F433561

General Info

Members Datasets Scaffolds Average Seq Length
396 282 387 132

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0316876|Ga0373937_0316876_106_585
Length 159
Sequence VDLNMKKSVPAESASVVIDAKIKELGDWRGKTLAQVRAIIHQADPEILEEWKWAKATSPGVPVFSHGGIVCTGETYKSVVKLTFARGAALPDPSGLFNSSLDGNVRRAIDIHEGEKINEAALKDLIRAAVSLNLKGKTKPKPQRKPRLIPKRSSSKRAG

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2643221591 Devosia sp. Root685 Isolate Unclassified
3 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
4 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
5 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
6 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
7 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
8 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
9 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
10 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
181 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
182 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
183 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
184 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
185 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
186 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
193 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
194 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
195 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
199 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
200 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
207 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
215 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
220 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
221 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
222 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
223 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
224 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
225 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
244 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
268 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
277 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
278 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
279 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.22
Metatranscriptomes 0.51
Isolates 2.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.04
Nodule 0
Rhizoplane 5.3
Rhizosphere 86.87
Stem 0
Stem Tuber 0
Unclassified 3.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000133 3300000546 Bacteria 11638
2 Ga0058862_11872432 3300004803 Bacteria 511
3 Ga0070658_10019639 3300005327 Bacteria 5410
4 Ga0070676_10000543 3300005328 Bacteria 18271
5 Ga0070676_10179512 3300005328 Bacteria 1375
6 Ga0070690_100045204 3300005330 Bacteria 2796
7 Ga0070677_10017284 3300005333 Bacteria 2581
8 Ga0070677_10083589 3300005333 Bacteria 1372
9 Ga0070677_10668954 3300005333 Bacteria 582
10 Ga0068869_100003802 3300005334 Bacteria 9302
11 Ga0070666_10105992 3300005335 Bacteria 1942
12 Ga0070680_100371551 3300005336 Bacteria 1217
13 Ga0070682_100111633 3300005337 Bacteria 1823
14 Ga0068868_100222816 3300005338 Bacteria 1579
15 Ga0070660_100098621 3300005339 Bacteria 2313
16 Ga0070661_100000067 3300005344 Bacteria 84376
17 Ga0070661_100914603 3300005344 Bacteria 725
18 Ga0070668_100005165 3300005347 Bacteria 9682
19 Ga0070669_100832513 3300005353 Bacteria 785
20 Ga0070675_100004625 3300005354 Bacteria 10512
21 Ga0070671_100010726 3300005355 Bacteria 7357
22 Ga0070674_100005923 3300005356 Bacteria 7108
23 Ga0070674_100204907 3300005356 Bacteria 1525
24 Ga0070673_100262252 3300005364 Bacteria 1510
25 Ga0070673_100712939 3300005364 Bacteria 922
26 Ga0070659_100606789 3300005366 Bacteria 941
27 Ga0070667_100003315 3300005367 Bacteria 13763
28 Ga0070709_10173910 3300005434 Bacteria 1507
29 Ga0070714_100065841 3300005435 Bacteria 3122
30 Ga0070714_101400204 3300005435 Bacteria 683
31 Ga0070713_100634156 3300005436 Bacteria 1017
32 Ga0070710_10077879 3300005437 Bacteria 1928
33 Ga0070701_10046298 3300005438 Bacteria 2235
34 Ga0070701_11298504 3300005438 Bacteria 520
35 Ga0070711_100233418 3300005439 Bacteria 1435
36 Ga0070711_100566380 3300005439 Bacteria 944
37 Ga0070700_100140511 3300005441 Bacteria 1641
38 Ga0070694_100099228 3300005444 Bacteria 2057
39 Ga0070694_100261463 3300005444 Bacteria 1313
40 Ga0070678_101237899 3300005456 Bacteria 693
41 Ga0070662_100002573 3300005457 Bacteria 11178
42 Ga0070681_11092241 3300005458 Bacteria 718
43 Ga0068867_100009092 3300005459 Bacteria 7010
44 Ga0068867_100271031 3300005459 Bacteria 1388
45 Ga0068867_100423959 3300005459 Bacteria 1128
46 Ga0070679_101164278 3300005530 Bacteria 716
47 Ga0070684_101167022 3300005535 Bacteria 724
48 Ga0068853_101872222 3300005539 Bacteria 582
49 Ga0070672_100009276 3300005543 Bacteria 6778
50 Ga0070672_100250342 3300005543 Bacteria 1492
51 Ga0070672_100427139 3300005543 Bacteria 1139
52 Ga0070695_100012052 3300005545 Bacteria 5182
53 Ga0070695_100164651 3300005545 Bacteria 1560
54 Ga0070665_100118389 3300005548 Bacteria 2651
55 Ga0070665_102272084 3300005548 Bacteria 546
56 Ga0070704_100247964 3300005549 Bacteria 1461
57 Ga0070704_100630190 3300005549 Bacteria 945
58 Ga0068855_100539836 3300005563 Bacteria 1263
59 Ga0068855_101270804 3300005563 Unclassified 763
60 Ga0068857_100530510 3300005577 Bacteria 1107
61 Ga0068857_102101770 3300005577 Bacteria 554
62 Ga0068854_100747896 3300005578 Bacteria 848
63 Ga0068856_102031130 3300005614 Bacteria 585
64 Ga0068852_100061061 3300005616 Bacteria 3274
65 Ga0068859_100174025 3300005617 Bacteria 2234
66 Ga0068859_100241760 3300005617 Bacteria 1895
67 Ga0068859_102102926 3300005617 Bacteria 623
68 Ga0068864_100084969 3300005618 Bacteria 2781
69 Ga0068864_100434846 3300005618 Bacteria 1252
70 Ga0068864_100549572 3300005618 Bacteria 1116
71 Ga0068866_10002671 3300005718 Bacteria 7355
72 Ga0068861_100014040 3300005719 Bacteria 5617
73 Ga0068861_100223692 3300005719 Bacteria 1592
74 Ga0068863_100017630 3300005841 Bacteria 6840
75 Ga0068863_100461036 3300005841 Bacteria 1248
76 Ga0068858_100027662 3300005842 Bacteria 5268
77 Ga0068858_100178202 3300005842 Bacteria 2006
78 Ga0068860_100003503 3300005843 Bacteria 16154
79 Ga0068860_100113682 3300005843 Bacteria 2588
80 Ga0068860_102732204 3300005843 Bacteria 512
81 Ga0068862_100010973 3300005844 Bacteria 7481
82 Ga0068862_100034683 3300005844 Bacteria 4271
83 Ga0068862_100082589 3300005844 Bacteria 2789
84 Ga0070717_10113465 3300006028 Bacteria 2314
85 Ga0070717_10823644 3300006028 Bacteria 844
86 Ga0070717_10970776 3300006028 Bacteria 774
87 Ga0070717_11876596 3300006028 Unclassified 541
88 Ga0075365_10019378 3300006038 Bacteria 4199
89 Ga0070712_100057840 3300006175 Bacteria 2725
90 Ga0070712_100231894 3300006175 Bacteria 1466
91 Ga0075369_10213131 3300006186 Bacteria 893
92 Ga0075366_10000689 3300006195 Bacteria 15998
93 Ga0075366_10274539 3300006195 Bacteria 1030
94 Ga0097621_100098075 3300006237 Bacteria 2461
95 Ga0075370_10145886 3300006353 Bacteria 1385
96 Ga0075428_100218970 3300006844 Bacteria 2056
97 Ga0075433_10609577 3300006852 Bacteria 958
98 Ga0068865_100002477 3300006881 Bacteria 10928
99 Ga0075436_100815178 3300006914 Bacteria 695
100 Ga0097620_100174017 3300006931 Bacteria 2234
101 Ga0097620_100241759 3300006931 Bacteria 1895
102 Ga0097620_102103432 3300006931 Bacteria 623
103 Ga0105240_10075783 3300009093 Bacteria 4149
104 Ga0105240_10645203 3300009093 Bacteria 1161
105 Ga0111539_10003300 3300009094 Bacteria 21324
106 Ga0111539_10383274 3300009094 Bacteria 1637
107 Ga0111539_10944871 3300009094 Bacteria 1002
108 Ga0111539_11364224 3300009094 Bacteria 822
109 Ga0114129_10033739 3300009147 Bacteria 7230
110 Ga0105243_10000060 3300009148 Bacteria 128124
111 Ga0105243_10055089 3300009148 Bacteria 3159
112 Ga0105241_10215714 3300009174 Bacteria 1610
113 Ga0105242_10013685 3300009176 Bacteria 6276
114 Ga0105248_10001394 3300009177 Bacteria 26961
115 Ga0105248_10230353 3300009177 Bacteria 2085
116 Ga0105237_10636834 3300009545 Bacteria 1073
117 Ga0105249_10002073 3300009553 Bacteria 17370
118 Ga0105246_11259447 3300011119 Bacteria 683
119 Ga0157373_10277456 3300013100 Bacteria 1187
120 Ga0157371_10299848 3300013102 Bacteria 1163
121 Ga0157370_10865852 3300013104 Bacteria 821
122 Ga0157369_10010723 3300013105 Bacteria 10429
123 Ga0157369_10200804 3300013105 Bacteria 2093
124 Ga0157378_10596442 3300013297 Bacteria 1115
125 Ga0163162_10711560 3300013306 Bacteria 1125
126 Ga0163162_11323896 3300013306 Bacteria 819
127 Ga0157372_10001764 3300013307 Bacteria 23462
128 Ga0157372_10454322 3300013307 Bacteria 1493
129 Ga0157372_10800225 3300013307 Bacteria 1095
130 Ga0157375_10017427 3300013308 Bacteria 6481
131 Ga0157375_10489516 3300013308 Bacteria 1394
132 Ga0157375_12152706 3300013308 Bacteria 664
133 Ga0163163_10017267 3300014325 Bacteria 6728
134 Ga0163163_10525285 3300014325 Bacteria 1246
135 Ga0157380_10000812 3300014326 Bacteria 19571
136 Ga0157380_10071867 3300014326 Bacteria 2800
137 Ga0182008_10000133 3300014497 Bacteria 56035
138 Ga0157379_10029519 3300014968 Bacteria 4875
139 Ga0157379_10032316 3300014968 Bacteria 4666
140 Ga0157379_10039462 3300014968 Bacteria 4212
141 Ga0157376_10173094 3300014969 Bacteria 1967
142 Ga0157376_10279640 3300014969 Bacteria 1571
143 Ga0157376_11424495 3300014969 Bacteria 725
144 Ga0182006_1000006 3300015261 Bacteria 555811
145 Ga0182007_10000434 3300015262 Bacteria 25521
146 Ga0182005_1000001 3300015265 Bacteria 1014869
147 Ga0163161_10100827 3300017792 Bacteria 2149
148 Ga0163161_11908542 3300017792 Bacteria 528
149 Ga0207653_10095130 3300025885 Bacteria 1048
150 Ga0207682_10011124 3300025893 Bacteria 3522
151 Ga0207682_10346531 3300025893 Bacteria 699
152 Ga0207692_10000808 3300025898 Bacteria 11168
153 Ga0207642_10500547 3300025899 Bacteria 744
154 Ga0207680_10076945 3300025903 Bacteria 2085
155 Ga0207685_10517185 3300025905 Bacteria 630
156 Ga0207699_10199330 3300025906 Bacteria 1355
157 Ga0207699_10236766 3300025906 Bacteria 1252
158 Ga0207645_10232568 3300025907 Bacteria 1217
159 Ga0207705_10022460 3300025909 Bacteria 4498
160 Ga0207707_11049814 3300025912 Bacteria 666
161 Ga0207695_10153578 3300025913 Bacteria 2239
162 Ga0207695_10381181 3300025913 Bacteria 1296
163 Ga0207693_10073752 3300025915 Bacteria 2672
164 Ga0207663_10068339 3300025916 Bacteria 2281
165 Ga0207657_10204358 3300025919 Bacteria 1588
166 Ga0207652_10914125 3300025921 Bacteria 775
167 Ga0207681_10429550 3300025923 Bacteria 1071
168 Ga0207659_10026809 3300025926 Bacteria 3894
169 Ga0207700_10492063 3300025928 Bacteria 1085
170 Ga0207664_10124608 3300025929 Bacteria 2161
171 Ga0207664_10151071 3300025929 Bacteria 1973
172 Ga0207664_10849960 3300025929 Bacteria 820
173 Ga0207664_10882255 3300025929 Unclassified 803
174 Ga0207644_10019021 3300025931 Bacteria 4656
175 Ga0207706_10000654 3300025933 Bacteria 36592
176 Ga0207686_10028458 3300025934 Bacteria 3285
177 Ga0207709_10000004 3300025935 Bacteria 825156
178 Ga0207709_10038246 3300025935 Bacteria 2856
179 Ga0207670_10314628 3300025936 Bacteria 1230
180 Ga0207670_10415407 3300025936 Bacteria 1078
181 Ga0207669_10408605 3300025937 Bacteria 1065
182 Ga0207704_10182914 3300025938 Bacteria 1516
183 Ga0207691_10016345 3300025940 Bacteria 7044
184 Ga0207691_10038582 3300025940 Bacteria 4420
185 Ga0207711_10090998 3300025941 Bacteria 2683
186 Ga0207711_10687657 3300025941 Bacteria 954
187 Ga0207689_10002302 3300025942 Bacteria 17874
188 Ga0207667_10350233 3300025949 Bacteria 1506
189 Ga0207667_10938441 3300025949 Bacteria 855
190 Ga0207651_10044481 3300025960 Bacteria 2972
191 Ga0207712_10005156 3300025961 Bacteria 8264
192 Ga0207712_11792325 3300025961 Bacteria 550
193 Ga0207668_10016001 3300025972 Bacteria 4672
194 Ga0207640_10620080 3300025981 Bacteria 918
195 Ga0207658_10026350 3300025986 Bacteria 4075
196 Ga0207677_11323476 3300026023 Bacteria 662
197 Ga0207703_10380529 3300026035 Bacteria 1305
198 Ga0207639_10371804 3300026041 Bacteria 1281
199 Ga0207708_10026241 3300026075 Bacteria 4407
200 Ga0207708_10130695 3300026075 Bacteria 1963
201 Ga0207641_10005417 3300026088 Bacteria 10897
202 Ga0207641_10824719 3300026088 Bacteria 918
203 Ga0207648_10001971 3300026089 Bacteria 22393
204 Ga0207648_10753092 3300026089 Bacteria 905
205 Ga0207648_11779651 3300026089 Bacteria 578
206 Ga0207676_10028034 3300026095 Bacteria 4202
207 Ga0207676_10433175 3300026095 Bacteria 1236
208 Ga0207676_11689704 3300026095 Bacteria 631
209 Ga0207674_11102587 3300026116 Bacteria 763
210 Ga0207675_100000868 3300026118 Bacteria 30104
211 Ga0207675_100133461 3300026118 Bacteria 2354
212 Ga0207683_10643185 3300026121 Bacteria 982
213 Ga0207683_11190499 3300026121 Bacteria 706
214 Ga0207698_10008824 3300026142 Bacteria 6390
215 Ga0209966_1035422 3300027695 Bacteria 1024
216 Ga0209966_1039141 3300027695 Bacteria 983
217 Ga0207428_10020094 3300027907 Bacteria 5682
218 Ga0207428_10064857 3300027907 Bacteria 2883
219 Ga0268266_10307082 3300028379 Bacteria 1481
220 Ga0268266_11439970 3300028379 Bacteria 664
221 Ga0268265_10348783 3300028380 Bacteria 1351
222 Ga0268265_10367372 3300028380 Bacteria 1319
223 Ga0268265_11514466 3300028380 Bacteria 674
224 Ga0268264_10025703 3300028381 Bacteria 4809
225 Ga0268264_10384630 3300028381 Bacteria 1344
226 Ga0265338_10002620 3300028800 Bacteria 26574
227 Ga0265338_10032640 3300028800 Bacteria 5070
228 Ga0265338_10137586 3300028800 Bacteria 1917
229 Ga0265338_10481878 3300028800 Bacteria 875
230 Ga0265770_1028874 3300030878 Bacteria 919
231 Ga0265325_10003700 3300031241 Bacteria 9897
232 Ga0265331_10014588 3300031250 Bacteria 4176
233 Ga0265327_10105433 3300031251 Bacteria 1354
234 Ga0265316_10113600 3300031344 Bacteria 2049
235 Ga0307408_101981663 3300031548 Bacteria 560
236 Ga0265313_10000984 3300031595 Bacteria 28062
237 Ga0265314_10082194 3300031711 Bacteria 2120
238 Ga0307413_11569325 3300031824 Bacteria 584
239 Ga0373926_0012798 3300035083 Bacteria 2839
240 Ga0373936_0025247 3300035113 Bacteria 2323
241 Ga0373939_0211980 3300035114 Bacteria 738
242 Ga0373943_0227634 3300035170 Bacteria 1040
243 Ga0373946_0309663 3300035171 Bacteria 782
244 Ga0373955_0194445 3300035172 Bacteria 1207
245 Ga0373924_0000111 3300035410 Bacteria 23121
246 Ga0373924_0251755 3300035410 Bacteria 782
247 Ga0373935_0039565 3300035692 Bacteria 2956
248 Ga0373935_0451777 3300035692 Bacteria 928
249 Ga0373927_0003549 3300035695 Bacteria 11149
250 Ga0373933_0030936 3300035724 Bacteria 3102
251 Ga0373947_0077800 3300035725 Bacteria 2046
252 Ga0373937_0316876 3300036401 Bacteria 1475
253 Ga0373937_0631785 3300036401 Bacteria 1016
254 Ga0373925_0092922 3300037068 Bacteria 2308
255 Ga0373925_1047844 3300037068 Bacteria 671
256 Ga0395905_0288534 3300037471 Bacteria 1528
257 Ga0395905_0308487 3300037471 Bacteria 1471
258 Ga0436361_0857520 3300039447 Bacteria 549
259 Ga0436363_1270877 3300039450 Bacteria 2656
260 Ga0436362_0929030 3300039453 Bacteria 1337
261 Ga0439453_0036591 3300041408 Bacteria 949
262 Ga0451789_0603110 3300041443 Bacteria 739
263 Ga0451798_0112337 3300041458 Bacteria 1048
264 Ga0451802_0936230 3300041460 Bacteria 645
265 Ga0451807_0257979 3300041486 Bacteria 536
266 Ga0439434_0088771 3300042435 Bacteria 987
267 Ga0466969_0116000 3300044656 Bacteria 1250
268 Ga0451576_0499483 3300045051 Bacteria 1278
269 Ga0466967_1647986 3300045976 Bacteria 639
270 Ga0495580_0369790 3300046472 Bacteria 969
271 Ga0495582_0069155 3300046473 Bacteria 1952
272 Ga0495664_0286831 3300046477 Bacteria 994
273 Ga0495584_0066518 3300046491 Bacteria 1812
274 Ga0495596_0226744 3300046500 Bacteria 725
275 Ga0495583_0053473 3300046506 Bacteria 1832
276 Ga0495616_0025203 3300046513 Bacteria 3180
277 Ga0495628_0168182 3300046516 Bacteria 1663
278 Ga0495630_0207390 3300046517 Bacteria 1496
279 Ga0495631_0051948 3300046518 Bacteria 1790
280 Ga0495632_0012380 3300046519 Bacteria 4923
281 Ga0495644_0136332 3300046523 Bacteria 936
282 Ga0495642_0066587 3300046528 Bacteria 1501
283 Ga0495652_0395130 3300046529 Bacteria 980
284 Ga0495587_0080016 3300046536 Bacteria 1894
285 Ga0495622_0106577 3300046557 Bacteria 1284
286 Ga0495633_0054441 3300046558 Bacteria 1882
287 Ga0495667_0004275 3300046559 Bacteria 9628
288 Ga0495667_0110612 3300046559 Bacteria 1775
289 Ga0495656_0382036 3300046615 Bacteria 734
290 Ga0495668_0017461 3300046616 Bacteria 4160
291 Ga0495634_0387989 3300046642 Bacteria 831
292 Ga0495661_0078772 3300046665 Bacteria 1905
293 Ga0495623_0046296 3300046679 Bacteria 2762
294 Ga0495613_0472692 3300046689 Bacteria 847
295 Ga0495670_0075127 3300046691 Bacteria 1715
296 Ga0495649_0627109 3300046694 Bacteria 529
297 Ga0495589_0066891 3300046794 Bacteria 1759
298 Ga0495581_0039329 3300047315 Bacteria 2738
299 Ga0495672_0254521 3300047320 Bacteria 850
300 Ga0495676_0699521 3300047321 Bacteria 656
301 Ga0495683_0078861 3300047323 Bacteria 1608
302 Ga0495675_0808136 3300047444 Bacteria 519
303 Ga0495677_0146306 3300047445 Bacteria 908
304 Ga0495679_033321 3300047446 Bacteria 1646
305 Ga0495681_0062799 3300047470 Bacteria 1706
306 Ga0495686_0052759 3300047472 Bacteria 2549
307 Ga0495626_0207257 3300048091 Bacteria 801
308 Ga0496104_0038424 3300048907 Bacteria 4479
309 Ga0496105_0112947 3300048908 Bacteria 2242
310 Ga0496105_0208796 3300048908 Bacteria 1592
311 Ga0496108_0016486 3300048911 Bacteria 6030
312 Ga0496108_0242914 3300048911 Bacteria 1566
313 Ga0496109_0393588 3300048912 Bacteria 1309
314 Ga0496109_1157188 3300048912 Bacteria 710
315 Ga0496110_0203931 3300048913 Bacteria 1797
316 Ga0496110_0914307 3300048913 Bacteria 784
317 Ga0496111_0008665 3300048914 Bacteria 6746
318 Ga0496112_0012255 3300048915 Bacteria 7873
319 Ga0496112_0519415 3300048915 Bacteria 1125
320 Ga0496113_0010013 3300048916 Bacteria 6250
321 Ga0496114_1192184 3300048917 Bacteria 647
322 Ga0496115_0038881 3300048918 Bacteria 3778
323 Ga0496115_0912669 3300048918 Bacteria 677
324 Ga0496116_0025930 3300048919 Bacteria 4298
325 Ga0496117_0000001 3300048920 Bacteria 2526244
326 Ga0496118_0000002 3300048921 Bacteria 1690764
327 Ga0496121_0002050 3300048924 Bacteria 31892
328 Ga0496121_0004312 3300048924 Bacteria 19254
329 Ga0496122_0003443 3300048925 Bacteria 20812
330 Ga0496123_0006215 3300048926 Bacteria 11654
331 Ga0496125_0077906 3300048928 Bacteria 2551
332 Ga0495678_044502 3300049459 Bacteria 1755
333 Ga0501031_0202811 3300049568 Bacteria 1294
334 Ga0501034_1153866 3300049571 Bacteria 654
335 Ga0501037_0926808 3300049573 Bacteria 570
336 Ga0501039_0570425 3300049575 Bacteria 888
337 Ga0501040_0054339 3300049576 Bacteria 2745
338 Ga0501041_0143919 3300049577 Bacteria 1487
339 Ga0501046_0026761 3300049580 Bacteria 4711
340 Ga0501046_0119275 3300049580 Bacteria 2009
341 Ga0501047_0200433 3300049581 Bacteria 1857
342 Ga0501047_1085907 3300049581 Bacteria 613
343 Ga0501048_0299865 3300049582 Bacteria 1143
344 Ga0501048_0752543 3300049582 Bacteria 700
345 Ga0501067_0075014 3300049583 Bacteria 1874
346 Ga0501069_0001198 3300049585 Bacteria 12629
347 Ga0501069_0077725 3300049585 Bacteria 1866
348 Ga0501070_0006673 3300049586 Bacteria 9829
349 Ga0501070_0011811 3300049586 Bacteria 7377
350 Ga0501071_0159933 3300049587 Bacteria 1683
351 Ga0501073_0443466 3300049589 Bacteria 897
352 Ga0501073_0569359 3300049589 Bacteria 782
353 Ga0501074_0001066 3300049590 Bacteria 17874
354 Ga0501074_0164934 3300049590 Bacteria 1582
355 Ga0501075_0095023 3300049591 Bacteria 2262
356 Ga0501076_0945244 3300049592 Bacteria 710
357 Ga0501079_0023808 3300049741 Bacteria 4698
358 Ga0501080_0003596 3300049742 Bacteria 13648
359 Ga0501081_0011968 3300049743 Bacteria 5685
360 Ga0501083_0002695 3300049744 Bacteria 12241
361 Ga0501083_0257041 3300049744 Bacteria 1137
362 Ga0501035_0110861 3300049822 Bacteria 2405
363 Ga0501044_0016419 3300049823 Bacteria 7948
364 Ga0501044_0159445 3300049823 Bacteria 2234
365 Ga0501044_1064227 3300049823 Bacteria 679
366 nmdc:mga00v17_35901_c1 3300050491 Bacteria 2952
367 nmdc:mga0yw44_143_c1 3300050492 Bacteria 24721
368 nmdc:mga0yw44_4720_c1 3300050492 Bacteria 6308
369 nmdc:mga0k408_250159_c1 3300050493 Bacteria 1058
370 nmdc:mga0k408_781_c1 3300050493 Bacteria 17522
371 nmdc:mga07m45_11_c1 3300050496 Bacteria 163532
372 nmdc:mga07m45_162822_c1 3300050496 Bacteria 831
373 nmdc:mga05p37_995622_c1 3300050507 Bacteria 891
374 nmdc:mga0qj67_396514_c1 3300050509 Bacteria 1114
375 nmdc:mga06r32_845289_c1 3300050510 Bacteria 874
376 nmdc:mga08y16_30726_c1 3300050511 Bacteria 5649
377 nmdc:mga08y16_7681_c1 3300050511 Bacteria 11288
378 nmdc:mga08x19_183504_c1 3300050514 Bacteria 1429
379 nmdc:mga08x19_759135_c1 3300050514 Bacteria 689
380 nmdc:mga0sz30_341157_c1 3300050516 Bacteria 669
381 Ga0500641_0021198 3300053096 Unclassified 2473
382 Ga0500618_075235 3300053125 Bacteria 757
383 Ga0500552_004321 3300053733 Bacteria 1491
384 Ga0501084_0105427 3300054114 Bacteria 2368
385 Ga0501082_0024844 3300060353 Bacteria 5164
386 Ga0501082_0069544 3300060353 Bacteria 3031
387 Ga0530510_0533246 3300061734 Bacteria 891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048924 Ga0496121_0002050 Ga0496121_0002050_6122_6556 111
2 3300006914 Ga0075436_100815178 Ga0075436_1008151781 112
3 3300050496 nmdc:mga07m45_11_c1 nmdc:mga07m45_11_c1_68879_69235 112
4 3300050514 nmdc:mga08x19_759135_c1 nmdc:mga08x19_759135_c1_11_367 112
5 3300031548 Ga0307408_101981663 Ga0307408_1019816631 114
6 3300028379 Ga0268266_10307082 Ga0268266_103070822 115
7 3300005545 Ga0070695_100164651 Ga0070695_1001646511 116
8 3300035114 Ga0373939_0211980 Ga0373939_0211980_306_662 117
9 3300005328 Ga0070676_10000543 Ga0070676_100005435 118
10 3300005330 Ga0070690_100045204 Ga0070690_1000452041 118
11 3300005333 Ga0070677_10017284 Ga0070677_100172842 118
12 3300005334 Ga0068869_100003802 Ga0068869_1000038028 118
13 3300005335 Ga0070666_10105992 Ga0070666_101059921 118
14 3300005338 Ga0068868_100222816 Ga0068868_1002228163 118
15 3300005339 Ga0070660_100098621 Ga0070660_1000986214 118
16 3300005347 Ga0070668_100005165 Ga0070668_1000051654 118
17 3300005353 Ga0070669_100832513 Ga0070669_1008325131 118
18 3300005354 Ga0070675_100004625 Ga0070675_1000046252 118
19 3300005356 Ga0070674_100005923 Ga0070674_1000059238 118
20 3300005364 Ga0070673_100262252 Ga0070673_1002622523 118
21 3300005366 Ga0070659_100606789 Ga0070659_1006067892 118
22 3300005367 Ga0070667_100003315 Ga0070667_1000033158 118
23 3300005457 Ga0070662_100002573 Ga0070662_1000025735 118
24 3300005459 Ga0068867_100009092 Ga0068867_1000090928 118
25 3300005539 Ga0068853_101872222 Ga0068853_1018722221 118
26 3300005543 Ga0070672_100009276 Ga0070672_1000092768 118
27 3300005548 Ga0070665_102272084 Ga0070665_1022720842 118
28 3300005577 Ga0068857_100530510 Ga0068857_1005305102 118
29 3300005578 Ga0068854_100747896 Ga0068854_1007478962 118
30 3300005616 Ga0068852_100061061 Ga0068852_1000610615 118
31 3300005617 Ga0068859_100174025 Ga0068859_1001740253 118
32 3300005618 Ga0068864_100084969 Ga0068864_1000849691 118
33 3300005718 Ga0068866_10002671 Ga0068866_100026719 118
34 3300005719 Ga0068861_100014040 Ga0068861_1000140405 118
35 3300005841 Ga0068863_100017630 Ga0068863_1000176307 118
36 3300005842 Ga0068858_100027662 Ga0068858_1000276627 118
37 3300005843 Ga0068860_100003503 Ga0068860_10000350311 118
38 3300005844 Ga0068862_100010973 Ga0068862_1000109738 118
39 3300006881 Ga0068865_100002477 Ga0068865_10000247714 118
40 3300006931 Ga0097620_100174017 Ga0097620_1001740173 118
41 3300009094 Ga0111539_10944871 Ga0111539_109448711 118
42 3300009148 Ga0105243_10055089 Ga0105243_100550893 118
43 3300009176 Ga0105242_10013685 Ga0105242_100136856 118
44 3300009177 Ga0105248_10230353 Ga0105248_102303532 118
45 3300009553 Ga0105249_10002073 Ga0105249_100020733 118
46 3300011119 Ga0105246_11259447 Ga0105246_112594471 118
47 3300013297 Ga0157378_10596442 Ga0157378_105964422 118
48 3300013308 Ga0157375_10017427 Ga0157375_100174278 118
49 3300014326 Ga0157380_10000812 Ga0157380_1000081218 118
50 3300014968 Ga0157379_10032316 Ga0157379_100323165 118
51 3300014969 Ga0157376_10279640 Ga0157376_102796403 118
52 3300017792 Ga0163161_10100827 Ga0163161_101008274 118
53 3300025893 Ga0207682_10011124 Ga0207682_100111245 118
54 3300025899 Ga0207642_10500547 Ga0207642_105005472 118
55 3300025903 Ga0207680_10076945 Ga0207680_100769452 118
56 3300025907 Ga0207645_10232568 Ga0207645_102325682 118
57 3300025919 Ga0207657_10204358 Ga0207657_102043585 118
58 3300025923 Ga0207681_10429550 Ga0207681_104295503 118
59 3300025926 Ga0207659_10026809 Ga0207659_100268092 118
60 3300025933 Ga0207706_10000654 Ga0207706_1000065429 118
61 3300025934 Ga0207686_10028458 Ga0207686_100284583 118
62 3300025935 Ga0207709_10038246 Ga0207709_100382462 118
63 3300025936 Ga0207670_10314628 Ga0207670_103146281 118
64 3300025938 Ga0207704_10182914 Ga0207704_101829142 118
65 3300025940 Ga0207691_10016345 Ga0207691_100163459 118
66 3300025941 Ga0207711_10687657 Ga0207711_106876572 118
67 3300025942 Ga0207689_10002302 Ga0207689_1000230214 118
68 3300025960 Ga0207651_10044481 Ga0207651_100444814 118
69 3300025961 Ga0207712_10005156 Ga0207712_100051562 118
70 3300025972 Ga0207668_10016001 Ga0207668_100160016 118
71 3300025981 Ga0207640_10620080 Ga0207640_106200802 118
72 3300025986 Ga0207658_10026350 Ga0207658_100263502 118
73 3300026023 Ga0207677_11323476 Ga0207677_113234762 118
74 3300026041 Ga0207639_10371804 Ga0207639_103718043 118
75 3300026075 Ga0207708_10130695 Ga0207708_101306955 118
76 3300026088 Ga0207641_10005417 Ga0207641_100054175 118
77 3300026089 Ga0207648_10001971 Ga0207648_1000197115 118
78 3300026095 Ga0207676_11689704 Ga0207676_116897042 118
79 3300026118 Ga0207675_100000868 Ga0207675_10000086830 118
80 3300026121 Ga0207683_10643185 Ga0207683_106431852 118
81 3300026142 Ga0207698_10008824 Ga0207698_100088242 118
82 3300028379 Ga0268266_11439970 Ga0268266_114399701 118
83 3300028380 Ga0268265_10367372 Ga0268265_103673722 118
84 3300028381 Ga0268264_10025703 Ga0268264_100257032 118
85 3300046491 Ga0495584_0066518 Ga0495584_0066518_1274_1648 118
86 3300046500 Ga0495596_0226744 Ga0495596_0226744_151_525 118
87 3300046506 Ga0495583_0053473 Ga0495583_0053473_1294_1668 118
88 3300046513 Ga0495616_0025203 Ga0495616_0025203_405_779 118
89 3300046518 Ga0495631_0051948 Ga0495631_0051948_129_503 118
90 3300046519 Ga0495632_0012380 Ga0495632_0012380_1032_1406 118
91 3300046523 Ga0495644_0136332 Ga0495644_0136332_398_772 118
92 3300046528 Ga0495642_0066587 Ga0495642_0066587_129_503 118
93 3300046558 Ga0495633_0054441 Ga0495633_0054441_208_582 118
94 3300046616 Ga0495668_0017461 Ga0495668_0017461_270_644 118
95 3300046665 Ga0495661_0078772 Ga0495661_0078772_233_607 118
96 3300046691 Ga0495670_0075127 Ga0495670_0075127_1234_1608 118
97 3300046694 Ga0495649_0627109 Ga0495649_0627109_102_476 118
98 3300046794 Ga0495589_0066891 Ga0495589_0066891_165_539 118
99 3300047320 Ga0495672_0254521 Ga0495672_0254521_65_439 118
100 3300047323 Ga0495683_0078861 Ga0495683_0078861_1083_1457 118
101 3300047445 Ga0495677_0146306 Ga0495677_0146306_216_590 118
102 3300047446 Ga0495679_033321 Ga0495679_033321_57_431 118
103 3300047470 Ga0495681_0062799 Ga0495681_0062799_1168_1542 118
104 3300048091 Ga0495626_0207257 Ga0495626_0207257_397_771 118
105 3300049459 Ga0495678_044502 Ga0495678_044502_135_509 118
106 iso_pu_bacteria 2643221591 2643966795 118
107 3300005435 Ga0070714_101400204 Ga0070714_1014002041 119
108 3300005548 Ga0070665_100118389 Ga0070665_1001183893 119
109 3300005617 Ga0068859_100241760 Ga0068859_1002417603 119
110 3300005843 Ga0068860_100113682 Ga0068860_1001136824 119
111 3300006931 Ga0097620_100241759 Ga0097620_1002417592 119
112 3300009093 Ga0105240_10645203 Ga0105240_106452032 119
113 3300009545 Ga0105237_10636834 Ga0105237_106368341 119
114 3300014968 Ga0157379_10039462 Ga0157379_100394627 119
115 3300025913 Ga0207695_10153578 Ga0207695_101535782 119
116 3300025929 Ga0207664_10151071 Ga0207664_101510713 119
117 3300028381 Ga0268264_10384630 Ga0268264_103846304 119
118 3300047321 Ga0495676_0699521 Ga0495676_0699521_20_379 119
119 3300047472 Ga0495686_0052759 Ga0495686_0052759_2113_2496 119
120 3300005337 Ga0070682_100111633 Ga0070682_1001116333 120
121 3300005543 Ga0070672_100427139 Ga0070672_1004271392 120
122 3300013306 Ga0163162_11323896 Ga0163162_113238962 120
123 3300035410 Ga0373924_0000111 Ga0373924_0000111_19850_20317 120
124 3300035692 Ga0373935_0451777 Ga0373935_0451777_237_704 120
125 3300037068 Ga0373925_1047844 Ga0373925_1047844_12_479 120
126 3300042435 Ga0439434_0088771 Ga0439434_0088771_217_606 120
127 3300046529 Ga0495652_0395130 Ga0495652_0395130_398_847 120
128 3300048913 Ga0496110_0914307 Ga0496110_0914307_372_770 120
129 3300050514 nmdc:mga08x19_183504_c1 nmdc:mga08x19_183504_c1_744_1190 120
130 3300005434 Ga0070709_10173910 Ga0070709_101739102 121
131 3300005436 Ga0070713_100634156 Ga0070713_1006341562 121
132 3300005438 Ga0070701_11298504 Ga0070701_112985041 121
133 3300005439 Ga0070711_100566380 Ga0070711_1005663802 121
134 3300005444 Ga0070694_100261463 Ga0070694_1002614632 121
135 3300005459 Ga0068867_100423959 Ga0068867_1004239592 121
136 3300005545 Ga0070695_100012052 Ga0070695_1000120527 121
137 3300005549 Ga0070704_100247964 Ga0070704_1002479643 121
138 3300005842 Ga0068858_100178202 Ga0068858_1001782022 121
139 3300006195 Ga0075366_10274539 Ga0075366_102745391 121
140 3300009148 Ga0105243_10000060 Ga0105243_1000006027 121
141 3300013308 Ga0157375_10489516 Ga0157375_104895162 121
142 3300014968 Ga0157379_10029519 Ga0157379_100295192 121
143 3300014969 Ga0157376_10173094 Ga0157376_101730942 121
144 3300025906 Ga0207699_10199330 Ga0207699_101993302 121
145 3300025935 Ga0207709_10000004 Ga0207709_1000000426 121
146 3300026035 Ga0207703_10380529 Ga0207703_103805292 121
147 3300026089 Ga0207648_10753092 Ga0207648_107530921 121
148 3300027695 Ga0209966_1035422 Ga0209966_10354222 121
149 3300048918 Ga0496115_0912669 Ga0496115_0912669_152_580 121
150 3300049582 Ga0501048_0299865 Ga0501048_0299865_536_931 121
151 3300053733 Ga0500552_004321 Ga0500552_004321_569_952 121
152 3300005355 Ga0070671_100010726 Ga0070671_1000107266 122
153 3300005438 Ga0070701_10046298 Ga0070701_100462981 122
154 3300005441 Ga0070700_100140511 Ga0070700_1001405113 122
155 3300005444 Ga0070694_100099228 Ga0070694_1000992282 122
156 3300005530 Ga0070679_101164278 Ga0070679_1011642782 122
157 3300005549 Ga0070704_100630190 Ga0070704_1006301902 122
158 3300005617 Ga0068859_102102926 Ga0068859_1021029261 122
159 3300005618 Ga0068864_100434846 Ga0068864_1004348462 122
160 3300005841 Ga0068863_100461036 Ga0068863_1004610362 122
161 3300005843 Ga0068860_102732204 Ga0068860_1027322041 122
162 3300005844 Ga0068862_100082589 Ga0068862_1000825892 122
163 3300006195 Ga0075366_10000689 Ga0075366_1000068923 122
164 3300006353 Ga0075370_10145886 Ga0075370_101458862 122
165 3300006844 Ga0075428_100218970 Ga0075428_1002189704 122
166 3300006931 Ga0097620_102103432 Ga0097620_1021034321 122
167 3300009094 Ga0111539_10003300 Ga0111539_1000330015 122
168 3300009094 Ga0111539_10383274 Ga0111539_103832743 122
169 3300009177 Ga0105248_10001394 Ga0105248_100013943 122
170 3300017792 Ga0163161_11908542 Ga0163161_119085422 122
171 3300025885 Ga0207653_10095130 Ga0207653_100951303 122
172 3300025931 Ga0207644_10019021 Ga0207644_100190213 122
173 3300025941 Ga0207711_10090998 Ga0207711_100909983 122
174 3300026075 Ga0207708_10026241 Ga0207708_100262416 122
175 3300026088 Ga0207641_10824719 Ga0207641_108247192 122
176 3300026095 Ga0207676_10028034 Ga0207676_100280344 122
177 3300027695 Ga0209966_1039141 Ga0209966_10391411 122
178 3300027907 Ga0207428_10020094 Ga0207428_100200942 122
179 3300028380 Ga0268265_10348783 Ga0268265_103487832 122
180 3300028800 Ga0265338_10032640 Ga0265338_100326405 122
181 3300031344 Ga0265316_10113600 Ga0265316_101136001 122
182 3300031824 Ga0307413_11569325 Ga0307413_115693251 122
183 3300035113 Ga0373936_0025247 Ga0373936_0025247_1702_2175 122
184 3300037471 Ga0395905_0288534 Ga0395905_0288534_887_1282 122
185 3300041460 Ga0451802_0936230 Ga0451802_0936230_149_523 122
186 3300046473 Ga0495582_0069155 Ga0495582_0069155_1085_1558 122
187 3300046516 Ga0495628_0168182 Ga0495628_0168182_248_694 122
188 3300047315 Ga0495581_0039329 Ga0495581_0039329_1788_2261 122
189 3300048908 Ga0496105_0112947 Ga0496105_0112947_389_784 122
190 3300048908 Ga0496105_0208796 Ga0496105_0208796_196_669 122
191 3300048911 Ga0496108_0242914 Ga0496108_0242914_1148_1543 122
192 3300048912 Ga0496109_1157188 Ga0496109_1157188_102_497 122
193 3300048913 Ga0496110_0203931 Ga0496110_0203931_1261_1656 122
194 3300048915 Ga0496112_0012255 Ga0496112_0012255_6451_6924 122
195 3300048916 Ga0496113_0010013 Ga0496113_0010013_334_807 122
196 3300049581 Ga0501047_0200433 Ga0501047_0200433_532_951 122
197 3300049589 Ga0501073_0443466 Ga0501073_0443466_174_593 122
198 3300049823 Ga0501044_0159445 Ga0501044_0159445_800_1219 122
199 3300050493 nmdc:mga0k408_781_c1 nmdc:mga0k408_781_c1_9589_9984 122
200 3300050496 nmdc:mga07m45_162822_c1 nmdc:mga07m45_162822_c1_150_542 122
201 3300050509 nmdc:mga0qj67_396514_c1 nmdc:mga0qj67_396514_c1_22_420 122
202 3300050510 nmdc:mga06r32_845289_c1 nmdc:mga06r32_845289_c1_12_449 122
203 3300050511 nmdc:mga08y16_7681_c1 nmdc:mga08y16_7681_c1_6589_6978 122
204 iso_pu_bacteria 2643221614 2644086741 122
205 3300005327 Ga0070658_10019639 Ga0070658_100196392 123
206 3300005333 Ga0070677_10083589 Ga0070677_100835892 123
207 3300005333 Ga0070677_10668954 Ga0070677_106689541 123
208 3300005336 Ga0070680_100371551 Ga0070680_1003715511 123
209 3300005356 Ga0070674_100204907 Ga0070674_1002049071 123
210 3300005456 Ga0070678_101237899 Ga0070678_1012378992 123
211 3300005458 Ga0070681_11092241 Ga0070681_110922411 123
212 3300005459 Ga0068867_100271031 Ga0068867_1002710312 123
213 3300005535 Ga0070684_101167022 Ga0070684_1011670222 123
214 3300005543 Ga0070672_100250342 Ga0070672_1002503422 123
215 3300005719 Ga0068861_100223692 Ga0068861_1002236922 123
216 3300005844 Ga0068862_100034683 Ga0068862_1000346832 123
217 3300006028 Ga0070717_10823644 Ga0070717_108236442 123
218 3300006038 Ga0075365_10019378 Ga0075365_100193786 123
219 3300006175 Ga0070712_100057840 Ga0070712_1000578403 123
220 3300006186 Ga0075369_10213131 Ga0075369_102131311 123
221 3300013100 Ga0157373_10277456 Ga0157373_102774564 123
222 3300013105 Ga0157369_10200804 Ga0157369_102008043 123
223 3300013307 Ga0157372_10800225 Ga0157372_108002252 123
224 3300013308 Ga0157375_12152706 Ga0157375_121527062 123
225 3300014325 Ga0163163_10017267 Ga0163163_100172672 123
226 3300014326 Ga0157380_10071867 Ga0157380_100718673 123
227 3300025893 Ga0207682_10346531 Ga0207682_103465311 123
228 3300025909 Ga0207705_10022460 Ga0207705_100224602 123
229 3300025912 Ga0207707_11049814 Ga0207707_110498142 123
230 3300025928 Ga0207700_10492063 Ga0207700_104920631 123
231 3300025937 Ga0207669_10408605 Ga0207669_104086051 123
232 3300025940 Ga0207691_10038582 Ga0207691_100385826 123
233 3300025949 Ga0207667_10350233 Ga0207667_103502333 123
234 3300025961 Ga0207712_11792325 Ga0207712_117923251 123
235 3300026118 Ga0207675_100133461 Ga0207675_1001334612 123
236 3300026121 Ga0207683_11190499 Ga0207683_111904992 123
237 3300028380 Ga0268265_11514466 Ga0268265_115144661 123
238 3300028800 Ga0265338_10137586 Ga0265338_101375862 123
239 3300035083 Ga0373926_0012798 Ga0373926_0012798_261_728 123
240 3300035170 Ga0373943_0227634 Ga0373943_0227634_255_722 123
241 3300035171 Ga0373946_0309663 Ga0373946_0309663_159_626 123
242 3300035692 Ga0373935_0039565 Ga0373935_0039565_121_588 123
243 3300035695 Ga0373927_0003549 Ga0373927_0003549_270_737 123
244 3300035725 Ga0373947_0077800 Ga0373947_0077800_304_771 123
245 3300037068 Ga0373925_0092922 Ga0373925_0092922_214_681 123
246 3300046472 Ga0495580_0369790 Ga0495580_0369790_309_776 123
247 3300046477 Ga0495664_0286831 Ga0495664_0286831_46_441 123
248 3300046517 Ga0495630_0207390 Ga0495630_0207390_866_1333 123
249 3300050491 nmdc:mga00v17_35901_c1 nmdc:mga00v17_35901_c1_1602_1994 123
250 3300050492 nmdc:mga0yw44_143_c1 nmdc:mga0yw44_143_c1_8558_8950 123
251 3300050492 nmdc:mga0yw44_4720_c1 nmdc:mga0yw44_4720_c1_2511_2903 123
252 3300050516 nmdc:mga0sz30_341157_c1 nmdc:mga0sz30_341157_c1_265_657 123
253 iso_pu_bacteria 2643221661 2644341695 123
254 iso_pu_bacteria 2643221666 2644367982 123
255 3300025921 Ga0207652_10914125 Ga0207652_109141251 124
256 3300025936 Ga0207670_10415407 Ga0207670_104154072 124
257 3300028800 Ga0265338_10002620 Ga0265338_1000262021 124
258 3300031241 Ga0265325_10003700 Ga0265325_1000370011 124
259 3300031250 Ga0265331_10014588 Ga0265331_100145883 124
260 3300031251 Ga0265327_10105433 Ga0265327_101054332 124
261 3300031595 Ga0265313_10000984 Ga0265313_1000098411 124
262 3300039447 Ga0436361_0857520 Ga0436361_0857520_42_440 124
263 3300041443 Ga0451789_0603110 Ga0451789_0603110_143_553 124
264 3300041458 Ga0451798_0112337 Ga0451798_0112337_13_426 124
265 3300049568 Ga0501031_0202811 Ga0501031_0202811_476_868 124
266 3300049575 Ga0501039_0570425 Ga0501039_0570425_83_475 124
267 3300049576 Ga0501040_0054339 Ga0501040_0054339_1042_1434 124
268 3300049577 Ga0501041_0143919 Ga0501041_0143919_414_806 124
269 3300049580 Ga0501046_0119275 Ga0501046_0119275_30_422 124
270 3300049582 Ga0501048_0752543 Ga0501048_0752543_60_452 124
271 3300049587 Ga0501071_0159933 Ga0501071_0159933_798_1190 124
272 3300049590 Ga0501074_0164934 Ga0501074_0164934_804_1196 124
273 3300049591 Ga0501075_0095023 Ga0501075_0095023_428_820 124
274 3300049592 Ga0501076_0945244 Ga0501076_0945244_240_632 124
275 3300049743 Ga0501081_0011968 Ga0501081_0011968_5212_5604 124
276 3300049744 Ga0501083_0257041 Ga0501083_0257041_327_719 124
277 3300050493 nmdc:mga0k408_250159_c1 nmdc:mga0k408_250159_c1_442_897 124
278 3300053125 Ga0500618_075235 Ga0500618_075235_104_508 124
279 3300054114 Ga0501084_0105427 Ga0501084_0105427_487_879 124
280 3300060353 Ga0501082_0069544 Ga0501082_0069544_2425_2811 124
281 3300061734 Ga0530510_0533246 Ga0530510_0533246_380_772 124
282 iso_pu_bacteria 2834641062 2834642226 124
283 3300005563 Ga0068855_100539836 Ga0068855_1005398362 125
284 3300013102 Ga0157371_10299848 Ga0157371_102998484 125
285 3300013104 Ga0157370_10865852 Ga0157370_108658522 125
286 3300013307 Ga0157372_10454322 Ga0157372_104543222 125
287 3300014497 Ga0182008_10000133 Ga0182008_1000013334 125
288 3300015261 Ga0182006_1000006 Ga0182006_1000006300 125
289 3300015262 Ga0182007_10000434 Ga0182007_100004348 125
290 3300015265 Ga0182005_1000001 Ga0182005_1000001549 125
291 3300025949 Ga0207667_10938441 Ga0207667_109384411 125
292 3300031711 Ga0265314_10082194 Ga0265314_100821944 125
293 3300046557 Ga0495622_0106577 Ga0495622_0106577_151_585 125
294 3300048914 Ga0496111_0008665 Ga0496111_0008665_1934_2368 125
295 3300048919 Ga0496116_0025930 Ga0496116_0025930_2598_3032 125
296 3300048920 Ga0496117_0000001 Ga0496117_0000001_450835_451269 125
297 3300048921 Ga0496118_0000002 Ga0496118_0000002_450835_451269 125
298 3300048924 Ga0496121_0004312 Ga0496121_0004312_2392_2826 125
299 3300048925 Ga0496122_0003443 Ga0496122_0003443_17108_17542 125
300 3300048926 Ga0496123_0006215 Ga0496123_0006215_3020_3454 125
301 3300048928 Ga0496125_0077906 Ga0496125_0077906_722_1156 125
302 3300049580 Ga0501046_0026761 Ga0501046_0026761_1471_1881 125
303 3300049581 Ga0501047_1085907 Ga0501047_1085907_136_546 125
304 3300049583 Ga0501067_0075014 Ga0501067_0075014_887_1297 125
305 3300049585 Ga0501069_0001198 Ga0501069_0001198_11919_12329 125
306 3300049586 Ga0501070_0006673 Ga0501070_0006673_5866_6276 125
307 3300049589 Ga0501073_0569359 Ga0501073_0569359_106_516 125
308 3300049590 Ga0501074_0001066 Ga0501074_0001066_13067_13477 125
309 3300049741 Ga0501079_0023808 Ga0501079_0023808_1853_2263 125
310 3300049742 Ga0501080_0003596 Ga0501080_0003596_13159_13569 125
311 3300049744 Ga0501083_0002695 Ga0501083_0002695_6722_7132 125
312 3300049822 Ga0501035_0110861 Ga0501035_0110861_516_926 125
313 3300049823 Ga0501044_0016419 Ga0501044_0016419_2463_2873 125
314 3300049823 Ga0501044_1064227 Ga0501044_1064227_263_667 125
315 3300060353 Ga0501082_0024844 Ga0501082_0024844_1338_1748 125
316 iso_pu_bacteria 2600255292 2601668584 125
317 iso_pu_bacteria 2857547612 2857550815 125
318 iso_pu_bacteria 2932410948 2932414137 125
319 iso_pu_bacteria 2932416698 2932416746 125
320 3300006028 Ga0070717_10113465 Ga0070717_101134653 126
321 3300009094 Ga0111539_11364224 Ga0111539_113642242 126
322 3300035724 Ga0373933_0030936 Ga0373933_0030936_2349_2816 126
323 3300045051 Ga0451576_0499483 Ga0451576_0499483_619_1017 126
324 3300045976 Ga0466967_1647986 Ga0466967_1647986_145_534 126
325 3300046689 Ga0495613_0472692 Ga0495613_0472692_20_409 126
326 3300049586 Ga0501070_0011811 Ga0501070_0011811_1162_1563 126
327 3300053096 Ga0500641_0021198 Ga0500641_0021198_856_1242 126
328 3300005328 Ga0070676_10179512 Ga0070676_101795122 127
329 3300005344 Ga0070661_100000067 Ga0070661_10000006760 127
330 3300005437 Ga0070710_10077879 Ga0070710_100778792 127
331 3300006852 Ga0075433_10609577 Ga0075433_106095771 127
332 3300026089 Ga0207648_11779651 Ga0207648_117796512 127
333 3300037471 Ga0395905_0308487 Ga0395905_0308487_70_495 127
334 3300046615 Ga0495656_0382036 Ga0495656_0382036_136_537 127
335 3300048907 Ga0496104_0038424 Ga0496104_0038424_2634_3083 127
336 3300048912 Ga0496109_0393588 Ga0496109_0393588_523_972 127
337 3300048917 Ga0496114_1192184 Ga0496114_1192184_130_579 127
338 3300049571 Ga0501034_1153866 Ga0501034_1153866_19_423 127
339 3300049573 Ga0501037_0926808 Ga0501037_0926808_60_464 127
340 3300049585 Ga0501069_0077725 Ga0501069_0077725_1057_1461 127
341 3300005364 Ga0070673_100712939 Ga0070673_1007129391 128
342 3300009174 Ga0105241_10215714 Ga0105241_102157142 128
343 3300025898 Ga0207692_10000808 Ga0207692_100008088 128
344 3300028800 Ga0265338_10481878 Ga0265338_104818781 128
345 3300044656 Ga0466969_0116000 Ga0466969_0116000_240_671 128
346 3300004803 Ga0058862_11872432 Ga0058862_118724321 129
347 3300005344 Ga0070661_100914603 Ga0070661_1009146032 129
348 3300035172 Ga0373955_0194445 Ga0373955_0194445_713_1123 129
349 3300041486 Ga0451807_0257979 Ga0451807_0257979_46_477 129
350 3300046536 Ga0495587_0080016 Ga0495587_0080016_342_752 129
351 3300046559 Ga0495667_0004275 Ga0495667_0004275_8109_8558 129
352 3300046559 Ga0495667_0110612 Ga0495667_0110612_1334_1744 129
353 3300046679 Ga0495623_0046296 Ga0495623_0046296_17_427 129
354 3300047444 Ga0495675_0808136 Ga0495675_0808136_36_446 129
355 3300041408 Ga0439453_0036591 Ga0439453_0036591_353_769 132
356 3300006028 Ga0070717_10970776 Ga0070717_109707762 133
357 3300006237 Ga0097621_100098075 Ga0097621_1000980752 133
358 3300005563 Ga0068855_101270804 Ga0068855_1012708041 134
359 3300005614 Ga0068856_102031130 Ga0068856_1020311302 134
360 3300009093 Ga0105240_10075783 Ga0105240_100757835 134
361 3300009147 Ga0114129_10033739 Ga0114129_100337395 134
362 3300013105 Ga0157369_10010723 Ga0157369_100107233 134
363 3300013307 Ga0157372_10001764 Ga0157372_100017643 134
364 3300025913 Ga0207695_10381181 Ga0207695_103811812 134
365 3300025929 Ga0207664_10849960 Ga0207664_108499602 134
366 3300027907 Ga0207428_10064857 Ga0207428_100648571 134
367 3300030878 Ga0265770_1028874 Ga0265770_10288742 134
368 3300039450 Ga0436363_1270877 Ga0436363_1270877_320_763 134
369 3300039453 Ga0436362_0929030 Ga0436362_0929030_541_984 134
370 3300050507 nmdc:mga05p37_995622_c1 nmdc:mga05p37_995622_c1_437_844 134
371 3300050511 nmdc:mga08y16_30726_c1 nmdc:mga08y16_30726_c1_2635_3087 134
372 3300005435 Ga0070714_100065841 Ga0070714_1000658413 135
373 3300005439 Ga0070711_100233418 Ga0070711_1002334181 135
374 3300005577 Ga0068857_102101770 Ga0068857_1021017701 135
375 3300005618 Ga0068864_100549572 Ga0068864_1005495722 135
376 3300006028 Ga0070717_11876596 Ga0070717_118765961 135
377 3300006175 Ga0070712_100231894 Ga0070712_1002318942 135
378 3300013306 Ga0163162_10711560 Ga0163162_107115602 135
379 3300014325 Ga0163163_10525285 Ga0163163_105252851 135
380 3300014969 Ga0157376_11424495 Ga0157376_114244951 135
381 3300025905 Ga0207685_10517185 Ga0207685_105171851 135
382 3300025915 Ga0207693_10073752 Ga0207693_100737523 135
383 3300025916 Ga0207663_10068339 Ga0207663_100683392 135
384 3300025929 Ga0207664_10882255 Ga0207664_108822551 135
385 3300026095 Ga0207676_10433175 Ga0207676_104331751 135
386 3300026116 Ga0207674_11102587 Ga0207674_111025871 135
387 3300035410 Ga0373924_0251755 Ga0373924_0251755_250_696 135
388 3300036401 Ga0373937_0316876 Ga0373937_0316876_106_585 135
389 3300036401 Ga0373937_0631785 Ga0373937_0631785_326_772 135
390 3300046642 Ga0495634_0387989 Ga0495634_0387989_10_456 135
391 3300048911 Ga0496108_0016486 Ga0496108_0016486_3448_3897 135
392 3300048918 Ga0496115_0038881 Ga0496115_0038881_134_583 135
393 3300048915 Ga0496112_0519415 Ga0496112_0519415_280_720 136
394 3300000546 LJNas_1000133 LJNas_100013314 137
395 3300025906 Ga0207699_10236766 Ga0207699_102367661 137
396 3300025929 Ga0207664_10124608 Ga0207664_101246082 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

29

130

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7679 7 130
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7194 7 130
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.7096 19 127
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6083 19 127
6m36-assembly1.cif.gz_E the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.5386 61 102
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7576 7 124 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7303 7 127 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7289 7 124 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7084 7 127 3.90.1150.200
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6076 26 126 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A7Z0AXJ3-F1-model_v4 YdhG-like domain-containing protein 0.9965 1 125
AF-I4W4N0-F1-model_v4 YdhG-like domain-containing protein 0.9958 4 126
AF-A0A427CGT7-F1-model_v4 DUF1801 domain-containing protein 0.9957 6 124
AF-A0A2V7X7N0-F1-model_v4 YdhG-like domain-containing protein 0.9957 4 76
AF-A0A433B8C7-F1-model_v4 DUF1801 domain-containing protein 0.9949 1 127

Feature Viewer

pLDDT pTM Quality
88.61 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map