 Bacteria 9123
165 Ga0439432_000428 3300042006 Bacteria 15693
166 Ga0439432_006154 3300042006 Bacteria 4297
167 Ga0439449_0001522 3300042007 Bacteria 9080
168 Ga0439449_0002808 3300042007 Bacteria 6769
169 Ga0439452_002665 3300042010 Bacteria 6489
170 Ga0439462_0006037 3300042015 Bacteria 2999
171 Ga0439462_0016320 3300042015 Bacteria 1918
172 Ga0450898_002070 3300042134 Bacteria 2757
173 Ga0450899_006402 3300042135 Bacteria 1275
174 Ga0450902_013150 3300042137 Bacteria 1332
175 Ga0450910_001999 3300042147 Bacteria 2644
176 Ga0439446_0001085 3300042156 Bacteria 6004
177 Ga0450909_003364 3300042185 Bacteria 2281
178 Ga0450909_006961 3300042185 Bacteria 1631
179 Ga0439434_0024671 3300042435 Bacteria 1814
180 Ga0466969_0022426 3300044656 Bacteria 3259
181 Ga0466969_0143273 3300044656 Bacteria 1104
182 Ga0466965_0005690 3300044683 Bacteria 5623
183 Ga0466965_0083719 3300044683 Bacteria 1615
184 Ga0466966_0000475 3300044684 Bacteria 25816
185 Ga0466966_0033691 3300044684 Bacteria 3315
186 Ga0466961_0022412 3300044693 Bacteria 4063
187 Ga0466971_0017031 3300044719 Bacteria 3213
188 Ga0466968_0041107 3300044735 Bacteria 1951
189 Ga0466957_0005057 3300044842 Bacteria 7380
190 Ga0466957_0045958 3300044842 Bacteria 2649
191 Ga0466960_0029992 3300044901 Bacteria 2500
192 Ga0466959_0048482 3300045049 Bacteria 3121
193 Ga0466959_0083646 3300045049 Bacteria 2298
194 Ga0466959_0145115 3300045049 Bacteria 1675
195 Ga0466958_0018189 3300045836 Bacteria 4074
196 Ga0495603_0042799 3300046455 Bacteria 2706
197 Ga0495590_0001006 3300046457 Bacteria 12443
198 Ga0495590_0052542 3300046457 Bacteria 1423
199 Ga0495629_0000639 3300046459 Bacteria 28355
200 Ga0495629_0006121 3300046459 Bacteria 8937
201 Ga0495651_0068492 3300046462 Bacteria 2705
202 Ga0495653_0000124 3300046463 Bacteria 65049
203 Ga0495653_0047778 3300046463 Bacteria 3309
204 Ga0495650_0005597 3300046471 Bacteria 8103
205 Ga0495650_0025943 3300046471 Bacteria 2736
206 Ga0495650_0049563 3300046471 Bacteria 1743
207 Ga0495580_0000364 3300046472 Bacteria 36962
208 Ga0495580_0012767 3300046472 Bacteria 6438
209 Ga0495580_0049633 3300046472 Bacteria 2969
210 Ga0495580_0077037 3300046472 Bacteria 2326
211 Ga0495582_0023038 3300046473 Bacteria 3406
212 Ga0495584_0015971 3300046491 Bacteria 3831
213 Ga0495596_0061503 3300046500 Bacteria 1462
214 Ga0495583_0000051 3300046506 Bacteria 212400
215 Ga0495583_0146750 3300046506 Bacteria 980
216 Ga0495606_0007730 3300046507 Bacteria 9520
217 Ga0495606_0040300 3300046507 Bacteria 3140
218 Ga0495606_0049548 3300046507 Bacteria 2753
219 Ga0495616_0110284 3300046513 Bacteria 1279
220 Ga0495618_0130862 3300046514 Bacteria 1606
221 Ga0495620_0035542 3300046515 Bacteria 2238
222 Ga0495628_0002705 3300046516 Bacteria 15870
223 Ga0495628_0093345 3300046516 Bacteria 2327
224 Ga0495630_0042094 3300046517 Bacteria 3411
225 Ga0495643_0000398 3300046522 Bacteria 57089
226 Ga0495666_0003628 3300046526 Bacteria 7803
227 Ga0495666_0004004 3300046526 Bacteria 7448
228 Ga0495666_0040669 3300046526 Bacteria 2253
229 Ga0495642_0000200 3300046528 Bacteria 35170
230 Ga0495642_0015822 3300046528 Bacteria 2936
231 Ga0495652_0025105 3300046529 Bacteria 5274
232 Ga0495654_0090308 3300046530 Bacteria 1422
233 Ga0495665_0000011 3300046531 Bacteria 71017
234 Ga0495665_0049397 3300046531 Bacteria 2231
235 Ga0495665_0100699 3300046531 Bacteria 1516
236 Ga0495586_0011346 3300046535 Bacteria 4739
237 Ga0495586_0135951 3300046535 Bacteria 1378
238 Ga0495621_0058223 3300046539 Bacteria 1397
239 Ga0495597_0004701 3300046542 Bacteria 7404
240 Ga0495645_0001361 3300046543 Bacteria 16526
241 Ga0495645_0020021 3300046543 Bacteria 4824
242 Ga0495645_0063621 3300046543 Bacteria 2671
243 Ga0495667_0053515 3300046559 Bacteria 2658
244 Ga0495635_0037195 3300046663 Bacteria 3370
245 Ga0495661_0012978 3300046665 Bacteria 5611
246 Ga0495623_0000739 3300046679 Bacteria 21877
247 Ga0495646_0014925 3300046680 Bacteria 4934
248 Ga0495646_0098720 3300046680 Bacteria 1677
249 Ga0495669_0009676 3300046684 Bacteria 4068
250 Ga0495613_0059636 3300046689 Bacteria 2797
251 Ga0495624_0000143 3300046690 Bacteria 51520
252 Ga0495624_0011788 3300046690 Bacteria 6001
253 Ga0495671_0096173 3300046692 Bacteria 1449
254 Ga0495649_0004438 3300046694 Bacteria 9171
255 Ga0495649_0136293 3300046694 Bacteria 1293
256 Ga0495589_0014534 3300046794 Bacteria 4052
257 Ga0495589_0059616 3300046794 Bacteria 1875
258 Ga0495600_0035427 3300046809 Bacteria 3241
259 Ga0495600_0100404 3300046809 Bacteria 1886
260 Ga0495660_0039894 3300046810 Bacteria 2605
261 Ga0495604_0001294 3300047317 Bacteria 20456
262 Ga0495604_0024275 3300047317 Bacteria 4838
263 Ga0495604_0075579 3300047317 Bacteria 2536
264 Ga0495604_0270571 3300047317 Bacteria 1151
265 Ga0495636_0000702 3300047318 Bacteria 12217
266 Ga0495674_0008085 3300047319 Bacteria 10037
267 Ga0495674_0020313 3300047319 Bacteria 6152
268 Ga0495674_0047380 3300047319 Bacteria 3812
269 Ga0495674_0096253 3300047319 Bacteria 2523
270 Ga0495676_0051752 3300047321 Bacteria 3283
271 Ga0495680_0003789 3300047322 Bacteria 14702
272 Ga0495683_0001006 3300047323 Bacteria 19647
273 Ga0495683_0024989 3300047323 Bacteria 3063
274 Ga0495683_0028163 3300047323 Bacteria 2873
275 Ga0495687_000020 3300047443 Bacteria 337717
276 Ga0495687_003307 3300047443 Bacteria 11823
277 Ga0495675_0074255 3300047444 Bacteria 2143
278 Ga0495675_0087776 3300047444 Bacteria 1954
279 Ga0495677_0020473 3300047445 Bacteria 2398
280 Ga0495679_011333 3300047446 Bacteria 3446
281 Ga0495593_0001586 3300047673 Bacteria 13420
282 Ga0495593_0026084 3300047673 Bacteria 3230
283 Ga0495593_0036832 3300047673 Bacteria 2650
284 Ga0495602_0001906 3300048088 Bacteria 20930
285 Ga0495602_0145033 3300048088 Bacteria 1874
286 Ga0495614_0011008 3300048089 Bacteria 3980
287 Ga0495626_0000868 3300048091 Bacteria 26883
288 Ga0495626_0001155 3300048091 Bacteria 22059
289 Ga0495626_0128705 3300048091 Bacteria 1083
290 Ga0496100_0000418 3300048903 Bacteria 20566
291 Ga0496100_0007055 3300048903 Bacteria 6164
292 Ga0496100_0021482 3300048903 Bacteria 3888
293 Ga0496100_0102102 3300048903 Bacteria 1978
294 Ga0496101_0000230 3300048904 Bacteria 41503
295 Ga0496101_0008793 3300048904 Bacteria 6608
296 Ga0496101_0044710 3300048904 Bacteria 3170
297 Ga0496101_0047078 3300048904 Bacteria 3095
298 Ga0496101_0071272 3300048904 Bacteria 2547
299 Ga0496102_0000794 3300048905 Bacteria 30723
300 Ga0496102_0083485 3300048905 Bacteria 2948
301 Ga0496103_0000545 3300048906 Bacteria 30219
302 Ga0496103_0097409 3300048906 Bacteria 1859
303 Ga0496104_0019076 3300048907 Bacteria 6268
304 Ga0496104_0020040 3300048907 Bacteria 6126
305 Ga0496104_0062890 3300048907 Bacteria 3520
306 Ga0496104_0123473 3300048907 Bacteria 2486
307 Ga0496105_0048109 3300048908 Bacteria 3520
308 Ga0496105_0062178 3300048908 Bacteria 3081
309 Ga0496105_0087502 3300048908 Bacteria 2574
310 Ga0496106_0029422 3300048909 Bacteria 4093
311 Ga0496106_0076927 3300048909 Bacteria 2558
312 Ga0496108_0261376 3300048911 Bacteria 1506
313 Ga0496110_0004366 3300048913 Bacteria 10947
314 Ga0496111_0007895 3300048914 Bacteria 7015
315 Ga0496112_0052657 3300048915 Bacteria 3995
316 Ga0496112_0068765 3300048915 Bacteria 3498
317 Ga0496112_0111830 3300048915 Bacteria 2701
318 Ga0496113_0010743 3300048916 Bacteria 6069
319 Ga0496113_0211681 3300048916 Bacteria 1543
320 Ga0496114_0001636 3300048917 Bacteria 16994
321 Ga0496114_0171872 3300048917 Bacteria 1889
322 Ga0496115_0112359 3300048918 Bacteria 2238
323 Ga0496115_0233712 3300048918 Bacteria 1516
324 Ga0496115_0490799 3300048918 Bacteria 988
325 Ga0496116_0001738 3300048919 Bacteria 23730
326 Ga0496116_0031144 3300048919 Bacteria 3824
327 Ga0496117_0001694 3300048920 Bacteria 30590
328 Ga0496117_0010954 3300048920 Bacteria 8172
329 Ga0496117_0031856 3300048920 Bacteria 4018
330 Ga0496117_0092974 3300048920 Bacteria 1936
331 Ga0496118_0000218 3300048921 Bacteria 100056
332 Ga0496118_0002433 3300048921 Bacteria 25052
333 Ga0496118_0049289 3300048921 Bacteria 3244
334 Ga0496118_0089927 3300048921 Bacteria 2118
335 Ga0496119_0065891 3300048922 Bacteria 2143
336 Ga0496119_0088886 3300048922 Bacteria 1760
337 Ga0496121_0001224 3300048924 Bacteria 44684
338 Ga0496121_0002057 3300048924 Bacteria 31838
339 Ga0496121_0020112 3300048924 Bacteria 6629
340 Ga0496121_0020408 3300048924 Bacteria 6562
341 Ga0496121_0260117 3300048924 Bacteria 1199
342 Ga0496122_0000199 3300048925 Bacteria 133898
343 Ga0496122_0000582 3300048925 Bacteria 74845
344 Ga0496122_0012331 3300048925 Bacteria 8529
345 Ga0496122_0095357 3300048925 Bacteria 2011
346 Ga0496123_0000102 3300048926 Bacteria 169327
347 Ga0496123_0000479 3300048926 Bacteria 69250
348 Ga0496123_0015579 3300048926 Bacteria 6225
349 Ga0496123_0034608 3300048926 Bacteria 3614
350 Ga0496124_0018952 3300048927 Bacteria 6424
351 Ga0496124_0084434 3300048927 Bacteria 2604
352 Ga0496124_0133829 3300048927 Bacteria 1966
353 Ga0496125_0009217 3300048928 Bacteria 10197
354 Ga0496125_0015784 3300048928 Bacteria 7278
355 Ga0496125_0039142 3300048928 Bacteria 4089
356 Ga0496125_0043997 3300048928 Bacteria 3782
357 Ga0496125_0046325 3300048928 Bacteria 3648
358 Ga0496126_0000511 3300048929 Bacteria 75804
359 Ga0501034_0000022 3300049571 Bacteria 264441
360 Ga0501206_001608 3300049653 Bacteria 2822
361 Ga0501257_021551 3300049686 Bacteria 1520
362 Ga0501262_001114 3300049759 Bacteria 3052
363 Ga0501265_001340 3300049762 Bacteria 2775
364 Ga0501281_01377 3300049777 Bacteria 1917
365 nmdc:mga03683_2081_c1 3300050489 Bacteria 6143
366 nmdc:mga03n38_9633_c1 3300050490 Bacteria 3521
367 nmdc:mga0k408_26091_c1 3300050493 Bacteria 3312
368 nmdc:mga0k408_283639_c1 3300050493 Bacteria 989
369 nmdc:mga07m45_13733_c1 3300050496 Bacteria 4301
370 Ga0500559_0014397 3300053136 Bacteria 3342
371 Ga0500573_0108543 3300053140 Bacteria 1555
372 Ga0500567_102962 3300053723 Bacteria 1181

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10326478 Ga0157372_103264783 282
2 3300015261 Ga0182006_1037796 Ga0182006_10377962 282
3 3300037466 Ga0395898_0292098 Ga0395898_0292098_447_1388 282
4 3300042005 Ga0439448_0000493 Ga0439448_0000493_4384_5325 282
5 3300013102 Ga0157371_10111198 Ga0157371_101111981 284
6 3300047321 Ga0495676_0051752 Ga0495676_0051752_565_1476 284
7 3300005539 Ga0068853_100450244 Ga0068853_1004502441 286
8 3300005616 Ga0068852_100108952 Ga0068852_1001089523 286
9 3300026142 Ga0207698_10122782 Ga0207698_101227823 286
10 3300005331 Ga0070670_100004577 Ga0070670_1000045771 288
11 3300005344 Ga0070661_100163622 Ga0070661_1001636222 288
12 3300005355 Ga0070671_100002269 Ga0070671_1000022696 288
13 3300005356 Ga0070674_100009788 Ga0070674_1000097882 288
14 3300005364 Ga0070673_100005422 Ga0070673_1000054227 288
15 3300005456 Ga0070678_100014490 Ga0070678_1000144904 288
16 3300005459 Ga0068867_100016411 Ga0068867_1000164113 288
17 3300005543 Ga0070672_100008793 Ga0070672_1000087935 288
18 3300005564 Ga0070664_100033215 Ga0070664_1000332152 288
19 3300005616 Ga0068852_100297502 Ga0068852_1002975022 288
20 3300005618 Ga0068864_100079637 Ga0068864_1000796373 288
21 3300005719 Ga0068861_100445681 Ga0068861_1004456811 288
22 3300005834 Ga0068851_10025815 Ga0068851_100258153 288
23 3300006237 Ga0097621_100042713 Ga0097621_1000427133 288
24 3300013306 Ga0163162_10226646 Ga0163162_102266462 288
25 3300017792 Ga0163161_10050685 Ga0163161_100506852 288
26 3300025315 Ga0207697_10002827 Ga0207697_100028273 288
27 3300025321 Ga0207656_10028799 Ga0207656_100287991 288
28 3300025893 Ga0207682_10018107 Ga0207682_100181073 288
29 3300025925 Ga0207650_10000667 Ga0207650_1000066716 288
30 3300025926 Ga0207659_10002251 Ga0207659_100022518 288
31 3300025931 Ga0207644_10010722 Ga0207644_100107226 288
32 3300025937 Ga0207669_10010117 Ga0207669_100101172 288
33 3300025940 Ga0207691_10012304 Ga0207691_100123046 288
34 3300025945 Ga0207679_10018081 Ga0207679_100180812 288
35 3300025960 Ga0207651_10005663 Ga0207651_100056635 288
36 3300025986 Ga0207658_10081372 Ga0207658_100813721 288
37 3300026023 Ga0207677_10076393 Ga0207677_100763932 288
38 3300026089 Ga0207648_10024639 Ga0207648_100246395 288
39 3300026095 Ga0207676_10188217 Ga0207676_101882173 288
40 3300026121 Ga0207683_10029034 Ga0207683_100290343 288
41 3300026142 Ga0207698_10192396 Ga0207698_101923963 288
42 3300046462 Ga0495651_0068492 Ga0495651_0068492_15_890 288
43 3300005336 Ga0070680_100010840 Ga0070680_1000108405 289
44 3300005530 Ga0070679_100009552 Ga0070679_1000095526 289
45 3300006195 Ga0075366_10083001 Ga0075366_100830012 289
46 3300025917 Ga0207660_10014565 Ga0207660_100145652 289
47 3300050493 nmdc:mga0k408_26091_c1 nmdc:mga0k408_26091_c1_1990_2961 289
48 3300005331 Ga0070670_100505899 Ga0070670_1005058991 290
49 3300031456 Ga0307513_10103009 Ga0307513_101030092 290
50 3300037471 Ga0395905_0111401 Ga0395905_0111401_381_1313 290
51 3300009093 Ga0105240_10114575 Ga0105240_101145753 291
52 3300025913 Ga0207695_10093196 Ga0207695_100931963 291
53 3300046459 Ga0495629_0006121 Ga0495629_0006121_6631_7533 291
54 3300046463 Ga0495653_0000124 Ga0495653_0000124_58842_59744 291
55 3300046516 Ga0495628_0002705 Ga0495628_0002705_13732_14634 291
56 3300046529 Ga0495652_0025105 Ga0495652_0025105_908_1810 291
57 3300046531 Ga0495665_0000011 Ga0495665_0000011_28916_29818 291
58 3300046543 Ga0495645_0020021 Ga0495645_0020021_2534_3436 291
59 3300046663 Ga0495635_0037195 Ga0495635_0037195_1697_2599 291
60 3300046679 Ga0495623_0000739 Ga0495623_0000739_1083_1985 291
61 3300046680 Ga0495646_0014925 Ga0495646_0014925_2513_3415 291
62 3300046690 Ga0495624_0011788 Ga0495624_0011788_3717_4619 291
63 3300046809 Ga0495600_0035427 Ga0495600_0035427_1296_2198 291
64 3300047317 Ga0495604_0001294 Ga0495604_0001294_12019_12921 291
65 3300047319 Ga0495674_0008085 Ga0495674_0008085_1616_2518 291
66 3300047322 Ga0495680_0003789 Ga0495680_0003789_209_1111 291
67 3300047444 Ga0495675_0087776 Ga0495675_0087776_343_1245 291
68 3300047673 Ga0495593_0001586 Ga0495593_0001586_9529_10431 291
69 3300048088 Ga0495602_0001906 Ga0495602_0001906_5103_6005 291
70 3300048908 Ga0496105_0087502 Ga0496105_0087502_913_1815 291
71 3300048911 Ga0496108_0261376 Ga0496108_0261376_164_1066 291
72 3300046457 Ga0495590_0052542 Ga0495590_0052542_222_1127 293
73 3300046506 Ga0495583_0146750 Ga0495583_0146750_42_947 293
74 3300005367 Ga0070667_100458768 Ga0070667_1004587681 294
75 3300009011 Ga0105251_10000029 Ga0105251_1000002912 294
76 3300015262 Ga0182007_10000694 Ga0182007_100006945 294
77 3300025735 Ga0207713_1000112 Ga0207713_1000112109 294
78 3300025904 Ga0207647_10011320 Ga0207647_100113205 294
79 3300025986 Ga0207658_10306920 Ga0207658_103069201 294
80 3300048919 Ga0496116_0031144 Ga0496116_0031144_2708_3628 294
81 3300048920 Ga0496117_0092974 Ga0496117_0092974_560_1480 294
82 3300048921 Ga0496118_0002433 Ga0496118_0002433_746_1666 294
83 3300025931 Ga0207644_10058191 Ga0207644_100581912 295
84 iso_pu_bacteria 2643221654 2644301643 295
85 3300046472 Ga0495580_0049633 Ga0495580_0049633_1436_2359 296
86 iso_pu_bacteria 2513237150 2513954684 296
87 iso_pu_bacteria 2513237165 2514043569 296
88 iso_pu_bacteria 2513237166 2514049804 296
89 iso_pu_bacteria 2599185292 2599904089 296
90 iso_pu_bacteria 2643221569 2643863431 296
91 iso_pu_bacteria 2643221594 2643982733 296
92 iso_pu_bacteria 2721755523 2722884241 296
93 iso_pu_bacteria 2744054900 2746090164 296
94 iso_pu_bacteria 2744054901 2746095604 296
95 iso_pu_bacteria 2808606395 2809034842 296
96 iso_pu_bacteria 2818991450 2819621185 296
97 iso_pu_bacteria 2842733646 2842739014 296
98 iso_pu_bacteria 2857537821 2857542016 296
99 iso_pu_bacteria 2863421361 2863426118 296
100 iso_pu_bacteria 2928108538 2928109299 296
101 iso_pu_bacteria 2928135762 2928136521 296
102 iso_pu_bacteria 2928157003 2928162247 296
103 iso_pu_bacteria 2928163908 2928166332 296
104 iso_pu_bacteria 2928503688 2928503699 296
105 iso_pu_bacteria 2974320154 2974324041 296
106 iso_pu_bacteria 644736347 644752218 296
107 iso_pu_bacteria 8003400568 8003404332 296
108 3300005328 Ga0070676_10007458 Ga0070676_100074585 299
109 3300005347 Ga0070668_100019098 Ga0070668_1000190985 299
110 3300005459 Ga0068867_100059876 Ga0068867_1000598762 299
111 3300005564 Ga0070664_100264861 Ga0070664_1002648612 299
112 3300005719 Ga0068861_100016333 Ga0068861_1000163335 299
113 3300005843 Ga0068860_100304661 Ga0068860_1003046612 299
114 3300005844 Ga0068862_100034165 Ga0068862_1000341653 299
115 3300009148 Ga0105243_10005581 Ga0105243_100055816 299
116 3300013297 Ga0157378_10251000 Ga0157378_102510003 299
117 3300013297 Ga0157378_10437406 Ga0157378_104374062 299
118 3300025899 Ga0207642_10057804 Ga0207642_100578043 299
119 3300025907 Ga0207645_10005701 Ga0207645_100057016 299
120 3300025918 Ga0207662_10009515 Ga0207662_100095153 299
121 3300025933 Ga0207706_10012120 Ga0207706_100121205 299
122 3300025940 Ga0207691_10009271 Ga0207691_100092717 299
123 3300025942 Ga0207689_10007011 Ga0207689_100070118 299
124 3300025961 Ga0207712_10044080 Ga0207712_100440803 299
125 3300025972 Ga0207668_10014756 Ga0207668_100147563 299
126 3300026075 Ga0207708_10017835 Ga0207708_100178353 299
127 3300026118 Ga0207675_100013220 Ga0207675_1000132205 299
128 3300028380 Ga0268265_10063210 Ga0268265_100632102 299
129 3300031731 Ga0307405_10043306 Ga0307405_100433063 299
130 3300031824 Ga0307413_10118666 Ga0307413_101186662 299
131 3300031911 Ga0307412_10257893 Ga0307412_102578932 299
132 3300031995 Ga0307409_100052353 Ga0307409_1000523532 299
133 3300032002 Ga0307416_100113762 Ga0307416_1001137622 299
134 3300032005 Ga0307411_10156416 Ga0307411_101564163 299
135 3300032126 Ga0307415_100000567 Ga0307415_1000005676 299
136 3300048917 Ga0496114_0171872 Ga0496114_0171872_651_1568 299
137 3300048928 Ga0496125_0009217 Ga0496125_0009217_1394_2323 299
138 3300002067 JGI24735J21928_10002019 JGI24735J21928_100020194 300
139 3300003322 rootL2_10006840 rootL2_100068406 300
140 3300003784 Ga0055534_1000581 Ga0055534_10005818 300
141 3300005262 Ga0065165_1000445 Ga0065165_100044511 300
142 3300005337 Ga0070682_100240476 Ga0070682_1002404762 300
143 3300005353 Ga0070669_100049515 Ga0070669_1000495154 300
144 3300005455 Ga0070663_100003236 Ga0070663_1000032368 300
145 3300005455 Ga0070663_100115149 Ga0070663_1001151492 300
146 3300005456 Ga0070678_100180587 Ga0070678_1001805872 300
147 3300005563 Ga0068855_100032274 Ga0068855_1000322742 300
148 3300005616 Ga0068852_100022429 Ga0068852_1000224295 300
149 3300006048 Ga0075363_100051837 Ga0075363_1000518373 300
150 3300006048 Ga0075363_100168321 Ga0075363_1001683211 300
151 3300006177 Ga0075362_10052306 Ga0075362_100523061 300
152 3300006195 Ga0075366_10262117 Ga0075366_102621171 300
153 3300006353 Ga0075370_10002282 Ga0075370_100022827 300
154 3300006353 Ga0075370_10005093 Ga0075370_100050932 300
155 3300009011 Ga0105251_10007715 Ga0105251_100077158 300
156 3300009036 Ga0105244_10043858 Ga0105244_100438584 300
157 3300009092 Ga0105250_10008770 Ga0105250_100087703 300
158 3300009093 Ga0105240_10060145 Ga0105240_100601454 300
159 3300009101 Ga0105247_10102130 Ga0105247_101021302 300
160 3300009545 Ga0105237_10244868 Ga0105237_102448681 300
161 3300009551 Ga0105238_10127924 Ga0105238_101279244 300
162 3300009551 Ga0105238_10434283 Ga0105238_104342832 300
163 3300010375 Ga0105239_10005253 Ga0105239_100052534 300
164 3300013100 Ga0157373_10000863 Ga0157373_100008636 300
165 3300013104 Ga0157370_10001259 Ga0157370_1000125910 300
166 3300013104 Ga0157370_10264172 Ga0157370_102641722 300
167 3300013105 Ga0157369_10012465 Ga0157369_100124658 300
168 3300013296 Ga0157374_10153434 Ga0157374_101534342 300
169 3300013306 Ga0163162_10007402 Ga0163162_100074028 300
170 3300013306 Ga0163162_10454465 Ga0163162_104544651 300
171 3300014497 Ga0182008_10001106 Ga0182008_1000110611 300
172 3300015265 Ga0182005_1034615 Ga0182005_10346151 300
173 3300015683 Ga0183362_10003 Ga0183362_10003761 300
174 3300017792 Ga0163161_10097397 Ga0163161_100973973 300
175 3300020069 Ga0197907_10794738 Ga0197907_107947382 300
176 3300025284 Ga0209130_1001847 Ga0209130_10018474 300
177 3300025291 Ga0209675_1001683 Ga0209675_10016836 300
178 3300025291 Ga0209675_1031803 Ga0209675_10318032 300
179 3300025298 Ga0209050_1004495 Ga0209050_10044952 300
180 3300025298 Ga0209050_1041394 Ga0209050_10413942 300
181 3300025302 Ga0207426_1000004 Ga0207426_1000004175 300
182 3300025302 Ga0207426_1003394 Ga0207426_10033945 300
183 3300025303 Ga0209051_1007980 Ga0209051_10079804 300
184 3300025303 Ga0209051_1010322 Ga0209051_10103223 300
185 3300025304 Ga0209257_1011627 Ga0209257_10116274 300
186 3300025735 Ga0207713_1035662 Ga0207713_10356622 300
187 3300025900 Ga0207710_10089014 Ga0207710_100890142 300
188 3300025904 Ga0207647_10236589 Ga0207647_102365891 300
189 3300025923 Ga0207681_10003007 Ga0207681_100030078 300
190 3300025931 Ga0207644_10139943 Ga0207644_101399432 300
191 3300025949 Ga0207667_10011546 Ga0207667_100115463 300
192 3300026067 Ga0207678_10003427 Ga0207678_1000342714 300
193 3300026067 Ga0207678_10039769 Ga0207678_100397693 300
194 3300026142 Ga0207698_10057793 Ga0207698_100577932 300
195 3300027312 Ga0209371_1000431 Ga0209371_100043133 300
196 3300028786 Ga0307517_10160610 Ga0307517_101606102 300
197 3300030500 Ga0268256_1000370 Ga0268256_100037033 300
198 3300031456 Ga0307513_10132037 Ga0307513_101320371 300
199 3300031911 Ga0307412_10106738 Ga0307412_101067382 300
200 3300032002 Ga0307416_100044043 Ga0307416_1000440434 300
201 3300032005 Ga0307411_10374233 Ga0307411_103742331 300
202 3300037471 Ga0395905_0003277 Ga0395905_0003277_11420_12349 300
203 3300037471 Ga0395905_0013387 Ga0395905_0013387_1637_2539 300
204 3300037471 Ga0395905_0137195 Ga0395905_0137195_240_1157 300
205 3300039447 Ga0436361_0757428 Ga0436361_0757428_28036_28986 300
206 3300041404 Ga0439436_0005538 Ga0439436_0005538_1798_2709 300
207 3300041407 Ga0439447_016686 Ga0439447_016686_781_1686 300
208 3300041411 Ga0439466_0002163 Ga0439466_0002163_1318_2223 300
209 3300041413 Ga0439465_0000917 Ga0439465_0000917_6998_7903 300
210 3300041452 Ga0451793_0920642 Ga0451793_0920642_97_1011 300
211 3300041997 Ga0439431_0001260 Ga0439431_0001260_532_1437 300
212 3300041999 Ga0439433_0003173 Ga0439433_0003173_1152_2057 300
213 3300041999 Ga0439433_0012228 Ga0439433_0012228_847_1758 300
214 3300042002 Ga0439442_001908 Ga0439442_001908_171_1082 300
215 3300042004 Ga0439445_0003666 Ga0439445_0003666_1652_2557 300
216 3300042004 Ga0439445_0025685 Ga0439445_0025685_118_1029 300
217 3300042004 Ga0439445_0060665 Ga0439445_0060665_12_935 300
218 3300042006 Ga0439432_000428 Ga0439432_000428_913_1818 300
219 3300042006 Ga0439432_006154 Ga0439432_006154_2643_3554 300
220 3300042007 Ga0439449_0001522 Ga0439449_0001522_3237_4142 300
221 3300042007 Ga0439449_0002808 Ga0439449_0002808_4381_5292 300
222 3300042010 Ga0439452_002665 Ga0439452_002665_4987_5892 300
223 3300042015 Ga0439462_0006037 Ga0439462_0006037_1075_1980 300
224 3300042015 Ga0439462_0016320 Ga0439462_0016320_662_1573 300
225 3300042134 Ga0450898_002070 Ga0450898_002070_1626_2537 300
226 3300042135 Ga0450899_006402 Ga0450899_006402_11_922 300
227 3300042137 Ga0450902_013150 Ga0450902_013150_321_1286 300
228 3300042147 Ga0450910_001999 Ga0450910_001999_528_1439 300
229 3300042156 Ga0439446_0001085 Ga0439446_0001085_4116_5021 300
230 3300042185 Ga0450909_003364 Ga0450909_003364_982_1893 300
231 3300042185 Ga0450909_006961 Ga0450909_006961_256_1161 300
232 3300042435 Ga0439434_0024671 Ga0439434_0024671_596_1501 300
233 3300044656 Ga0466969_0022426 Ga0466969_0022426_31_960 300
234 3300044656 Ga0466969_0143273 Ga0466969_0143273_132_1055 300
235 3300044683 Ga0466965_0005690 Ga0466965_0005690_473_1402 300
236 3300044683 Ga0466965_0083719 Ga0466965_0083719_131_1054 300
237 3300044684 Ga0466966_0000475 Ga0466966_0000475_10641_11564 300
238 3300044684 Ga0466966_0033691 Ga0466966_0033691_756_1679 300
239 3300044693 Ga0466961_0022412 Ga0466961_0022412_683_1615 300
240 3300044719 Ga0466971_0017031 Ga0466971_0017031_678_1601 300
241 3300044735 Ga0466968_0041107 Ga0466968_0041107_744_1676 300
242 3300044842 Ga0466957_0005057 Ga0466957_0005057_6059_6982 300
243 3300044842 Ga0466957_0045958 Ga0466957_0045958_1176_2099 300
244 3300044901 Ga0466960_0029992 Ga0466960_0029992_554_1483 300
245 3300045049 Ga0466959_0048482 Ga0466959_0048482_2037_2960 300
246 3300045049 Ga0466959_0083646 Ga0466959_0083646_1193_2125 300
247 3300045049 Ga0466959_0145115 Ga0466959_0145115_324_1247 300
248 3300045836 Ga0466958_0018189 Ga0466958_0018189_602_1525 300
249 3300046455 Ga0495603_0042799 Ga0495603_0042799_1521_2435 300
250 3300046457 Ga0495590_0001006 Ga0495590_0001006_5920_6822 300
251 3300046459 Ga0495629_0000639 Ga0495629_0000639_4030_4944 300
252 3300046463 Ga0495653_0047778 Ga0495653_0047778_901_1803 300
253 3300046471 Ga0495650_0005597 Ga0495650_0005597_4775_5689 300
254 3300046471 Ga0495650_0025943 Ga0495650_0025943_402_1307 300
255 3300046471 Ga0495650_0049563 Ga0495650_0049563_789_1724 300
256 3300046472 Ga0495580_0000364 Ga0495580_0000364_19789_20700 300
257 3300046472 Ga0495580_0012767 Ga0495580_0012767_3288_4202 300
258 3300046472 Ga0495580_0077037 Ga0495580_0077037_182_1084 300
259 3300046473 Ga0495582_0023038 Ga0495582_0023038_2003_2917 300
260 3300046491 Ga0495584_0015971 Ga0495584_0015971_2495_3397 300
261 3300046500 Ga0495596_0061503 Ga0495596_0061503_88_990 300
262 3300046506 Ga0495583_0000051 Ga0495583_0000051_132190_133290 300
263 3300046507 Ga0495606_0007730 Ga0495606_0007730_8576_9505 300
264 3300046507 Ga0495606_0040300 Ga0495606_0040300_348_1250 300
265 3300046507 Ga0495606_0049548 Ga0495606_0049548_1666_2568 300
266 3300046513 Ga0495616_0110284 Ga0495616_0110284_335_1249 300
267 3300046514 Ga0495618_0130862 Ga0495618_0130862_553_1464 300
268 3300046515 Ga0495620_0035542 Ga0495620_0035542_956_1858 300
269 3300046516 Ga0495628_0093345 Ga0495628_0093345_1303_2214 300
270 3300046517 Ga0495630_0042094 Ga0495630_0042094_388_1299 300
271 3300046522 Ga0495643_0000398 Ga0495643_0000398_27859_28794 300
272 3300046526 Ga0495666_0003628 Ga0495666_0003628_1461_2372 300
273 3300046526 Ga0495666_0004004 Ga0495666_0004004_2087_3028 300
274 3300046526 Ga0495666_0040669 Ga0495666_0040669_859_1761 300
275 3300046528 Ga0495642_0000200 Ga0495642_0000200_18429_19343 300
276 3300046528 Ga0495642_0015822 Ga0495642_0015822_1300_2214 300
277 3300046530 Ga0495654_0090308 Ga0495654_0090308_281_1195 300
278 3300046531 Ga0495665_0049397 Ga0495665_0049397_954_1874 300
279 3300046531 Ga0495665_0100699 Ga0495665_0100699_254_1168 300
280 3300046535 Ga0495586_0011346 Ga0495586_0011346_1660_2574 300
281 3300046535 Ga0495586_0135951 Ga0495586_0135951_292_1233 300
282 3300046539 Ga0495621_0058223 Ga0495621_0058223_161_1081 300
283 3300046542 Ga0495597_0004701 Ga0495597_0004701_1810_2712 300
284 3300046543 Ga0495645_0001361 Ga0495645_0001361_2292_3206 300
285 3300046543 Ga0495645_0063621 Ga0495645_0063621_132_1043 300
286 3300046559 Ga0495667_0053515 Ga0495667_0053515_1701_2615 300
287 3300046665 Ga0495661_0012978 Ga0495661_0012978_1092_2210 300
288 3300046680 Ga0495646_0098720 Ga0495646_0098720_350_1264 300
289 3300046684 Ga0495669_0009676 Ga0495669_0009676_195_1109 300
290 3300046689 Ga0495613_0059636 Ga0495613_0059636_731_1645 300
291 3300046690 Ga0495624_0000143 Ga0495624_0000143_36872_37783 300
292 3300046692 Ga0495671_0096173 Ga0495671_0096173_395_1309 300
293 3300046694 Ga0495649_0004438 Ga0495649_0004438_474_1403 300
294 3300046694 Ga0495649_0136293 Ga0495649_0136293_331_1239 300
295 3300046794 Ga0495589_0014534 Ga0495589_0014534_1370_2299 300
296 3300046794 Ga0495589_0059616 Ga0495589_0059616_183_1097 300
297 3300046809 Ga0495600_0100404 Ga0495600_0100404_761_1675 300
298 3300046810 Ga0495660_0039894 Ga0495660_0039894_1077_2009 300
299 3300047317 Ga0495604_0024275 Ga0495604_0024275_3814_4725 300
300 3300047317 Ga0495604_0075579 Ga0495604_0075579_99_1001 300
301 3300047317 Ga0495604_0270571 Ga0495604_0270571_223_1125 300
302 3300047318 Ga0495636_0000702 Ga0495636_0000702_6248_7210 300
303 3300047319 Ga0495674_0020313 Ga0495674_0020313_4743_5684 300
304 3300047319 Ga0495674_0047380 Ga0495674_0047380_1515_2435 300
305 3300047319 Ga0495674_0096253 Ga0495674_0096253_190_1119 300
306 3300047323 Ga0495683_0001006 Ga0495683_0001006_5673_6575 300
307 3300047323 Ga0495683_0024989 Ga0495683_0024989_1071_1979 300
308 3300047323 Ga0495683_0028163 Ga0495683_0028163_307_1236 300
309 3300047443 Ga0495687_000020 Ga0495687_000020_76714_77622 300
310 3300047443 Ga0495687_003307 Ga0495687_003307_6306_7208 300
311 3300047444 Ga0495675_0074255 Ga0495675_0074255_1155_2057 300
312 3300047445 Ga0495677_0020473 Ga0495677_0020473_1314_2228 300
313 3300047446 Ga0495679_011333 Ga0495679_011333_1186_2100 300
314 3300047673 Ga0495593_0026084 Ga0495593_0026084_2226_3140 300
315 3300047673 Ga0495593_0036832 Ga0495593_0036832_927_1829 300
316 3300048088 Ga0495602_0145033 Ga0495602_0145033_905_1816 300
317 3300048089 Ga0495614_0011008 Ga0495614_0011008_73_987 300
318 3300048091 Ga0495626_0000868 Ga0495626_0000868_5940_6878 300
319 3300048091 Ga0495626_0001155 Ga0495626_0001155_4869_5783 300
320 3300048091 Ga0495626_0128705 Ga0495626_0128705_132_1034 300
321 3300048903 Ga0496100_0000418 Ga0496100_0000418_14685_15599 300
322 3300048903 Ga0496100_0007055 Ga0496100_0007055_120_1022 300
323 3300048903 Ga0496100_0021482 Ga0496100_0021482_1431_2345 300
324 3300048903 Ga0496100_0102102 Ga0496100_0102102_690_1610 300
325 3300048904 Ga0496101_0000230 Ga0496101_0000230_15778_16692 300
326 3300048904 Ga0496101_0008793 Ga0496101_0008793_1908_2810 300
327 3300048904 Ga0496101_0044710 Ga0496101_0044710_2089_3003 300
328 3300048904 Ga0496101_0047078 Ga0496101_0047078_519_1439 300
329 3300048904 Ga0496101_0071272 Ga0496101_0071272_1302_2204 300
330 3300048905 Ga0496102_0000794 Ga0496102_0000794_5095_6009 300
331 3300048905 Ga0496102_0083485 Ga0496102_0083485_608_1510 300
332 3300048906 Ga0496103_0000545 Ga0496103_0000545_19539_20453 300
333 3300048906 Ga0496103_0097409 Ga0496103_0097409_120_1022 300
334 3300048907 Ga0496104_0019076 Ga0496104_0019076_4786_5700 300
335 3300048907 Ga0496104_0020040 Ga0496104_0020040_1373_2293 300
336 3300048907 Ga0496104_0062890 Ga0496104_0062890_362_1264 300
337 3300048907 Ga0496104_0123473 Ga0496104_0123473_925_1893 300
338 3300048908 Ga0496105_0048109 Ga0496105_0048109_602_1504 300
339 3300048908 Ga0496105_0062178 Ga0496105_0062178_1627_2547 300
340 3300048909 Ga0496106_0029422 Ga0496106_0029422_2496_3398 300
341 3300048909 Ga0496106_0076927 Ga0496106_0076927_1146_2060 300
342 3300048913 Ga0496110_0004366 Ga0496110_0004366_4838_5740 300
343 3300048914 Ga0496111_0007895 Ga0496111_0007895_5427_6329 300
344 3300048915 Ga0496112_0052657 Ga0496112_0052657_582_1484 300
345 3300048915 Ga0496112_0068765 Ga0496112_0068765_1831_2739 300
346 3300048915 Ga0496112_0111830 Ga0496112_0111830_439_1359 300
347 3300048916 Ga0496113_0010743 Ga0496113_0010743_1369_2271 300
348 3300048916 Ga0496113_0211681 Ga0496113_0211681_507_1415 300
349 3300048917 Ga0496114_0001636 Ga0496114_0001636_8475_9389 300
350 3300048918 Ga0496115_0112359 Ga0496115_0112359_91_993 300
351 3300048918 Ga0496115_0233712 Ga0496115_0233712_406_1320 300
352 3300048918 Ga0496115_0490799 Ga0496115_0490799_14_940 300
353 3300048919 Ga0496116_0001738 Ga0496116_0001738_11586_12494 300
354 3300048920 Ga0496117_0001694 Ga0496117_0001694_24684_25598 300
355 3300048920 Ga0496117_0010954 Ga0496117_0010954_4384_5286 300
356 3300048920 Ga0496117_0031856 Ga0496117_0031856_2376_3284 300
357 3300048921 Ga0496118_0000218 Ga0496118_0000218_24349_25263 300
358 3300048921 Ga0496118_0049289 Ga0496118_0049289_843_1751 300
359 3300048921 Ga0496118_0089927 Ga0496118_0089927_570_1478 300
360 3300048922 Ga0496119_0065891 Ga0496119_0065891_76_978 300
361 3300048922 Ga0496119_0088886 Ga0496119_0088886_527_1444 300
362 3300048924 Ga0496121_0001224 Ga0496121_0001224_19034_19948 300
363 3300048924 Ga0496121_0002057 Ga0496121_0002057_15265_16167 300
364 3300048924 Ga0496121_0020112 Ga0496121_0020112_2432_3340 300
365 3300048924 Ga0496121_0020408 Ga0496121_0020408_4240_5157 300
366 3300048924 Ga0496121_0260117 Ga0496121_0260117_158_1078 300
367 3300048925 Ga0496122_0000199 Ga0496122_0000199_52295_53203 300
368 3300048925 Ga0496122_0000582 Ga0496122_0000582_19453_20361 300
369 3300048925 Ga0496122_0012331 Ga0496122_0012331_458_1360 300
370 3300048925 Ga0496122_0095357 Ga0496122_0095357_442_1356 300
371 3300048926 Ga0496123_0000102 Ga0496123_0000102_86491_87399 300
372 3300048926 Ga0496123_0000479 Ga0496123_0000479_53984_54892 300
373 3300048926 Ga0496123_0015579 Ga0496123_0015579_715_1617 300
374 3300048926 Ga0496123_0034608 Ga0496123_0034608_1500_2408 300
375 3300048927 Ga0496124_0018952 Ga0496124_0018952_4941_5843 300
376 3300048927 Ga0496124_0084434 Ga0496124_0084434_820_1728 300
377 3300048927 Ga0496124_0133829 Ga0496124_0133829_558_1472 300
378 3300048928 Ga0496125_0015784 Ga0496125_0015784_6332_7234 300
379 3300048928 Ga0496125_0039142 Ga0496125_0039142_1480_2388 300
380 3300048928 Ga0496125_0043997 Ga0496125_0043997_1930_2838 300
381 3300048928 Ga0496125_0046325 Ga0496125_0046325_1603_2574 300
382 3300048929 Ga0496126_0000511 Ga0496126_0000511_19757_20668 300
383 3300049571 Ga0501034_0000022 Ga0501034_0000022_258473_259429 300
384 3300049653 Ga0501206_001608 Ga0501206_001608_1478_2395 300
385 3300049686 Ga0501257_021551 Ga0501257_021551_114_1031 300
386 3300049759 Ga0501262_001114 Ga0501262_001114_1601_2518 300
387 3300049762 Ga0501265_001340 Ga0501265_001340_1187_2104 300
388 3300049777 Ga0501281_01377 Ga0501281_01377_861_1778 300
389 3300050489 nmdc:mga03683_2081_c1 nmdc:mga03683_2081_c1_694_1605 300
390 3300050490 nmdc:mga03n38_9633_c1 nmdc:mga03n38_9633_c1_1620_2531 300
391 3300050493 nmdc:mga0k408_283639_c1 nmdc:mga0k408_283639_c1_52_972 300
392 3300050496 nmdc:mga07m45_13733_c1 nmdc:mga07m45_13733_c1_1663_2583 300
393 3300053136 Ga0500559_0014397 Ga0500559_0014397_422_1330 300
394 3300053140 Ga0500573_0108543 Ga0500573_0108543_232_1140 300
395 3300053723 Ga0500567_102962 Ga0500567_102962_110_1018 300
396 iso_pu_bacteria 2904434214 2904438230 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

63

122

0.98

PF03466

LysR_substrate

LysR substrate binding domain

146

356

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.964 4 91
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9636 4 91
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9554 4 85
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.9521 4 91
5xxp-assembly1.cif.gz_B crystal structure of cbnr_dbd-dna complex 0.9465 4 89
ID Description Score Start End Superfamily
af_P0ACQ7_8_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9842 5 88 1.10.10.10
af_P37641_3_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9828 5 82 1.10.10.10
af_Q2G1Q6_4_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9827 4 85 1.10.10.10
af_P77700_7_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9818 7 91 1.10.10.10
af_P9WMF3_10_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9787 7 84 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5R1NF86-F1-model_v4 deleted 0.9779 4 75
AF-A0A0F4JEL2-F1-model_v4 LysR family transcriptional regulator 0.9694 4 79 GO:0003677
GO:0003700
GO:0032993
AF-A0A0K2RCL1-F1-model_v4 HTH-type transcriptional regulator GltR 0.9691 1 81 GO:0003700
AF-A0A367M5X4-F1-model_v4 LysR family transcriptional regulator 0.9689 4 85 GO:0000976
GO:0003700
AF-A0A553ZST6-F1-model_v4 LysR family transcriptional regulator 0.9672 3 82 GO:0003700
GO:0006351
GO:0043565

Feature Viewer

pLDDT pTM Quality
91.1 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map