F433444

General Info

Members Datasets Scaffolds Average Seq Length
396 252 376 257

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10110679|Ga0070681_101106791
Length 286
Sequence MPMRRLTWDHPRMNRITFAMAGLLLPGLTMAASIPVQGYTVVHAFPHDPKAYTEGLFYLDGYLYEATGTVGASSVRKVDLASGKVLQQSATPWPDYGEGIVAWKDRLVQLTWQDHEGFVYDLATLTPHAKFAYPGEGWSLTTDGTHLLMSDGTPTIRILDPDSLQQVGRIDVTADGKPLANLNELEWVQGELYANVWLTDRIARIDPASGRVIGWIDLAGLGPAPETLEDPANDVLNGIAYDAAHDRLFVTGKRWPRVYEIRLVPAHRDTAAGPAAAKAGSPPASR

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
4 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
5 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
6 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
7 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
8 2643221638 Duganella sp. Root336D2 Isolate Unclassified
9 2643221640 Caulobacter sp. Root342 Isolate Unclassified
10 2643221642 Caulobacter sp. Root343 Isolate Unclassified
11 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
12 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
13 2734482264 Dyella sp. AD052 Isolate Unclassified
14 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
15 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
16 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
17 2919404418 Luteibacter sp. 3190 Isolate Unclassified
18 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
19 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
20 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
23 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
24 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
25 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
26 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
27 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
28 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
29 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
30 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
33 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
34 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
35 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
36 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
37 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
38 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
39 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
40 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
43 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
44 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
45 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
103 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
111 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
113 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
114 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
115 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
117 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
118 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
119 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
150 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
171 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
172 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
173 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
174 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
175 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
187 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
188 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
192 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
193 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
194 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
198 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
208 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
209 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
210 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
211 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
212 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
213 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
231 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
239 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
246 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
247 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
248 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
249 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
250 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
251 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
252 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.95
Metatranscriptomes 0
Isolates 5.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.8
Nodule 0.51
Rhizoplane 2.78
Rhizosphere 54.55
Stem 0
Stem Tuber 0
Unclassified 12.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10000218 3300002075 Bacteria 15528
2 JGI25156J39149_1005586 3300002705 Bacteria 3595
3 JGI25162J39368_1001784 3300002737 Bacteria 10199
4 JGI25162J39368_1006425 3300002737 Bacteria 2035
5 JGI25157J39369_1001283 3300002741 Bacteria 10098
6 JGI25157J39369_1002282 3300002741 Bacteria 5081
7 JGI25163J39215_1001844 3300002771 Bacteria 2813
8 JGI25164J39214_1000571 3300002772 Bacteria 16629
9 JGI25164J39214_1000878 3300002772 Bacteria 10199
10 JGI25150J39212_1000581 3300002774 Bacteria 14438
11 JGI25150J39212_1004366 3300002774 Bacteria 3155
12 JGI25159J45721_1000536 3300002987 Bacteria 17286
13 JGI25159J45721_1001543 3300002987 Bacteria 9433
14 JGI25159J45721_1005094 3300002987 Bacteria 4177
15 JGI25165J46597_1001141 3300003214 Bacteria 16629
16 JGI25165J46597_1001659 3300003214 Bacteria 10199
17 JGI25153J46596_10006703 3300003215 Bacteria 5788
18 rootL2_10052119 3300003322 Bacteria 1008
19 rootH1_10176962 3300003323 Bacteria 1513
20 JGI25160J50197_1001804 3300003354 Bacteria 10336
21 JGI25161J50226_1000545 3300003374 Bacteria 16078
22 JGI25161J50226_1000554 3300003374 Bacteria 15937
23 Ga0055525_1000004 3300003759 Bacteria 888039
24 Ga0055535_1001671 3300003761 Bacteria 10199
25 Ga0055542_1001621 3300003762 Bacteria 10199
26 Ga0055529_1001205 3300003763 Bacteria 10199
27 Ga0055526_1001198 3300003771 Bacteria 18704
28 Ga0055526_1003637 3300003771 Bacteria 9656
29 Ga0055526_1008545 3300003771 Bacteria 5083
30 Ga0055537_1000040 3300003773 Bacteria 92014
31 Ga0055537_1002331 3300003773 Bacteria 6460
32 Ga0055537_1020205 3300003773 Bacteria 1016
33 Ga0055524_1000022 3300003775 Bacteria 224103
34 Ga0055524_1000587 3300003775 Bacteria 26365
35 Ga0055524_1002230 3300003775 Bacteria 10152
36 Ga0055524_1003954 3300003775 Bacteria 7013
37 Ga0055536_1000678 3300003781 Bacteria 22920
38 Ga0055536_1000767 3300003781 Bacteria 21385
39 Ga0055534_1000396 3300003784 Bacteria 26966
40 Ga0055534_1001613 3300003784 Bacteria 8751
41 Ga0055528_1000181 3300003790 Bacteria 53479
42 Ga0055528_1005260 3300003790 Bacteria 6069
43 Ga0055530_10001297 3300003791 Bacteria 18865
44 Ga0055530_10002649 3300003791 Bacteria 11194
45 Ga0055530_10004384 3300003791 Bacteria 7301
46 Ga0055530_10009888 3300003791 Bacteria 3597
47 Ga0055530_10017995 3300003791 Bacteria 2194
48 Ga0055531_10001084 3300003794 Bacteria 21385
49 Ga0055531_10011115 3300003794 Bacteria 4387
50 Ga0055531_10027583 3300003794 Bacteria 1986
51 Ga0055543_1000692 3300004625 Bacteria 17340
52 Ga0065165_1000201 3300005262 Bacteria 103327
53 Ga0065165_1000321 3300005262 Bacteria 78264
54 Ga0065165_1009400 3300005262 Bacteria 4387
55 Ga0068868_100455813 3300005338 Unclassified 1113
56 Ga0070661_100064794 3300005344 Bacteria 2686
57 Ga0070669_100182427 3300005353 Bacteria 1643
58 Ga0070671_100004730 3300005355 Bacteria 10811
59 Ga0070667_100018764 3300005367 Bacteria 5736
60 Ga0070714_100048242 3300005435 Bacteria 3621
61 Ga0070708_100144039 3300005445 Bacteria 2212
62 Ga0070662_100432503 3300005457 Bacteria 1090
63 Ga0070662_100640515 3300005457 Bacteria 896
64 Ga0070681_10110679 3300005458 Bacteria 2686
65 Ga0070707_100191145 3300005468 Bacteria 1996
66 Ga0070698_100056745 3300005471 Bacteria 3966
67 Ga0070679_100591190 3300005530 Bacteria 1053
68 Ga0070684_100323712 3300005535 Bacteria 1416
69 Ga0070697_100255492 3300005536 Bacteria 1499
70 Ga0070665_100016383 3300005548 Bacteria 7433
71 Ga0070665_100063418 3300005548 Bacteria 3705
72 Ga0068856_100096166 3300005614 Bacteria 2950
73 Ga0068856_100190065 3300005614 Bacteria 2067
74 Ga0070702_100224920 3300005615 Unclassified 1257
75 Ga0068863_100009616 3300005841 Bacteria 9429
76 Ga0068858_100002701 3300005842 Bacteria 17882
77 Ga0068862_100010772 3300005844 Bacteria 7549
78 Ga0068862_100314176 3300005844 Bacteria 1445
79 Ga0070717_10065154 3300006028 Bacteria 3028
80 Ga0075431_100123587 3300006847 Bacteria 2670
81 Ga0075434_100018566 3300006871 Bacteria 6720
82 Ga0068865_100445080 3300006881 Bacteria 1070
83 Ga0099826_10000006 3300006948 Bacteria 432260
84 Ga0075435_100000017 3300007076 Bacteria 99666
85 Ga0105250_10017037 3300009092 Unclassified 2954
86 Ga0105240_10004572 3300009093 Bacteria 20981
87 Ga0105240_10039934 3300009093 Bacteria 6006
88 Ga0105240_10064478 3300009093 Bacteria 4552
89 Ga0111539_10005216 3300009094 Bacteria 16826
90 Ga0105245_10023887 3300009098 Bacteria 5365
91 Ga0105247_10000248 3300009101 Bacteria 50108
92 Ga0105241_10202588 3300009174 Bacteria 1658
93 Ga0105242_10146814 3300009176 Bacteria 2052
94 Ga0105248_10018666 3300009177 Bacteria 7667
95 Ga0105248_10061659 3300009177 Bacteria 4211
96 Ga0105248_10373721 3300009177 Bacteria 1605
97 Ga0105237_10518760 3300009545 Unclassified 1198
98 Ga0105238_10113652 3300009551 Bacteria 2687
99 Ga0105238_10388326 3300009551 Bacteria 1388
100 Ga0105249_10029334 3300009553 Bacteria 4968
101 Ga0105249_10118921 3300009553 Bacteria 2509
102 Ga0099796_10021120 3300010159 Bacteria 2001
103 Ga0157370_10090187 3300013104 Bacteria 2879
104 Ga0157369_10470185 3300013105 Bacteria 1301
105 Ga0157378_10002118 3300013297 Bacteria 17654
106 Ga0163162_10045642 3300013306 Bacteria 4389
107 Ga0157372_10179529 3300013307 Bacteria 2450
108 Ga0163163_10026043 3300014325 Bacteria 5585
109 Ga0163163_10079919 3300014325 Bacteria 3269
110 Ga0182008_10000926 3300014497 Bacteria 20426
111 Ga0157379_10051360 3300014968 Unclassified 3683
112 Ga0157379_10080973 3300014968 Bacteria 2909
113 Ga0157379_10196895 3300014968 Bacteria 1821
114 Ga0182006_1000066 3300015261 Bacteria 151095
115 Ga0182006_1000188 3300015261 Bacteria 64237
116 Ga0182007_10045991 3300015262 Bacteria 1446
117 Ga0182005_1001641 3300015265 Bacteria 8699
118 Ga0182005_1010571 3300015265 Bacteria 2651
119 Ga0182005_1048102 3300015265 Bacteria 1159
120 Ga0182005_1071020 3300015265 Bacteria 956
121 Ga0183363_1010 3300015690 Bacteria 108191
122 Ga0163161_10529878 3300017792 Bacteria 963
123 Ga0213872_10002790 3300021361 Bacteria 9998
124 Ga0213876_10179286 3300021384 Bacteria 1127
125 Ga0209435_103648 3300025206 Bacteria 1748
126 Ga0209760_100584 3300025207 Bacteria 6404
127 Ga0209436_100123 3300025208 Bacteria 37941
128 Ga0209436_100307 3300025208 Bacteria 22491
129 Ga0209436_100548 3300025208 Bacteria 16269
130 Ga0209784_100094 3300025224 Bacteria 113434
131 Ga0209566_102564 3300025225 Bacteria 3263
132 Ga0209672_107084 3300025228 Bacteria 1760
133 Ga0209563_100013 3300025230 Bacteria 941463
134 Ga0207427_100100 3300025231 Bacteria 121264
135 Ga0207427_100194 3300025231 Bacteria 58375
136 Ga0209437_100059 3300025233 Bacteria 355048
137 Ga0209437_100121 3300025233 Bacteria 202531
138 Ga0209258_100034 3300025242 Bacteria 437372
139 Ga0209258_100584 3300025242 Bacteria 30530
140 Ga0207425_1000013 3300025245 Bacteria 497384
141 Ga0207425_1000371 3300025245 Bacteria 30946
142 Ga0209646_1001749 3300025246 Bacteria 5480
143 Ga0209646_1002605 3300025246 Bacteria 3889
144 Ga0209026_1001373 3300025250 Bacteria 10867
145 Ga0209148_1000001 3300025254 Bacteria 2545271
146 Ga0209759_1001936 3300025256 Bacteria 10080
147 Ga0209759_1005307 3300025256 Bacteria 4554
148 Ga0209129_1000102 3300025258 Bacteria 161712
149 Ga0209129_1004293 3300025258 Bacteria 5663
150 Ga0209233_1000002 3300025261 Bacteria 2501366
151 Ga0209233_1000112 3300025261 Bacteria 258251
152 Ga0209565_1000035 3300025263 Bacteria 298125
153 Ga0209565_1000881 3300025263 Bacteria 16505
154 Ga0209565_1003091 3300025263 Bacteria 5588
155 Ga0209565_1007104 3300025263 Bacteria 3057
156 Ga0209565_1013006 3300025263 Bacteria 1963
157 Ga0209455_1000054 3300025272 Bacteria 358936
158 Ga0209673_1000006 3300025273 Bacteria 650600
159 Ga0209673_1049331 3300025273 Bacteria 1126
160 Ga0209130_1000149 3300025284 Bacteria 108821
161 Ga0209130_1001115 3300025284 Bacteria 19753
162 Ga0209130_1002691 3300025284 Bacteria 8466
163 Ga0209675_1000005 3300025291 Bacteria 849192
164 Ga0209675_1000709 3300025291 Bacteria 22778
165 Ga0209675_1001028 3300025291 Bacteria 17414
166 Ga0209676_1000207 3300025292 Bacteria 130882
167 Ga0209676_1000233 3300025292 Bacteria 120247
168 Ga0209564_1000088 3300025295 Bacteria 250268
169 Ga0209564_1000902 3300025295 Bacteria 38919
170 Ga0209564_1004909 3300025295 Bacteria 7922
171 Ga0209758_1000031 3300025297 Bacteria 497252
172 Ga0209050_1000056 3300025298 Bacteria 338703
173 Ga0209050_1000430 3300025298 Bacteria 77008
174 Ga0209050_1000624 3300025298 Bacteria 55344
175 Ga0209050_1001488 3300025298 Bacteria 24908
176 Ga0209050_1005206 3300025298 Bacteria 8315
177 Ga0209256_1000035 3300025299 Bacteria 386754
178 Ga0209256_1000141 3300025299 Bacteria 152280
179 Ga0209256_1000560 3300025299 Bacteria 53201
180 Ga0209256_1003306 3300025299 Bacteria 11473
181 Ga0209256_1004338 3300025299 Bacteria 9006
182 Ga0209256_1005324 3300025299 Bacteria 7482
183 Ga0209256_1010201 3300025299 Bacteria 3972
184 Ga0207426_1007971 3300025302 Bacteria 4355
185 Ga0207426_1009541 3300025302 Bacteria 3830
186 Ga0209051_1003749 3300025303 Bacteria 9771
187 Ga0209051_1009925 3300025303 Bacteria 4858
188 Ga0209257_1000157 3300025304 Bacteria 181004
189 Ga0209257_1000265 3300025304 Bacteria 120247
190 Ga0209257_1008031 3300025304 Bacteria 6148
191 Ga0209257_1025972 3300025304 Bacteria 1987
192 Ga0207710_10000333 3300025900 Bacteria 35381
193 Ga0207710_10025590 3300025900 Bacteria 2547
194 Ga0207647_10039378 3300025904 Bacteria 2982
195 Ga0207699_10167168 3300025906 Bacteria 1469
196 Ga0207705_10017770 3300025909 Bacteria 5086
197 Ga0207695_10003231 3300025913 Bacteria 23190
198 Ga0207695_10049844 3300025913 Bacteria 4409
199 Ga0207695_10058513 3300025913 Bacteria 4000
200 Ga0207694_10210496 3300025924 Bacteria 1584
201 Ga0207659_10627681 3300025926 Bacteria 917
202 Ga0207664_10000102 3300025929 Bacteria 77855
203 Ga0207644_10019276 3300025931 Bacteria 4625
204 Ga0207690_10001850 3300025932 Bacteria 13005
205 Ga0207706_10018677 3300025933 Bacteria 6239
206 Ga0207711_10317473 3300025941 Bacteria 1439
207 Ga0207711_10335347 3300025941 Unclassified 1399
208 Ga0207667_10025499 3300025949 Bacteria 6469
209 Ga0207668_10008796 3300025972 Bacteria 6034
210 Ga0207668_10194596 3300025972 Bacteria 1610
211 Ga0207658_10002111 3300025986 Bacteria 14799
212 Ga0207703_10004984 3300026035 Bacteria 10776
213 Ga0207702_10074029 3300026078 Bacteria 2938
214 Ga0209282_1000003 3300027666 Bacteria 856377
215 Ga0265354_1000406 3300028016 Bacteria 7575
216 Ga0268266_10005072 3300028379 Bacteria 12422
217 Ga0268266_10012137 3300028379 Bacteria 7456
218 Ga0268265_10008772 3300028380 Bacteria 6832
219 Ga0268264_10164825 3300028381 Bacteria 2000
220 Ga0265338_10030476 3300028800 Bacteria 5313
221 Ga0307511_10000077 3300030521 Bacteria 82357
222 Ga0307511_10064112 3300030521 Bacteria 2767
223 Ga0265327_10001259 3300031251 Bacteria 33543
224 Ga0265316_10063684 3300031344 Bacteria 2858
225 Ga0307408_100001475 3300031548 Bacteria 17461
226 Ga0307408_100028124 3300031548 Bacteria 3882
227 Ga0307408_100036627 3300031548 Bacteria 3450
228 Ga0265342_10033005 3300031712 Bacteria 3187
229 Ga0307516_10003240 3300031730 Bacteria 21117
230 Ga0307412_10001033 3300031911 Bacteria 15898
231 Ga0307510_10000009 3300033180 Bacteria 409702
232 Ga0307510_10026241 3300033180 Bacteria 6702
233 Ga0373936_0001755 3300035113 Bacteria 7956
234 Ga0373936_0035093 3300035113 Unclassified 1996
235 Ga0395900_0046285 3300037418 Bacteria 4480
236 Ga0395905_0205113 3300037471 Bacteria 1848
237 Ga0436364_1244178 3300037853 Bacteria 1586
238 Ga0395901_0000413 3300038443 Bacteria 50350
239 Ga0395901_0068071 3300038443 Bacteria 3709
240 Ga0395901_0099093 3300038443 Bacteria 3056
241 Ga0395901_0112009 3300038443 Bacteria 2866
242 Ga0436365_0365417 3300039437 Bacteria 1545
243 Ga0436365_1284784 3300039437 Bacteria 2323
244 Ga0436361_0505866 3300039447 Bacteria 12664
245 Ga0439436_0000004 3300041404 Bacteria 175137
246 Ga0439465_0001164 3300041413 Bacteria 8448
247 Ga0451793_1539854 3300041452 Bacteria 2342
248 Ga0439445_0013144 3300042004 Bacteria 2001
249 Ga0450908_000029 3300042184 Bacteria 32225
250 Ga0439459_0008636 3300042438 Bacteria 1746
251 Ga0451577_0005793 3300042876 Bacteria 12520
252 Ga0466966_0095183 3300044684 Bacteria 1845
253 Ga0466961_0150741 3300044693 Bacteria 1452
254 Ga0466968_0007387 3300044735 Bacteria 4177
255 Ga0466959_0000553 3300045049 Bacteria 21758
256 Ga0466959_0077927 3300045049 Bacteria 2391
257 Ga0466967_0068620 3300045976 Bacteria 3167
258 Ga0495617_000024 3300046452 Bacteria 174402
259 Ga0495638_0000060 3300046460 Bacteria 190580
260 Ga0495638_0080614 3300046460 Bacteria 1977
261 Ga0495638_0170450 3300046460 Bacteria 1249
262 Ga0495638_0250549 3300046460 Bacteria 976
263 Ga0495650_0026259 3300046471 Bacteria 2712
264 Ga0495584_0001718 3300046491 Bacteria 12800
265 Ga0495584_0023792 3300046491 Bacteria 3105
266 Ga0495585_0000143 3300046492 Bacteria 78365
267 Ga0495585_0000360 3300046492 Bacteria 44156
268 Ga0495607_0012186 3300046501 Bacteria 5684
269 Ga0495583_0007933 3300046506 Bacteria 6573
270 Ga0495606_0000136 3300046507 Bacteria 125611
271 Ga0495606_0001286 3300046507 Bacteria 34779
272 Ga0495606_0126732 3300046507 Bacteria 1522
273 Ga0495606_0166288 3300046507 Bacteria 1283
274 Ga0495610_0000542 3300046512 Bacteria 37767
275 Ga0495616_0000003 3300046513 Bacteria 290178
276 Ga0495616_0004267 3300046513 Bacteria 9035
277 Ga0495620_0000102 3300046515 Bacteria 68028
278 Ga0495631_0000022 3300046518 Bacteria 91377
279 Ga0495632_0000020 3300046519 Bacteria 210606
280 Ga0495632_0033031 3300046519 Bacteria 2660
281 Ga0495632_0149379 3300046519 Unclassified 1081
282 Ga0495648_0000184 3300046524 Bacteria 72048
283 Ga0495648_0001155 3300046524 Bacteria 26690
284 Ga0495642_0017187 3300046528 Bacteria 2825
285 Ga0495609_0000173 3300046538 Bacteria 66125
286 Ga0495597_0017014 3300046542 Bacteria 3428
287 Ga0495597_0105909 3300046542 Bacteria 1182
288 Ga0495633_0217859 3300046558 Bacteria 874
289 Ga0495668_0000458 3300046616 Bacteria 52227
290 Ga0495668_0000511 3300046616 Bacteria 48358
291 Ga0495668_0007758 3300046616 Bacteria 6809
292 Ga0495668_0100119 3300046616 Bacteria 1585
293 Ga0495625_0000578 3300046660 Bacteria 53326
294 Ga0495625_0027414 3300046660 Bacteria 4289
295 Ga0495659_0002366 3300046664 Bacteria 6089
296 Ga0495659_0004798 3300046664 Bacteria 4255
297 Ga0495661_0002830 3300046665 Bacteria 13138
298 Ga0495661_0082212 3300046665 Bacteria 1854
299 Ga0495669_0000485 3300046684 Bacteria 18399
300 Ga0495670_0001364 3300046691 Bacteria 11929
301 Ga0495649_0011172 3300046694 Bacteria 5280
302 Ga0495649_0059228 3300046694 Bacteria 2062
303 Ga0495660_0000052 3300046810 Bacteria 137821
304 Ga0495683_0000699 3300047323 Bacteria 24522
305 Ga0495677_0068125 3300047445 Bacteria 1324
306 Ga0495679_016244 3300047446 Bacteria 2697
307 Ga0495685_000552 3300047447 Bacteria 11584
308 Ga0495673_0000036 3300047469 Bacteria 311035
309 Ga0495681_0005927 3300047470 Bacteria 8107
310 Ga0495681_0077950 3300047470 Bacteria 1486
311 Ga0495684_0136731 3300047471 Bacteria 1839
312 Ga0495686_0000180 3300047472 Bacteria 121204
313 Ga0495686_0007095 3300047472 Bacteria 8445
314 Ga0495686_0034773 3300047472 Bacteria 3242
315 Ga0495686_0144822 3300047472 Bacteria 1399
316 Ga0496100_0661585 3300048903 Bacteria 814
317 Ga0496102_0003223 3300048905 Bacteria 13847
318 Ga0496102_0095069 3300048905 Bacteria 2762
319 Ga0496103_0145258 3300048906 Bacteria 1518
320 Ga0496106_0000904 3300048909 Bacteria 21668
321 Ga0496108_0074215 3300048911 Bacteria 2872
322 Ga0496112_0071282 3300048915 Bacteria 3435
323 Ga0496112_0198504 3300048915 Bacteria 1966
324 Ga0496115_0303533 3300048918 Bacteria 1308
325 Ga0496115_0454646 3300048918 Bacteria 1034
326 Ga0496117_0000151 3300048920 Bacteria 148304
327 Ga0496118_0000105 3300048921 Bacteria 156739
328 Ga0496118_0160672 3300048921 Bacteria 1390
329 Ga0496119_0002419 3300048922 Bacteria 20492
330 Ga0496119_0003839 3300048922 Bacteria 15350
331 Ga0496119_0027477 3300048922 Bacteria 3909
332 Ga0496120_0001210 3300048923 Bacteria 32605
333 Ga0496121_0000782 3300048924 Bacteria 58365
334 Ga0496121_0001227 3300048924 Bacteria 44616
335 Ga0496121_0003041 3300048924 Bacteria 24337
336 Ga0496121_0036714 3300048924 Bacteria 4362
337 Ga0496121_0070452 3300048924 Bacteria 2816
338 Ga0496124_0056351 3300048927 Bacteria 3315
339 Ga0496124_0170273 3300048927 Bacteria 1688
340 Ga0496125_0018647 3300048928 Bacteria 6584
341 Ga0496125_0019132 3300048928 Bacteria 6473
342 Ga0495678_000400 3300049459 Bacteria 43762
343 Ga0495682_0002506 3300049460 Bacteria 8684
344 Ga0501032_0076039 3300049569 Bacteria 2236
345 Ga0501034_0095430 3300049571 Bacteria 2971
346 Ga0501034_0154755 3300049571 Bacteria 2267
347 Ga0501038_0114734 3300049574 Bacteria 2227
348 Ga0501043_0146403 3300049579 Bacteria 1849
349 Ga0501043_0532676 3300049579 Bacteria 874
350 Ga0501046_0012790 3300049580 Bacteria 7139
351 Ga0501046_0186079 3300049580 Bacteria 1551
352 Ga0501047_0036131 3300049581 Bacteria 4773
353 Ga0501047_0308415 3300049581 Bacteria 1424
354 Ga0501263_003419 3300049760 Bacteria 1694
355 Ga0501279_002123 3300049775 Bacteria 2618
356 Ga0501279_013208 3300049775 Bacteria 1129
357 Ga0501035_0003253 3300049822 Bacteria 15565
358 Ga0501035_0386526 3300049822 Bacteria 1166
359 Ga0501035_0484364 3300049822 Bacteria 1020
360 nmdc:mga06r32_113336_c1 3300050510 Bacteria 2669
361 nmdc:mga0n895_295374_c1 3300050512 Bacteria 1643
362 nmdc:mga0n895_37_c1 3300050512 Bacteria 77167
363 nmdc:mga0n895_721935_c1 3300050512 Bacteria 991
364 nmdc:mga0rr50_14_c1 3300050513 Bacteria 196574
365 nmdc:mga0rr50_89874_c1 3300050513 Bacteria 2389
366 nmdc:mga08x19_63156_c1 3300050514 Bacteria 2403
367 nmdc:mga08x19_925_c1 3300050514 Bacteria 18506
368 Ga0500644_0000116 3300053088 Bacteria 49989
369 Ga0500572_000257 3300053111 Bacteria 19086
370 Ga0500594_0000016 3300053118 Bacteria 64151
371 Ga0500608_000063 3300053122 Bacteria 46532
372 Ga0500617_075677 3300053124 Bacteria 1467
373 Ga0500559_0002976 3300053136 Bacteria 8513
374 Ga0500622_0003151 3300053156 Bacteria 11293
375 Ga0500622_0037253 3300053156 Bacteria 2541
376 Ga0500645_001886 3300053730 Bacteria 10017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046542 Ga0495597_0017014 Ga0495597_0017014_2464_3246 218
2 3300048918 Ga0496115_0303533 Ga0496115_0303533_605_1276 222
3 3300046664 Ga0495659_0004798 Ga0495659_0004798_3361_4125 229
4 3300005445 Ga0070708_100144039 Ga0070708_1001440392 230
5 3300005468 Ga0070707_100191145 Ga0070707_1001911452 230
6 3300050512 nmdc:mga0n895_721935_c1 nmdc:mga0n895_721935_c1_38_730 230
7 3300025299 Ga0209256_1005324 Ga0209256_10053243 232
8 3300046491 Ga0495584_0023792 Ga0495584_0023792_1559_2338 232
9 3300046513 Ga0495616_0000003 Ga0495616_0000003_93010_93789 234
10 3300046519 Ga0495632_0033031 Ga0495632_0033031_816_1595 234
11 3300046492 Ga0495585_0000360 Ga0495585_0000360_31268_32047 235
12 3300047323 Ga0495683_0000699 Ga0495683_0000699_14072_14851 235
13 3300015265 Ga0182005_1048102 Ga0182005_10481022 236
14 3300046471 Ga0495650_0026259 Ga0495650_0026259_877_1656 236
15 3300046507 Ga0495606_0000136 Ga0495606_0000136_88228_89007 236
16 3300046558 Ga0495633_0217859 Ga0495633_0217859_54_836 236
17 3300047472 Ga0495686_0000180 Ga0495686_0000180_18922_19701 236
18 3300048909 Ga0496106_0000904 Ga0496106_0000904_9694_10473 236
19 3300048924 Ga0496121_0001227 Ga0496121_0001227_23241_24020 236
20 3300046542 Ga0495597_0105909 Ga0495597_0105909_25_828 237
21 3300048903 Ga0496100_0661585 Ga0496100_0661585_53_775 237
22 3300048905 Ga0496102_0095069 Ga0496102_0095069_2022_2744 237
23 3300048915 Ga0496112_0071282 Ga0496112_0071282_2574_3296 237
24 3300005262 Ga0065165_1000201 Ga0065165_100020115 238
25 3300021361 Ga0213872_10002790 Ga0213872_1000279010 238
26 3300025302 Ga0207426_1007971 Ga0207426_10079713 238
27 3300039447 Ga0436361_0505866 Ga0436361_0505866_11164_11997 238
28 3300003759 Ga0055525_1000004 Ga0055525_1000004559 240
29 3300025230 Ga0209563_100013 Ga0209563_100013559 240
30 3300046519 Ga0495632_0149379 Ga0495632_0149379_209_934 240
31 3300009098 Ga0105245_10023887 Ga0105245_100238874 241
32 3300009174 Ga0105241_10202588 Ga0105241_102025882 241
33 3300009176 Ga0105242_10146814 Ga0105242_101468142 241
34 3300013297 Ga0157378_10002118 Ga0157378_100021187 241
35 3300046460 Ga0495638_0000060 Ga0495638_0000060_99047_99823 241
36 3300053111 Ga0500572_000257 Ga0500572_000257_17310_18098 241
37 3300053124 Ga0500617_075677 Ga0500617_075677_144_890 241
38 3300010159 Ga0099796_10021120 Ga0099796_100211202 242
39 3300003781 Ga0055536_1000678 Ga0055536_100067815 243
40 3300003791 Ga0055530_10002649 Ga0055530_1000264913 243
41 3300009093 Ga0105240_10004572 Ga0105240_100045729 243
42 3300015265 Ga0182005_1010571 Ga0182005_10105711 243
43 3300025292 Ga0209676_1000207 Ga0209676_100020736 243
44 3300025298 Ga0209050_1000056 Ga0209050_100005636 243
45 3300025303 Ga0209051_1003749 Ga0209051_10037491 243
46 3300025304 Ga0209257_1008031 Ga0209257_10080313 243
47 3300025913 Ga0207695_10003231 Ga0207695_1000323115 243
48 3300041452 Ga0451793_1539854 Ga0451793_1539854_102_878 243
49 3300025906 Ga0207699_10167168 Ga0207699_101671681 244
50 iso_pu_bacteria 2643221554 2643789952 245
51 iso_pu_bacteria 2643221638 2644214320 245
52 3300003781 Ga0055536_1000767 Ga0055536_100076715 246
53 3300003791 Ga0055530_10009888 Ga0055530_100098881 246
54 3300003794 Ga0055531_10001084 Ga0055531_1000108415 246
55 3300025292 Ga0209676_1000233 Ga0209676_100023394 246
56 3300025298 Ga0209050_1000624 Ga0209050_100062445 246
57 3300025304 Ga0209257_1000265 Ga0209257_100026594 246
58 3300048921 Ga0496118_0160672 Ga0496118_0160672_479_1270 246
59 3300048927 Ga0496124_0170273 Ga0496124_0170273_29_820 246
60 3300053156 Ga0500622_0003151 Ga0500622_0003151_5540_6325 246
61 3300003323 rootH1_10176962 rootH1_101769622 247
62 3300005471 Ga0070698_100056745 Ga0070698_1000567453 247
63 3300009545 Ga0105237_10518760 Ga0105237_105187602 247
64 3300033180 Ga0307510_10026241 Ga0307510_100262414 247
65 iso_pu_bacteria 2582581279 2585147450 247
66 3300003775 Ga0055524_1000022 Ga0055524_1000022111 248
67 3300005530 Ga0070679_100591190 Ga0070679_1005911901 248
68 3300005548 Ga0070665_100063418 Ga0070665_1000634184 248
69 3300005615 Ga0070702_100224920 Ga0070702_1002249201 248
70 3300005844 Ga0068862_100010772 Ga0068862_1000107725 248
71 3300009093 Ga0105240_10064478 Ga0105240_100644782 248
72 3300009551 Ga0105238_10113652 Ga0105238_101136522 248
73 3300009553 Ga0105249_10118921 Ga0105249_101189211 248
74 3300025299 Ga0209256_1000035 Ga0209256_1000035111 248
75 3300025913 Ga0207695_10058513 Ga0207695_100585135 248
76 3300025924 Ga0207694_10210496 Ga0207694_102104963 248
77 3300028379 Ga0268266_10005072 Ga0268266_100050726 248
78 3300028380 Ga0268265_10008772 Ga0268265_100087725 248
79 3300033180 Ga0307510_10000009 Ga0307510_10000009115 248
80 3300046507 Ga0495606_0126732 Ga0495606_0126732_34_816 248
81 3300046694 Ga0495649_0059228 Ga0495649_0059228_191_949 248
82 3300048905 Ga0496102_0003223 Ga0496102_0003223_9767_10549 248
83 3300048906 Ga0496103_0145258 Ga0496103_0145258_174_956 248
84 3300048920 Ga0496117_0000151 Ga0496117_0000151_42249_43031 248
85 3300048921 Ga0496118_0000105 Ga0496118_0000105_123982_124764 248
86 3300048922 Ga0496119_0002419 Ga0496119_0002419_11485_12267 248
87 3300048922 Ga0496119_0003839 Ga0496119_0003839_6769_7548 248
88 3300048923 Ga0496120_0001210 Ga0496120_0001210_7803_8582 248
89 3300048924 Ga0496121_0070452 Ga0496121_0070452_1659_2441 248
90 3300048928 Ga0496125_0018647 Ga0496125_0018647_5426_6208 248
91 3300002705 JGI25156J39149_1005586 JGI25156J39149_10055863 249
92 3300002737 JGI25162J39368_1001784 JGI25162J39368_10017846 249
93 3300002741 JGI25157J39369_1001283 JGI25157J39369_10012836 249
94 3300002741 JGI25157J39369_1002282 JGI25157J39369_10022825 249
95 3300002771 JGI25163J39215_1001844 JGI25163J39215_10018442 249
96 3300002772 JGI25164J39214_1000878 JGI25164J39214_10008786 249
97 3300002774 JGI25150J39212_1000581 JGI25150J39212_100058110 249
98 3300002774 JGI25150J39212_1004366 JGI25150J39212_10043662 249
99 3300002987 JGI25159J45721_1000536 JGI25159J45721_100053626 249
100 3300002987 JGI25159J45721_1001543 JGI25159J45721_10015435 249
101 3300003214 JGI25165J46597_1001659 JGI25165J46597_10016596 249
102 3300003215 JGI25153J46596_10006703 JGI25153J46596_100067032 249
103 3300003322 rootL2_10052119 rootL2_100521192 249
104 3300003354 JGI25160J50197_1001804 JGI25160J50197_10018048 249
105 3300003374 JGI25161J50226_1000545 JGI25161J50226_10005454 249
106 3300003374 JGI25161J50226_1000554 JGI25161J50226_10005548 249
107 3300003761 Ga0055535_1001671 Ga0055535_10016716 249
108 3300003762 Ga0055542_1001621 Ga0055542_10016216 249
109 3300003763 Ga0055529_1001205 Ga0055529_10012056 249
110 3300003771 Ga0055526_1001198 Ga0055526_10011989 249
111 3300003771 Ga0055526_1008545 Ga0055526_10085455 249
112 3300003773 Ga0055537_1002331 Ga0055537_10023317 249
113 3300003773 Ga0055537_1020205 Ga0055537_10202051 249
114 3300003775 Ga0055524_1000587 Ga0055524_100058714 249
115 3300003775 Ga0055524_1002230 Ga0055524_10022308 249
116 3300003775 Ga0055524_1003954 Ga0055524_10039548 249
117 3300003784 Ga0055534_1001613 Ga0055534_10016137 249
118 3300003790 Ga0055528_1005260 Ga0055528_10052602 249
119 3300003791 Ga0055530_10001297 Ga0055530_100012975 249
120 3300003791 Ga0055530_10004384 Ga0055530_100043845 249
121 3300003791 Ga0055530_10017995 Ga0055530_100179953 249
122 3300003794 Ga0055531_10011115 Ga0055531_100111155 249
123 3300003794 Ga0055531_10027583 Ga0055531_100275832 249
124 3300004625 Ga0055543_1000692 Ga0055543_10006925 249
125 3300005262 Ga0065165_1009400 Ga0065165_10094005 249
126 3300005548 Ga0070665_100016383 Ga0070665_1000163833 249
127 3300006948 Ga0099826_10000006 Ga0099826_10000006301 249
128 3300014968 Ga0157379_10080973 Ga0157379_100809734 249
129 3300025206 Ga0209435_103648 Ga0209435_1036482 249
130 3300025207 Ga0209760_100584 Ga0209760_1005844 249
131 3300025208 Ga0209436_100123 Ga0209436_1001239 249
132 3300025208 Ga0209436_100307 Ga0209436_10030721 249
133 3300025208 Ga0209436_100548 Ga0209436_1005489 249
134 3300025224 Ga0209784_100094 Ga0209784_10009492 249
135 3300025228 Ga0209672_107084 Ga0209672_1070842 249
136 3300025231 Ga0207427_100100 Ga0207427_10010092 249
137 3300025233 Ga0209437_100059 Ga0209437_100059292 249
138 3300025242 Ga0209258_100034 Ga0209258_100034179 249
139 3300025245 Ga0207425_1000013 Ga0207425_1000013128 249
140 3300025245 Ga0207425_1000371 Ga0207425_100037113 249
141 3300025246 Ga0209646_1001749 Ga0209646_10017494 249
142 3300025250 Ga0209026_1001373 Ga0209026_10013736 249
143 3300025254 Ga0209148_1000001 Ga0209148_1000001525 249
144 3300025256 Ga0209759_1001936 Ga0209759_10019364 249
145 3300025258 Ga0209129_1000102 Ga0209129_1000102142 249
146 3300025258 Ga0209129_1004293 Ga0209129_10042932 249
147 3300025261 Ga0209233_1000002 Ga0209233_10000021706 249
148 3300025263 Ga0209565_1000881 Ga0209565_10008819 249
149 3300025263 Ga0209565_1003091 Ga0209565_10030916 249
150 3300025263 Ga0209565_1007104 Ga0209565_10071042 249
151 3300025263 Ga0209565_1013006 Ga0209565_10130062 249
152 3300025272 Ga0209455_1000054 Ga0209455_1000054148 249
153 3300025273 Ga0209673_1049331 Ga0209673_10493312 249
154 3300025284 Ga0209130_1001115 Ga0209130_100111526 249
155 3300025284 Ga0209130_1002691 Ga0209130_10026919 249
156 3300025291 Ga0209675_1000709 Ga0209675_100070921 249
157 3300025291 Ga0209675_1001028 Ga0209675_100102810 249
158 3300025295 Ga0209564_1000088 Ga0209564_100008818 249
159 3300025295 Ga0209564_1004909 Ga0209564_10049093 249
160 3300025297 Ga0209758_1000031 Ga0209758_1000031336 249
161 3300025298 Ga0209050_1000430 Ga0209050_100043015 249
162 3300025298 Ga0209050_1001488 Ga0209050_100148822 249
163 3300025298 Ga0209050_1005206 Ga0209050_10052062 249
164 3300025299 Ga0209256_1000560 Ga0209256_100056033 249
165 3300025299 Ga0209256_1003306 Ga0209256_10033065 249
166 3300025299 Ga0209256_1004338 Ga0209256_10043384 249
167 3300025302 Ga0207426_1009541 Ga0207426_10095413 249
168 3300025303 Ga0209051_1009925 Ga0209051_10099256 249
169 3300025304 Ga0209257_1000157 Ga0209257_100015752 249
170 3300025304 Ga0209257_1025972 Ga0209257_10259722 249
171 3300027666 Ga0209282_1000003 Ga0209282_100000374 249
172 3300028379 Ga0268266_10012137 Ga0268266_100121373 249
173 3300030521 Ga0307511_10000077 Ga0307511_1000007741 249
174 3300031548 Ga0307408_100001475 Ga0307408_10000147520 249
175 3300031548 Ga0307408_100028124 Ga0307408_1000281242 249
176 3300031548 Ga0307408_100036627 Ga0307408_1000366274 249
177 3300037471 Ga0395905_0205113 Ga0395905_0205113_881_1645 249
178 3300046460 Ga0495638_0080614 Ga0495638_0080614_685_1482 249
179 3300046491 Ga0495584_0001718 Ga0495584_0001718_7144_7941 249
180 3300046501 Ga0495607_0012186 Ga0495607_0012186_2910_3707 249
181 3300046506 Ga0495583_0007933 Ga0495583_0007933_917_1714 249
182 3300046513 Ga0495616_0004267 Ga0495616_0004267_5479_6276 249
183 3300046524 Ga0495648_0000184 Ga0495648_0000184_35286_36068 249
184 3300046528 Ga0495642_0017187 Ga0495642_0017187_570_1367 249
185 3300046538 Ga0495609_0000173 Ga0495609_0000173_50971_51768 249
186 3300046660 Ga0495625_0000578 Ga0495625_0000578_30383_31180 249
187 3300046664 Ga0495659_0002366 Ga0495659_0002366_2383_3180 249
188 3300046665 Ga0495661_0082212 Ga0495661_0082212_786_1583 249
189 3300046684 Ga0495669_0000485 Ga0495669_0000485_6973_7770 249
190 3300046694 Ga0495649_0011172 Ga0495649_0011172_2895_3692 249
191 3300047445 Ga0495677_0068125 Ga0495677_0068125_397_1194 249
192 3300047446 Ga0495679_016244 Ga0495679_016244_384_1181 249
193 3300047447 Ga0495685_000552 Ga0495685_000552_7117_7914 249
194 3300047470 Ga0495681_0005927 Ga0495681_0005927_6155_6952 249
195 3300047471 Ga0495684_0136731 Ga0495684_0136731_17_772 249
196 3300049459 Ga0495678_000400 Ga0495678_000400_19214_19996 249
197 3300049760 Ga0501263_003419 Ga0501263_003419_606_1370 249
198 3300049775 Ga0501279_002123 Ga0501279_002123_245_1009 249
199 3300049775 Ga0501279_013208 Ga0501279_013208_324_1088 249
200 3300053088 Ga0500644_0000116 Ga0500644_0000116_37044_37826 249
201 3300053118 Ga0500594_0000016 Ga0500594_0000016_45107_45889 249
202 iso_pu_bacteria 2718218334 2721028902 249
203 iso_pu_bacteria 2734482264 2735835511 249
204 3300003771 Ga0055526_1003637 Ga0055526_100363713 250
205 3300003773 Ga0055537_1000040 Ga0055537_100004064 250
206 3300003784 Ga0055534_1000396 Ga0055534_100039633 250
207 3300003790 Ga0055528_1000181 Ga0055528_100018127 250
208 3300005536 Ga0070697_100255492 Ga0070697_1002554922 250
209 3300006871 Ga0075434_100018566 Ga0075434_1000185667 250
210 3300007076 Ga0075435_100000017 Ga0075435_10000001793 250
211 3300009177 Ga0105248_10373721 Ga0105248_103737212 250
212 3300025263 Ga0209565_1000035 Ga0209565_100003532 250
213 3300025273 Ga0209673_1000006 Ga0209673_1000006122 250
214 3300025291 Ga0209675_1000005 Ga0209675_1000005650 250
215 3300025295 Ga0209564_1000902 Ga0209564_100090216 250
216 3300025299 Ga0209256_1000141 Ga0209256_1000141125 250
217 3300042438 Ga0439459_0008636 Ga0439459_0008636_721_1491 250
218 3300047472 Ga0495686_0007095 Ga0495686_0007095_2398_3174 250
219 3300050512 nmdc:mga0n895_295374_c1 nmdc:mga0n895_295374_c1_365_1156 250
220 3300050512 nmdc:mga0n895_37_c1 nmdc:mga0n895_37_c1_75257_76048 250
221 3300050513 nmdc:mga0rr50_14_c1 nmdc:mga0rr50_14_c1_51439_52230 250
222 3300050513 nmdc:mga0rr50_89874_c1 nmdc:mga0rr50_89874_c1_869_1660 250
223 3300050514 nmdc:mga08x19_63156_c1 nmdc:mga08x19_63156_c1_1356_2147 250
224 3300050514 nmdc:mga08x19_925_c1 nmdc:mga08x19_925_c1_4556_5347 250
225 3300002987 JGI25159J45721_1005094 JGI25159J45721_10050942 251
226 3300005262 Ga0065165_1000321 Ga0065165_100032149 251
227 3300009092 Ga0105250_10017037 Ga0105250_100170375 251
228 3300009177 Ga0105248_10018666 Ga0105248_100186664 251
229 3300009177 Ga0105248_10061659 Ga0105248_100616593 251
230 3300009553 Ga0105249_10029334 Ga0105249_100293343 251
231 3300013306 Ga0163162_10045642 Ga0163162_100456422 251
232 3300015690 Ga0183363_1010 Ga0183363_101057 251
233 3300025225 Ga0209566_102564 Ga0209566_1025642 251
234 3300025242 Ga0209258_100584 Ga0209258_10058426 251
235 3300025246 Ga0209646_1002605 Ga0209646_10026053 251
236 3300025256 Ga0209759_1005307 Ga0209759_10053072 251
237 3300025284 Ga0209130_1000149 Ga0209130_100014924 251
238 3300025941 Ga0207711_10317473 Ga0207711_103174732 251
239 3300025972 Ga0207668_10008796 Ga0207668_100087963 251
240 3300028381 Ga0268264_10164825 Ga0268264_101648252 251
241 3300035113 Ga0373936_0035093 Ga0373936_0035093_211_1011 251
242 3300039437 Ga0436365_0365417 Ga0436365_0365417_566_1339 251
243 3300045976 Ga0466967_0068620 Ga0466967_0068620_163_933 251
244 3300046616 Ga0495668_0000458 Ga0495668_0000458_12026_12805 251
245 3300048911 Ga0496108_0074215 Ga0496108_0074215_938_1729 251
246 3300048915 Ga0496112_0198504 Ga0496112_0198504_506_1297 251
247 3300048924 Ga0496121_0003041 Ga0496121_0003041_17310_18101 251
248 3300048928 Ga0496125_0019132 Ga0496125_0019132_716_1507 251
249 3300009093 Ga0105240_10039934 Ga0105240_100399346 252
250 3300025913 Ga0207695_10049844 Ga0207695_100498442 252
251 3300042876 Ga0451577_0005793 Ga0451577_0005793_6056_6865 252
252 3300044684 Ga0466966_0095183 Ga0466966_0095183_202_969 252
253 3300044693 Ga0466961_0150741 Ga0466961_0150741_524_1291 252
254 3300045049 Ga0466959_0000553 Ga0466959_0000553_2492_3271 252
255 3300045049 Ga0466959_0077927 Ga0466959_0077927_231_998 252
256 3300046616 Ga0495668_0000511 Ga0495668_0000511_11752_12525 252
257 iso_pu_bacteria 2643221685 2644478636 252
258 iso_pu_bacteria 2884960567 2884962159 252
259 3300005344 Ga0070661_100064794 Ga0070661_1000647941 253
260 3300005353 Ga0070669_100182427 Ga0070669_1001824272 253
261 3300005457 Ga0070662_100640515 Ga0070662_1006405151 253
262 3300006847 Ga0075431_100123587 Ga0075431_1001235872 253
263 3300014325 Ga0163163_10026043 Ga0163163_100260434 253
264 3300014968 Ga0157379_10051360 Ga0157379_100513602 253
265 3300015261 Ga0182006_1000066 Ga0182006_100006631 253
266 3300015265 Ga0182005_1071020 Ga0182005_10710201 253
267 3300017792 Ga0163161_10529878 Ga0163161_105298781 253
268 3300025900 Ga0207710_10025590 Ga0207710_100255902 253
269 3300025926 Ga0207659_10627681 Ga0207659_106276811 253
270 3300025933 Ga0207706_10018677 Ga0207706_100186771 253
271 3300025972 Ga0207668_10194596 Ga0207668_101945962 253
272 3300046452 Ga0495617_000024 Ga0495617_000024_121309_122088 253
273 3300046460 Ga0495638_0250549 Ga0495638_0250549_20_799 253
274 3300046492 Ga0495585_0000143 Ga0495585_0000143_57958_58737 253
275 3300046507 Ga0495606_0001286 Ga0495606_0001286_33411_34190 253
276 3300046515 Ga0495620_0000102 Ga0495620_0000102_34872_35651 253
277 3300046518 Ga0495631_0000022 Ga0495631_0000022_19640_20419 253
278 3300046524 Ga0495648_0001155 Ga0495648_0001155_19894_20673 253
279 3300046616 Ga0495668_0007758 Ga0495668_0007758_5343_6122 253
280 3300046665 Ga0495661_0002830 Ga0495661_0002830_6284_7063 253
281 3300046810 Ga0495660_0000052 Ga0495660_0000052_47835_48614 253
282 3300047469 Ga0495673_0000036 Ga0495673_0000036_141428_142207 253
283 3300047470 Ga0495681_0077950 Ga0495681_0077950_550_1329 253
284 3300047472 Ga0495686_0034773 Ga0495686_0034773_17_796 253
285 3300047472 Ga0495686_0144822 Ga0495686_0144822_414_1193 253
286 3300048924 Ga0496121_0000782 Ga0496121_0000782_15214_15993 253
287 3300048924 Ga0496121_0036714 Ga0496121_0036714_3262_4041 253
288 3300049460 Ga0495682_0002506 Ga0495682_0002506_6067_6846 253
289 3300050510 nmdc:mga06r32_113336_c1 nmdc:mga06r32_113336_c1_951_1748 253
290 3300053122 Ga0500608_000063 Ga0500608_000063_11496_12284 253
291 3300053136 Ga0500559_0002976 Ga0500559_0002976_1687_2475 253
292 3300053730 Ga0500645_001886 Ga0500645_001886_3803_4582 253
293 iso_pu_bacteria 2537561836 2538833390 253
294 iso_pu_bacteria 2593339239 2595450707 253
295 iso_pu_bacteria 2643221562 2643831878 253
296 iso_pu_bacteria 2643221577 2643896613 253
297 iso_pu_bacteria 2857504554 2857508178 253
298 iso_pu_bacteria 2939611941 2939613895 253
299 3300005338 Ga0068868_100455813 Ga0068868_1004558131 254
300 3300005614 Ga0068856_100190065 Ga0068856_1001900651 254
301 3300006881 Ga0068865_100445080 Ga0068865_1004450801 254
302 3300014968 Ga0157379_10196895 Ga0157379_101968952 254
303 3300021384 Ga0213876_10179286 Ga0213876_101792861 254
304 3300030521 Ga0307511_10064112 Ga0307511_100641123 254
305 3300031730 Ga0307516_10003240 Ga0307516_100032408 254
306 3300035113 Ga0373936_0001755 Ga0373936_0001755_6517_7347 254
307 3300039437 Ga0436365_1284784 Ga0436365_1284784_111_902 254
308 3300048927 Ga0496124_0056351 Ga0496124_0056351_836_1618 254
309 3300049580 Ga0501046_0186079 Ga0501046_0186079_676_1452 254
310 3300049581 Ga0501047_0308415 Ga0501047_0308415_493_1269 254
311 3300049822 Ga0501035_0386526 Ga0501035_0386526_79_855 254
312 iso_pu_bacteria 2928531327 2928535816 254
313 3300002737 JGI25162J39368_1006425 JGI25162J39368_10064252 255
314 3300002772 JGI25164J39214_1000571 JGI25164J39214_10005719 255
315 3300003214 JGI25165J46597_1001141 JGI25165J46597_10011419 255
316 3300005355 Ga0070671_100004730 Ga0070671_1000047306 255
317 3300005367 Ga0070667_100018764 Ga0070667_1000187643 255
318 3300005457 Ga0070662_100432503 Ga0070662_1004325031 255
319 3300005535 Ga0070684_100323712 Ga0070684_1003237123 255
320 3300005841 Ga0068863_100009616 Ga0068863_1000096164 255
321 3300005842 Ga0068858_100002701 Ga0068858_1000027016 255
322 3300009101 Ga0105247_10000248 Ga0105247_1000024829 255
323 3300013307 Ga0157372_10179529 Ga0157372_101795293 255
324 3300014325 Ga0163163_10079919 Ga0163163_100799193 255
325 3300025231 Ga0207427_100194 Ga0207427_1001949 255
326 3300025233 Ga0209437_100121 Ga0209437_100121158 255
327 3300025261 Ga0209233_1000112 Ga0209233_1000112162 255
328 3300025299 Ga0209256_1010201 Ga0209256_10102014 255
329 3300025900 Ga0207710_10000333 Ga0207710_1000033315 255
330 3300025931 Ga0207644_10019276 Ga0207644_100192764 255
331 3300025941 Ga0207711_10335347 Ga0207711_103353472 255
332 3300025986 Ga0207658_10002111 Ga0207658_100021113 255
333 3300026035 Ga0207703_10004984 Ga0207703_100049846 255
334 3300031251 Ga0265327_10001259 Ga0265327_1000125927 255
335 3300038443 Ga0395901_0099093 Ga0395901_0099093_1097_1891 255
336 3300046460 Ga0495638_0170450 Ga0495638_0170450_266_1051 255
337 3300046616 Ga0495668_0100119 Ga0495668_0100119_64_849 255
338 3300046660 Ga0495625_0027414 Ga0495625_0027414_2148_2933 255
339 3300048918 Ga0496115_0454646 Ga0496115_0454646_11_826 255
340 3300049569 Ga0501032_0076039 Ga0501032_0076039_60_839 255
341 3300049571 Ga0501034_0095430 Ga0501034_0095430_42_821 255
342 3300049574 Ga0501038_0114734 Ga0501038_0114734_686_1459 255
343 3300049579 Ga0501043_0146403 Ga0501043_0146403_373_1146 255
344 3300049579 Ga0501043_0532676 Ga0501043_0532676_47_826 255
345 3300049822 Ga0501035_0003253 Ga0501035_0003253_931_1704 255
346 3300053156 Ga0500622_0037253 Ga0500622_0037253_346_1131 255
347 iso_pu_bacteria 2585428106 2587918207 255
348 iso_pu_bacteria 2643221640 2644224683 255
349 iso_pu_bacteria 2643221642 2644234382 255
350 iso_pu_bacteria 2919404418 2919407143 255
351 3300006028 Ga0070717_10065154 Ga0070717_100651544 256
352 3300009094 Ga0111539_10005216 Ga0111539_1000521615 256
353 3300009551 Ga0105238_10388326 Ga0105238_103883262 256
354 3300013104 Ga0157370_10090187 Ga0157370_100901872 256
355 3300015262 Ga0182007_10045991 Ga0182007_100459912 256
356 3300028016 Ga0265354_1000406 Ga0265354_10004062 256
357 3300031344 Ga0265316_10063684 Ga0265316_100636841 256
358 3300031712 Ga0265342_10033005 Ga0265342_100330051 256
359 3300037418 Ga0395900_0046285 Ga0395900_0046285_2527_3303 256
360 3300037853 Ga0436364_1244178 Ga0436364_1244178_631_1425 256
361 3300038443 Ga0395901_0000413 Ga0395901_0000413_45833_46609 256
362 3300042184 Ga0450908_000029 Ga0450908_000029_561_1331 256
363 3300046519 Ga0495632_0000020 Ga0495632_0000020_74497_75285 256
364 3300049571 Ga0501034_0154755 Ga0501034_0154755_874_1683 256
365 3300049580 Ga0501046_0012790 Ga0501046_0012790_80_862 256
366 3300049581 Ga0501047_0036131 Ga0501047_0036131_3211_4020 256
367 3300005435 Ga0070714_100048242 Ga0070714_1000482423 257
368 3300005458 Ga0070681_10110679 Ga0070681_101106791 257
369 3300005614 Ga0068856_100096166 Ga0068856_1000961662 257
370 3300013105 Ga0157369_10470185 Ga0157369_104701852 257
371 3300025904 Ga0207647_10039378 Ga0207647_100393782 257
372 3300025909 Ga0207705_10017770 Ga0207705_100177704 257
373 3300025929 Ga0207664_10000102 Ga0207664_100001022 257
374 3300025932 Ga0207690_10001850 Ga0207690_100018507 257
375 3300025949 Ga0207667_10025499 Ga0207667_100254994 257
376 3300026078 Ga0207702_10074029 Ga0207702_100740293 257
377 3300028800 Ga0265338_10030476 Ga0265338_100304761 257
378 3300038443 Ga0395901_0068071 Ga0395901_0068071_133_912 257
379 3300038443 Ga0395901_0112009 Ga0395901_0112009_1035_1814 257
380 3300049822 Ga0501035_0484364 Ga0501035_0484364_112_897 257
381 iso_pu_bacteria 2842918807 2842921064 257
382 3300005844 Ga0068862_100314176 Ga0068862_1003141762 259
383 3300044735 Ga0466968_0007387 Ga0466968_0007387_1174_1971 260
384 3300002075 JGI24738J21930_10000218 JGI24738J21930_100002188 261
385 3300014497 Ga0182008_10000926 Ga0182008_100009263 261
386 3300015261 Ga0182006_1000188 Ga0182006_100018832 261
387 3300015265 Ga0182005_1001641 Ga0182005_10016416 261
388 3300031911 Ga0307412_10001033 Ga0307412_100010335 261
389 3300041404 Ga0439436_0000004 Ga0439436_0000004_143332_144132 261
390 3300041413 Ga0439465_0001164 Ga0439465_0001164_541_1395 261
391 3300042004 Ga0439445_0013144 Ga0439445_0013144_477_1331 261
392 3300046507 Ga0495606_0166288 Ga0495606_0166288_445_1245 261
393 3300046512 Ga0495610_0000542 Ga0495610_0000542_33002_33787 261
394 3300046691 Ga0495670_0001364 Ga0495670_0001364_3236_4036 261
395 3300048922 Ga0496119_0027477 Ga0496119_0027477_380_1180 261
396 iso_pu_bacteria 2953994433 2953996338 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05096

Glu_cyclase_2

Glutamine cyclotransferase

16

263

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nom-assembly2.cif.gz_B crystal structure of zymomonas mobilis glutaminyl cyclase (monoclinic form) 0.9618 25 255
3mbr-assembly1.cif.gz_X crystal structure of the glutaminyl cyclase from xanthomonas campestris 0.95 26 259
3nom-assembly2.cif.gz_B crystal structure of zymomonas mobilis glutaminyl cyclase (monoclinic form) 0.9457 25 255
3mbr-assembly1.cif.gz_X crystal structure of the glutaminyl cyclase from xanthomonas campestris 0.9382 26 259
3nok-assembly2.cif.gz_B crystal structure of myxococcus xanthus glutaminyl cyclase 0.9258 27 255
ID Description Score Start End Superfamily
af_Q5VRH1_75_319_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8922 11 253 2.130.10.10
af_A0A144A3U7_117_356_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8879 54 251 2.130.10.10
af_Q5VRH1_75_319_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8817 11 253 2.130.10.10
af_F1M8Z5_136_280_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8136 42 124 2.40.128.630
af_E9QIR4_212_349_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8094 43 131 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A7X5QXG6-F1-model_v4 Glutaminyl-peptide cyclotransferase 0.9864 23 255 GO:0016603
AF-A0A2E5GTY6-F1-model_v4 Glutamine cyclotransferase 0.9836 32 125 GO:0016603
AF-A0A356T8H6-F1-model_v4 Glutamine cyclotransferase 0.9832 32 148 GO:0016603
AF-A0A7X7RNT1-F1-model_v4 Glutaminyl-peptide cyclotransferase 0.9818 32 253 GO:0016603
AF-A0A7C2TPQ4-F1-model_v4 Glutaminyl-peptide cyclotransferase 0.9816 21 257 GO:0016603

Feature Viewer

pLDDT pTM Quality
91.08 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map