F433303

General Info

Members Datasets Scaffolds Average Seq Length
395 186 790 91

Family's Representative Sequence

Representative Sequence 3300046535|Ga0495586_0119742|Ga0495586_0119742_97_411
Length 104
Sequence MNLFDLAGTGGDSAAAPGTVCSRKACRAVAEWQLLWNNPKIHTPERRKIWLACGEHRPWLEDYLQTRGLWKETVPLEETVTLPGQPLKTATPETATPDPSGRNG

Samples

Sample ID Description Type Environment
1 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
14 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
15 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
18 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
19 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
20 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
21 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
22 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
23 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
26 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
35 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
36 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
37 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
50 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
57 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
61 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
69 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
70 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
71 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
72 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
73 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
74 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
75 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
76 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
77 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
78 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
79 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
80 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
81 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
82 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
83 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
84 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
85 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
86 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
87 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
88 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
89 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
90 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
99 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
102 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
105 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
106 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
107 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
120 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
126 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
127 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
162 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
171 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
172 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
173 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
174 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
175 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
176 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
177 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
178 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
179 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
180 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
181 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
182 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
183 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
184 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
185 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
186 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.8
Metatranscriptomes 11.9
Isolates 4.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0
Rhizoplane 11.39
Rhizosphere 86.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495586_0119742 3300046535 Bacteria 1470
2 LJQas_1002824 3300000549 Bacteria 2382
3 LJQas_1003631 3300000549 Bacteria 2053
4 LJQas_1003870 3300000549 Bacteria 1982
5 Ga0055540_1023761 3300003792 Bacteria 1536
6 Ga0058861_12066684 3300004800 Bacteria 639
7 Ga0065714_10221469 3300005288 Bacteria 839
8 Ga0070658_10717333 3300005327 Bacteria 868
9 Ga0070676_10024958 3300005328 Bacteria 3374
10 Ga0070677_10031986 3300005333 Bacteria 2015
11 Ga0070669_101054358 3300005353 Bacteria 699
12 Ga0070675_100056724 3300005354 Bacteria 3229
13 Ga0070675_101262474 3300005354 Bacteria 680
14 Ga0070673_100270095 3300005364 Bacteria 1488
15 Ga0070698_100371020 3300005471 Bacteria 1363
16 Ga0075432_10002903 3300006058 Bacteria 5763
17 Ga0075432_10017063 3300006058 Bacteria 2477
18 Ga0105244_10004227 3300009036 Bacteria 9982
19 Ga0105244_10035036 3300009036 Bacteria 2639
20 Ga0105244_10044725 3300009036 Bacteria 2280
21 Ga0105250_10258809 3300009092 Bacteria 745
22 Ga0105243_10069980 3300009148 Bacteria 2832
23 Ga0105243_10422304 3300009148 Bacteria 1244
24 Ga0105248_10220468 3300009177 Bacteria 2135
25 Ga0105238_11940145 3300009551 Bacteria 622
26 Ga0105246_10003534 3300011119 Bacteria 9463
27 Ga0105246_10047286 3300011119 Bacteria 2938
28 Ga0105246_10232824 3300011119 Bacteria 1452
29 Ga0105246_10255696 3300011119 Bacteria 1393
30 Ga0105246_10670824 3300011119 Bacteria 905
31 Ga0157373_10005927 3300013100 Bacteria 9146
32 Ga0157370_10879002 3300013104 Bacteria 814
33 Ga0157369_10042802 3300013105 Bacteria 4940
34 Ga0157369_10198424 3300013105 Bacteria 2106
35 Ga0163162_10055014 3300013306 Bacteria 4005
36 Ga0157375_11187414 3300013308 Bacteria 895
37 Ga0157375_11211617 3300013308 Bacteria 886
38 Ga0163161_10113243 3300017792 Bacteria 2030
39 Ga0197907_10996170 3300020069 Bacteria 1120
40 Ga0206356_10125280 3300020070 Bacteria 868
41 Ga0206356_10468319 3300020070 Bacteria 1231
42 Ga0206356_10730516 3300020070 Bacteria 726
43 Ga0206349_1155848 3300020075 Bacteria 1111
44 Ga0206349_1157411 3300020075 Bacteria 807
45 Ga0206349_1420620 3300020075 Bacteria 974
46 Ga0206349_1646261 3300020075 Bacteria 825
47 Ga0206352_10958296 3300020078 Bacteria 772
48 Ga0206350_10270732 3300020080 Bacteria 721
49 Ga0206350_10502929 3300020080 Bacteria 1113
50 Ga0206354_10047430 3300020081 Bacteria 803
51 Ga0206354_10058902 3300020081 Bacteria 1619
52 Ga0206354_11364243 3300020081 Bacteria 919
53 Ga0206354_11364960 3300020081 Bacteria 735
54 Ga0206353_10716577 3300020082 Bacteria 1712
55 Ga0224712_10077707 3300022467 Bacteria 1363
56 Ga0224712_10168269 3300022467 Bacteria 982
57 Ga0224712_10300613 3300022467 Bacteria 750
58 Ga0207425_1002927 3300025245 Bacteria 5718
59 Ga0209129_1000067 3300025258 Bacteria 219974
60 Ga0209025_1001395 3300025294 Bacteria 32161
61 Ga0209051_1003979 3300025303 Bacteria 9383
62 Ga0207697_10004823 3300025315 Bacteria 6372
63 Ga0207655_1005476 3300025728 Bacteria 8617
64 Ga0207655_1018186 3300025728 Bacteria 3746
65 Ga0207655_1043814 3300025728 Bacteria 1887
66 Ga0207713_1042917 3300025735 Bacteria 1873
67 Ga0207682_10026419 3300025893 Bacteria 2308
68 Ga0207645_10019501 3300025907 Bacteria 4445
69 Ga0207705_10568888 3300025909 Bacteria 881
70 Ga0207694_10863100 3300025924 Bacteria 765
71 Ga0207650_10219051 3300025925 Bacteria 1531
72 Ga0207659_10071804 3300025926 Bacteria 2529
73 Ga0207659_10805820 3300025926 Bacteria 807
74 Ga0207709_10170318 3300025935 Bacteria 1527
75 Ga0207709_10799720 3300025935 Bacteria 761
76 Ga0207669_10037075 3300025937 Bacteria 2794
77 Ga0207428_10055820 3300027907 Bacteria 3139
78 Ga0207428_10210195 3300027907 Bacteria 1462
79 Ga0311001_1010357 3300029277 Bacteria 530
80 Ga0307408_100019381 3300031548 Bacteria 4580
81 Ga0307408_100020533 3300031548 Bacteria 4461
82 Ga0307408_100059025 3300031548 Bacteria 2791
83 Ga0307408_100129695 3300031548 Bacteria 1965
84 Ga0307408_100338096 3300031548 Bacteria 1273
85 Ga0307408_100763546 3300031548 Bacteria 874
86 Ga0307408_101452538 3300031548 Bacteria 647
87 Ga0307405_10019060 3300031731 Bacteria 3801
88 Ga0307405_10019227 3300031731 Bacteria 3788
89 Ga0307405_10062325 3300031731 Bacteria 2361
90 Ga0307405_10075869 3300031731 Bacteria 2179
91 Ga0307405_10107921 3300031731 Bacteria 1880
92 Ga0307405_10201511 3300031731 Bacteria 1446
93 Ga0307405_10225478 3300031731 Bacteria 1378
94 Ga0307405_10233488 3300031731 Bacteria 1357
95 Ga0307405_10445137 3300031731 Bacteria 1026
96 Ga0307405_10536251 3300031731 Bacteria 944
97 Ga0307413_10040998 3300031824 Bacteria 2707
98 Ga0307413_10064028 3300031824 Bacteria 2282
99 Ga0307413_10145711 3300031824 Bacteria 1643
100 Ga0307413_10184849 3300031824 Bacteria 1490
101 Ga0307413_10219232 3300031824 Bacteria 1388
102 Ga0307413_10369549 3300031824 Bacteria 1113
103 Ga0307413_10823140 3300031824 Bacteria 782
104 Ga0307413_10842970 3300031824 Bacteria 774
105 Ga0307413_10928513 3300031824 Bacteria 741
106 Ga0307413_11769288 3300031824 Bacteria 552
107 Ga0307410_10005052 3300031852 Bacteria 6932
108 Ga0307410_10063569 3300031852 Bacteria 2532
109 Ga0307410_10074478 3300031852 Bacteria 2364
110 Ga0307410_10107115 3300031852 Bacteria 2015
111 Ga0307410_10313815 3300031852 Bacteria 1241
112 Ga0307410_10548126 3300031852 Bacteria 958
113 Ga0307410_11020364 3300031852 Bacteria 714
114 Ga0307410_11263281 3300031852 Bacteria 645
115 Ga0307410_11561013 3300031852 Bacteria 582
116 Ga0307406_10078121 3300031901 Bacteria 2191
117 Ga0307406_10127598 3300031901 Bacteria 1780
118 Ga0307406_10317452 3300031901 Bacteria 1204
119 Ga0307406_10352097 3300031901 Bacteria 1151
120 Ga0307406_11247018 3300031901 Bacteria 647
121 Ga0307406_11440966 3300031901 Bacteria 605
122 Ga0307406_11829326 3300031901 Bacteria 540
123 Ga0307406_12149742 3300031901 Bacteria 501
124 Ga0307407_10031870 3300031903 Bacteria 2859
125 Ga0307407_10051310 3300031903 Bacteria 2364
126 Ga0307407_10069226 3300031903 Bacteria 2094
127 Ga0307407_10090520 3300031903 Bacteria 1874
128 Ga0307407_10176618 3300031903 Bacteria 1412
129 Ga0307407_10196350 3300031903 Bacteria 1349
130 Ga0307407_10231004 3300031903 Bacteria 1256
131 Ga0307407_10400522 3300031903 Bacteria 984
132 Ga0307407_10585026 3300031903 Bacteria 829
133 Ga0307407_10890720 3300031903 Bacteria 682
134 Ga0307412_10002167 3300031911 Bacteria 10899
135 Ga0307412_10035701 3300031911 Bacteria 3178
136 Ga0307412_10066367 3300031911 Bacteria 2445
137 Ga0307412_10098244 3300031911 Bacteria 2064
138 Ga0307412_10132251 3300031911 Bacteria 1814
139 Ga0307412_10200342 3300031911 Bacteria 1515
140 Ga0307412_10260553 3300031911 Bacteria 1351
141 Ga0307412_10311612 3300031911 Bacteria 1248
142 Ga0307412_10700008 3300031911 Bacteria 869
143 Ga0307412_10804231 3300031911 Bacteria 816
144 Ga0307412_11573641 3300031911 Bacteria 599
145 Ga0307412_11614306 3300031911 Bacteria 592
146 Ga0307412_11777007 3300031911 Bacteria 567
147 Ga0307409_100010515 3300031995 Bacteria 5760
148 Ga0307409_100030508 3300031995 Bacteria 3874
149 Ga0307409_100150910 3300031995 Bacteria 2017
150 Ga0307409_100266005 3300031995 Bacteria 1576
151 Ga0307409_101393854 3300031995 Bacteria 727
152 Ga0307409_101642112 3300031995 Bacteria 671
153 Ga0307416_100017801 3300032002 Bacteria 4984
154 Ga0307416_100179277 3300032002 Bacteria 1983
155 Ga0307416_100193655 3300032002 Bacteria 1920
156 Ga0307416_100195365 3300032002 Bacteria 1913
157 Ga0307416_100200373 3300032002 Bacteria 1893
158 Ga0307416_100290664 3300032002 Bacteria 1618
159 Ga0307416_100302139 3300032002 Bacteria 1591
160 Ga0307416_100350581 3300032002 Bacteria 1493
161 Ga0307416_100393640 3300032002 Bacteria 1420
162 Ga0307416_100448109 3300032002 Bacteria 1342
163 Ga0307416_100484663 3300032002 Bacteria 1297
164 Ga0307416_100630413 3300032002 Bacteria 1155
165 Ga0307414_10135065 3300032004 Bacteria 1922
166 Ga0307414_10142588 3300032004 Bacteria 1878
167 Ga0307414_10285695 3300032004 Bacteria 1388
168 Ga0307414_10426920 3300032004 Bacteria 1157
169 Ga0307414_10790121 3300032004 Bacteria 865
170 Ga0307414_11704651 3300032004 Bacteria 588
171 Ga0307411_10085090 3300032005 Bacteria 2189
172 Ga0307411_10174704 3300032005 Bacteria 1624
173 Ga0307411_11571517 3300032005 Bacteria 606
174 Ga0307415_100036532 3300032126 Bacteria 3220
175 Ga0307415_100302118 3300032126 Bacteria 1326
176 Ga0307415_100419908 3300032126 Bacteria 1147
177 Ga0307415_100667326 3300032126 Bacteria 934
178 Ga0395899_0112184 3300037312 Bacteria 1959
179 Ga0395899_0119574 3300037312 Bacteria 1888
180 Ga0395900_0018741 3300037418 Bacteria 7058
181 Ga0395900_0112440 3300037418 Bacteria 2796
182 Ga0395900_0768111 3300037418 Bacteria 893
183 Ga0395898_0017683 3300037466 Bacteria 7276
184 Ga0395898_0035249 3300037466 Bacteria 4978
185 Ga0395905_0839171 3300037471 Bacteria 822
186 Ga0395901_0083092 3300038443 Bacteria 3347
187 Ga0439436_0001657 3300041404 Bacteria 6504
188 Ga0439436_0072222 3300041404 Bacteria 961
189 Ga0439438_010684 3300041405 Bacteria 2891
190 Ga0439439_0001237 3300041406 Bacteria 4961
191 Ga0439439_0028466 3300041406 Bacteria 1415
192 Ga0439447_117833 3300041407 Bacteria 609
193 Ga0439461_0003795 3300041410 Bacteria 2500
194 Ga0439466_0000908 3300041411 Bacteria 11277
195 Ga0439466_0005004 3300041411 Bacteria 5086
196 Ga0439466_0044908 3300041411 Bacteria 1462
197 Ga0439465_0006890 3300041413 Bacteria 3610
198 Ga0451807_2660243 3300041486 Bacteria 563
199 Ga0439431_0146511 3300041997 Bacteria 669
200 Ga0439431_0247535 3300041997 Bacteria 528
201 Ga0439433_0000441 3300041999 Bacteria 7628
202 Ga0439433_0039001 3300041999 Bacteria 1103
203 Ga0439433_0073939 3300041999 Bacteria 823
204 Ga0439433_0114790 3300041999 Bacteria 676
205 Ga0439442_000244 3300042002 Bacteria 13232
206 Ga0439442_001405 3300042002 Bacteria 4760
207 Ga0439442_002895 3300042002 Bacteria 3380
208 Ga0439442_011728 3300042002 Bacteria 1787
209 Ga0439442_024476 3300042002 Bacteria 1256
210 Ga0439432_003697 3300042006 Bacteria 5658
211 Ga0439449_0007219 3300042007 Bacteria 4228
212 Ga0439449_0008824 3300042007 Bacteria 3824
213 Ga0439449_0011042 3300042007 Bacteria 3406
214 Ga0439449_0012687 3300042007 Bacteria 3168
215 Ga0439449_0046983 3300042007 Bacteria 1599
216 Ga0439452_001752 3300042010 Bacteria 8499
217 Ga0439452_055936 3300042010 Bacteria 893
218 Ga0439457_000675 3300042014 Bacteria 10082
219 Ga0439457_003930 3300042014 Bacteria 3969
220 Ga0439462_0000542 3300042015 Bacteria 7467
221 Ga0439462_0009453 3300042015 Bacteria 2467
222 Ga0439462_0016094 3300042015 Bacteria 1930
223 Ga0439462_0048579 3300042015 Bacteria 1138
224 Ga0450919_000570 3300042121 Bacteria 4643
225 Ga0450920_008040 3300042122 Bacteria 1921
226 Ga0450920_019842 3300042122 Bacteria 1292
227 Ga0450920_042280 3300042122 Bacteria 909
228 Ga0450907_003232 3300042146 Bacteria 2935
229 Ga0450907_035826 3300042146 Bacteria 847
230 Ga0450908_004069 3300042184 Bacteria 2827
231 Ga0450908_112438 3300042184 Bacteria 504
232 Ga0450909_000776 3300042185 Bacteria 4331
233 Ga0439434_0020807 3300042435 Bacteria 1970
234 Ga0439434_0021225 3300042435 Bacteria 1951
235 Ga0450918_001091 3300042531 Bacteria 5590
236 Ga0450918_024488 3300042531 Bacteria 1056
237 Ga0466970_0276613 3300044765 Bacteria 944
238 Ga0466958_0249846 3300045836 Bacteria 1134
239 Ga0495590_0304310 3300046457 Bacteria 600
240 Ga0495629_0050900 3300046459 Bacteria 2900
241 Ga0495653_0020578 3300046463 Bacteria 5348
242 Ga0495580_0157531 3300046472 Bacteria 1572
243 Ga0495580_0489591 3300046472 Bacteria 822
244 Ga0495582_0688622 3300046473 Bacteria 591
245 Ga0495639_0064163 3300046475 Bacteria 1687
246 Ga0495639_0137828 3300046475 Bacteria 1171
247 Ga0495662_0022537 3300046476 Bacteria 3041
248 Ga0495664_0119575 3300046477 Bacteria 1593
249 Ga0495594_0042576 3300046499 Bacteria 2487
250 Ga0495607_0422624 3300046501 Bacteria 603
251 Ga0495606_0668790 3300046507 Bacteria 500
252 Ga0495631_0037212 3300046518 Bacteria 2169
253 Ga0495642_0070926 3300046528 Bacteria 1457
254 Ga0495654_0411468 3300046530 Bacteria 536
255 Ga0495665_0000709 3300046531 Bacteria 17165
256 Ga0495665_0012359 3300046531 Bacteria 4618
257 Ga0495586_0003928 3300046535 Bacteria 7975
258 Ga0495586_0013203 3300046535 Bacteria 4379
259 Ga0495587_0022960 3300046536 Bacteria 3836
260 Ga0495598_0055054 3300046537 Bacteria 1210
261 Ga0495645_0012546 3300046543 Bacteria 5973
262 Ga0495645_0338838 3300046543 Bacteria 972
263 Ga0495633_0067709 3300046558 Bacteria 1667
264 Ga0495667_0016886 3300046559 Bacteria 4928
265 Ga0495656_0002635 3300046615 Bacteria 5986
266 Ga0495668_0188349 3300046616 Bacteria 1130
267 Ga0495668_0491719 3300046616 Bacteria 676
268 Ga0495634_0445225 3300046642 Bacteria 765
269 Ga0495659_0183705 3300046664 Bacteria 852
270 Ga0495661_0145153 3300046665 Bacteria 1287
271 Ga0495588_0001605 3300046674 Bacteria 9662
272 Ga0495588_0014083 3300046674 Bacteria 3822
273 Ga0495588_0548439 3300046674 Bacteria 606
274 Ga0495623_0167543 3300046679 Bacteria 1286
275 Ga0495670_0006377 3300046691 Bacteria 5795
276 Ga0495670_0657232 3300046691 Bacteria 571
277 Ga0495670_0693285 3300046691 Bacteria 555
278 Ga0495600_0017269 3300046809 Bacteria 4587
279 Ga0495600_0530064 3300046809 Bacteria 721
280 Ga0495581_0028099 3300047315 Bacteria 3260
281 Ga0495581_0046099 3300047315 Bacteria 2518
282 Ga0495581_0089678 3300047315 Bacteria 1783
283 Ga0495581_0097441 3300047315 Bacteria 1708
284 Ga0495636_0051964 3300047318 Bacteria 1718
285 Ga0495680_0181239 3300047322 Bacteria 1520
286 Ga0495675_0070316 3300047444 Bacteria 2210
287 Ga0495677_0024451 3300047445 Bacteria 2191
288 Ga0495681_0049851 3300047470 Bacteria 1977
289 Ga0495684_0061745 3300047471 Bacteria 2851
290 Ga0495593_0030095 3300047673 Bacteria 2973
291 Ga0495593_0059384 3300047673 Bacteria 2004
292 Ga0496100_0126470 3300048903 Bacteria 1794
293 Ga0496100_0355914 3300048903 Bacteria 1106
294 Ga0496100_0680199 3300048903 Bacteria 802
295 Ga0496100_0832353 3300048903 Bacteria 723
296 Ga0496100_1230039 3300048903 Bacteria 591
297 Ga0496101_0016028 3300048904 Bacteria 5058
298 Ga0496101_0124321 3300048904 Bacteria 1953
299 Ga0496101_0289833 3300048904 Bacteria 1280
300 Ga0496101_0834346 3300048904 Bacteria 726
301 Ga0496101_1615273 3300048904 Bacteria 503
302 Ga0496102_0050712 3300048905 Bacteria 3780
303 Ga0496102_0232594 3300048905 Bacteria 1737
304 Ga0496102_0383979 3300048905 Bacteria 1321
305 Ga0496102_0524015 3300048905 Bacteria 1107
306 Ga0496102_1577773 3300048905 Bacteria 575
307 Ga0496102_1771475 3300048905 Bacteria 535
308 Ga0496102_1773967 3300048905 Bacteria 534
309 Ga0496103_0004543 3300048906 Bacteria 8399
310 Ga0496103_0050167 3300048906 Bacteria 2581
311 Ga0496103_0069041 3300048906 Bacteria 2209
312 Ga0496103_0080157 3300048906 Bacteria 2052
313 Ga0496103_0236360 3300048906 Bacteria 1175
314 Ga0496103_0420915 3300048906 Bacteria 857
315 Ga0496104_0222104 3300048907 Bacteria 1801
316 Ga0496105_0011201 3300048908 Bacteria 7075
317 Ga0496106_0015995 3300048909 Bacteria 5548
318 Ga0496106_0275254 3300048909 Bacteria 1348
319 Ga0496107_0028274 3300048910 Bacteria 3983
320 Ga0496107_0277541 3300048910 Bacteria 1247
321 Ga0496107_0777598 3300048910 Bacteria 702
322 Ga0496109_0081163 3300048912 Bacteria 2988
323 Ga0496109_0236230 3300048912 Bacteria 1720
324 Ga0496110_0078331 3300048913 Bacteria 2942
325 Ga0496110_0111990 3300048913 Bacteria 2453
326 Ga0496110_0206676 3300048913 Bacteria 1784
327 Ga0496110_0591253 3300048913 Bacteria 1007
328 Ga0496111_0062484 3300048914 Bacteria 2700
329 Ga0496111_0098278 3300048914 Bacteria 2149
330 Ga0496111_0160032 3300048914 Bacteria 1671
331 Ga0496112_0021629 3300048915 Bacteria 6118
332 Ga0496112_0065168 3300048915 Bacteria 3595
333 Ga0496113_0450882 3300048916 Bacteria 1034
334 Ga0496113_0952913 3300048916 Bacteria 677
335 Ga0496114_0752952 3300048917 Bacteria 851
336 Ga0501304_026004 3300049160 Bacteria 602
337 Ga0501307_094607 3300049162 Bacteria 502
338 Ga0501311_062364 3300049527 Bacteria 605
339 Ga0501312_059918 3300049528 Bacteria 658
340 Ga0501317_032748 3300049533 Bacteria 762
341 Ga0501317_045753 3300049533 Bacteria 682
342 Ga0501317_098304 3300049533 Bacteria 526
343 Ga0501318_015538 3300049534 Bacteria 911
344 Ga0501319_021556 3300049535 Bacteria 580
345 Ga0501321_025298 3300049537 Bacteria 764
346 Ga0501321_057283 3300049537 Bacteria 582
347 Ga0501321_062132 3300049537 Bacteria 566
348 Ga0501324_006905 3300049540 Bacteria 967
349 Ga0501324_012307 3300049540 Bacteria 799
350 Ga0501324_015596 3300049540 Bacteria 738
351 Ga0501325_007947 3300049541 Bacteria 909
352 Ga0501032_0015763 3300049569 Bacteria 5329
353 Ga0501032_0464782 3300049569 Bacteria 810
354 Ga0501034_0000016 3300049571 Bacteria 289751
355 Ga0501037_0004927 3300049573 Bacteria 9714
356 Ga0501037_0065681 3300049573 Bacteria 2643
357 Ga0501038_0052584 3300049574 Bacteria 3511
358 Ga0501038_0093535 3300049574 Bacteria 2515
359 Ga0501038_0099810 3300049574 Bacteria 2419
360 Ga0501038_0177707 3300049574 Bacteria 1719
361 Ga0501039_0067545 3300049575 Bacteria 2776
362 Ga0501039_0162611 3300049575 Bacteria 1755
363 Ga0501039_0749736 3300049575 Bacteria 762
364 Ga0501043_0031178 3300049579 Bacteria 4192
365 Ga0501043_0083113 3300049579 Bacteria 2517
366 Ga0501043_0771313 3300049579 Bacteria 697
367 Ga0501070_0499832 3300049586 Bacteria 977
368 Ga0501202_068970 3300049652 Bacteria 812
369 Ga0587085_019336 3300059506 Bacteria 1019
370 Ga0587086_005638 3300059507 Bacteria 1363
371 Ga0587090_007318 3300059510 Bacteria 1446
372 Ga0587090_035806 3300059510 Bacteria 852
373 Ga0587101_041887 3300059623 Bacteria 758
374 Ga0587115_023670 3300059626 Bacteria 872
375 Ga0587062_006935 3300059639 Bacteria 1305
376 Ga0587072_012872 3300059643 Bacteria 1388
377 Ga0587072_048307 3300059643 Bacteria 846
378 Ga0587124_002000 3300059660 Bacteria 1393
379 2691513857 2690315906 Bacteria 4517044
380 2808852388 2808606360 Bacteria 4404006
381 2808891178 2808606370 Bacteria 4942454
382 2857742123 2857740372 Bacteria 4782044
383 2904498234 2904497146 Bacteria 4731781
384 2904777596 2904776348 Bacteria 4658726
385 2919059793 2919059106 Bacteria 4991624
386 2933421119 2933418574 Bacteria 4476724
387 2939601317 2939598168 Bacteria 4687164
388 2939648688 2939647034 Bacteria 4681660
389 2945920699 2945920336 Bacteria 4501603
390 2945943115 2945941187 Bacteria 4682474
391 2946025910 2946024296 Bacteria 3508095
392 2946039008 2946037020 Bacteria 4900426
393 2954000415 2953998280 Bacteria 4812144
394 2974306919 2974302888 Bacteria 4369871
395 8054107876 8054107350 Bacteria 5022511
396 Ga0495586_0119742
397 LJQas_1002824
398 LJQas_1003631
399 LJQas_1003870
400 Ga0055540_1023761
401 Ga0058861_12066684
402 Ga0065714_10221469
403 Ga0070658_10717333
404 Ga0070676_10024958
405 Ga0070677_10031986
406 Ga0070669_101054358
407 Ga0070675_100056724
408 Ga0070675_101262474
409 Ga0070673_100270095
410 Ga0070698_100371020
411 Ga0075432_10002903
412 Ga0075432_10017063
413 Ga0105244_10004227
414 Ga0105244_10035036
415 Ga0105244_10044725
416 Ga0105250_10258809
417 Ga0105243_10069980
418 Ga0105243_10422304
419 Ga0105248_10220468
420 Ga0105238_11940145
421 Ga0105246_10003534
422 Ga0105246_10047286
423 Ga0105246_10232824
424 Ga0105246_10255696
425 Ga0105246_10670824
426 Ga0157373_10005927
427 Ga0157370_10879002
428 Ga0157369_10042802
429 Ga0157369_10198424
430 Ga0163162_10055014
431 Ga0157375_11187414
432 Ga0157375_11211617
433 Ga0163161_10113243
434 Ga0197907_10996170
435 Ga0206356_10125280
436 Ga0206356_10468319
437 Ga0206356_10730516
438 Ga0206349_1155848
439 Ga0206349_1157411
440 Ga0206349_1420620
441 Ga0206349_1646261
442 Ga0206352_10958296
443 Ga0206350_10270732
444 Ga0206350_10502929
445 Ga0206354_10047430
446 Ga0206354_10058902
447 Ga0206354_11364243
448 Ga0206354_11364960
449 Ga0206353_10716577
450 Ga0224712_10077707
451 Ga0224712_10168269
452 Ga0224712_10300613
453 Ga0207425_1002927
454 Ga0209129_1000067
455 Ga0209025_1001395
456 Ga0209051_1003979
457 Ga0207697_10004823
458 Ga0207655_1005476
459 Ga0207655_1018186
460 Ga0207655_1043814
461 Ga0207713_1042917
462 Ga0207682_10026419
463 Ga0207645_10019501
464 Ga0207705_10568888
465 Ga0207694_10863100
466 Ga0207650_10219051
467 Ga0207659_10071804
468 Ga0207659_10805820
469 Ga0207709_10170318
470 Ga0207709_10799720
471 Ga0207669_10037075
472 Ga0207428_10055820
473 Ga0207428_10210195
474 Ga0311001_1010357
475 Ga0307408_100019381
476 Ga0307408_100020533
477 Ga0307408_100059025
478 Ga0307408_100129695
479 Ga0307408_100338096
480 Ga0307408_100763546
481 Ga0307408_101452538
482 Ga0307405_10019060
483 Ga0307405_10019227
484 Ga0307405_10062325
485 Ga0307405_10075869
486 Ga0307405_10107921
487 Ga0307405_10201511
488 Ga0307405_10225478
489 Ga0307405_10233488
490 Ga0307405_10445137
491 Ga0307405_10536251
492 Ga0307413_10040998
493 Ga0307413_10064028
494 Ga0307413_10145711
495 Ga0307413_10184849
496 Ga0307413_10219232
497 Ga0307413_10369549
498 Ga0307413_10823140
499 Ga0307413_10842970
500 Ga0307413_10928513
501 Ga0307413_11769288
502 Ga0307410_10005052
503 Ga0307410_10063569
504 Ga0307410_10074478
505 Ga0307410_10107115
506 Ga0307410_10313815
507 Ga0307410_10548126
508 Ga0307410_11020364
509 Ga0307410_11263281
510 Ga0307410_11561013
511 Ga0307406_10078121
512 Ga0307406_10127598
513 Ga0307406_10317452
514 Ga0307406_10352097
515 Ga0307406_11247018
516 Ga0307406_11440966
517 Ga0307406_11829326
518 Ga0307406_12149742
519 Ga0307407_10031870
520 Ga0307407_10051310
521 Ga0307407_10069226
522 Ga0307407_10090520
523 Ga0307407_10176618
524 Ga0307407_10196350
525 Ga0307407_10231004
526 Ga0307407_10400522
527 Ga0307407_10585026
528 Ga0307407_10890720
529 Ga0307412_10002167
530 Ga0307412_10035701
531 Ga0307412_10066367
532 Ga0307412_10098244
533 Ga0307412_10132251
534 Ga0307412_10200342
535 Ga0307412_10260553
536 Ga0307412_10311612
537 Ga0307412_10700008
538 Ga0307412_10804231
539 Ga0307412_11573641
540 Ga0307412_11614306
541 Ga0307412_11777007
542 Ga0307409_100010515
543 Ga0307409_100030508
544 Ga0307409_100150910
545 Ga0307409_100266005
546 Ga0307409_101393854
547 Ga0307409_101642112
548 Ga0307416_100017801
549 Ga0307416_100179277
550 Ga0307416_100193655
551 Ga0307416_100195365
552 Ga0307416_100200373
553 Ga0307416_100290664
554 Ga0307416_100302139
555 Ga0307416_100350581
556 Ga0307416_100393640
557 Ga0307416_100448109
558 Ga0307416_100484663
559 Ga0307416_100630413
560 Ga0307414_10135065
561 Ga0307414_10142588
562 Ga0307414_10285695
563 Ga0307414_10426920
564 Ga0307414_10790121
565 Ga0307414_11704651
566 Ga0307411_10085090
567 Ga0307411_10174704
568 Ga0307411_11571517
569 Ga0307415_100036532
570 Ga0307415_100302118
571 Ga0307415_100419908
572 Ga0307415_100667326
573 Ga0395899_0112184
574 Ga0395899_0119574
575 Ga0395900_0018741
576 Ga0395900_0112440
577 Ga0395900_0768111
578 Ga0395898_0017683
579 Ga0395898_0035249
580 Ga0395905_0839171
581 Ga0395901_0083092
582 Ga0439436_0001657
583 Ga0439436_0072222
584 Ga0439438_010684
585 Ga0439439_0001237
586 Ga0439439_0028466
587 Ga0439447_117833
588 Ga0439461_0003795
589 Ga0439466_0000908
590 Ga0439466_0005004
591 Ga0439466_0044908
592 Ga0439465_0006890
593 Ga0451807_2660243
594 Ga0439431_0146511
595 Ga0439431_0247535
596 Ga0439433_0000441
597 Ga0439433_0039001
598 Ga0439433_0073939
599 Ga0439433_0114790
600 Ga0439442_000244
601 Ga0439442_001405
602 Ga0439442_002895
603 Ga0439442_011728
604 Ga0439442_024476
605 Ga0439432_003697
606 Ga0439449_0007219
607 Ga0439449_0008824
608 Ga0439449_0011042
609 Ga0439449_0012687
610 Ga0439449_0046983
611 Ga0439452_001752
612 Ga0439452_055936
613 Ga0439457_000675
614 Ga0439457_003930
615 Ga0439462_0000542
616 Ga0439462_0009453
617 Ga0439462_0016094
618 Ga0439462_0048579
619 Ga0450919_000570
620 Ga0450920_008040
621 Ga0450920_019842
622 Ga0450920_042280
623 Ga0450907_003232
624 Ga0450907_035826
625 Ga0450908_004069
626 Ga0450908_112438
627 Ga0450909_000776
628 Ga0439434_0020807
629 Ga0439434_0021225
630 Ga0450918_001091
631 Ga0450918_024488
632 Ga0466970_0276613
633 Ga0466958_0249846
634 Ga0495590_0304310
635 Ga0495629_0050900
636 Ga0495653_0020578
637 Ga0495580_0157531
638 Ga0495580_0489591
639 Ga0495582_0688622
640 Ga0495639_0064163
641 Ga0495639_0137828
642 Ga0495662_0022537
643 Ga0495664_0119575
644 Ga0495594_0042576
645 Ga0495607_0422624
646 Ga0495606_0668790
647 Ga0495631_0037212
648 Ga0495642_0070926
649 Ga0495654_0411468
650 Ga0495665_0000709
651 Ga0495665_0012359
652 Ga0495586_0003928
653 Ga0495586_0013203
654 Ga0495587_0022960
655 Ga0495598_0055054
656 Ga0495645_0012546
657 Ga0495645_0338838
658 Ga0495633_0067709
659 Ga0495667_0016886
660 Ga0495656_0002635
661 Ga0495668_0188349
662 Ga0495668_0491719
663 Ga0495634_0445225
664 Ga0495659_0183705
665 Ga0495661_0145153
666 Ga0495588_0001605
667 Ga0495588_0014083
668 Ga0495588_0548439
669 Ga0495623_0167543
670 Ga0495670_0006377
671 Ga0495670_0657232
672 Ga0495670_0693285
673 Ga0495600_0017269
674 Ga0495600_0530064
675 Ga0495581_0028099
676 Ga0495581_0046099
677 Ga0495581_0089678
678 Ga0495581_0097441
679 Ga0495636_0051964
680 Ga0495680_0181239
681 Ga0495675_0070316
682 Ga0495677_0024451
683 Ga0495681_0049851
684 Ga0495684_0061745
685 Ga0495593_0030095
686 Ga0495593_0059384
687 Ga0496100_0126470
688 Ga0496100_0355914
689 Ga0496100_0680199
690 Ga0496100_0832353
691 Ga0496100_1230039
692 Ga0496101_0016028
693 Ga0496101_0124321
694 Ga0496101_0289833
695 Ga0496101_0834346
696 Ga0496101_1615273
697 Ga0496102_0050712
698 Ga0496102_0232594
699 Ga0496102_0383979
700 Ga0496102_0524015
701 Ga0496102_1577773
702 Ga0496102_1771475
703 Ga0496102_1773967
704 Ga0496103_0004543
705 Ga0496103_0050167
706 Ga0496103_0069041
707 Ga0496103_0080157
708 Ga0496103_0236360
709 Ga0496103_0420915
710 Ga0496104_0222104
711 Ga0496105_0011201
712 Ga0496106_0015995
713 Ga0496106_0275254
714 Ga0496107_0028274
715 Ga0496107_0277541
716 Ga0496107_0777598
717 Ga0496109_0081163
718 Ga0496109_0236230
719 Ga0496110_0078331
720 Ga0496110_0111990
721 Ga0496110_0206676
722 Ga0496110_0591253
723 Ga0496111_0062484
724 Ga0496111_0098278
725 Ga0496111_0160032
726 Ga0496112_0021629
727 Ga0496112_0065168
728 Ga0496113_0450882
729 Ga0496113_0952913
730 Ga0496114_0752952
731 Ga0501304_026004
732 Ga0501307_094607
733 Ga0501311_062364
734 Ga0501312_059918
735 Ga0501317_032748
736 Ga0501317_045753
737 Ga0501317_098304
738 Ga0501318_015538
739 Ga0501319_021556
740 Ga0501321_025298
741 Ga0501321_057283
742 Ga0501321_062132
743 Ga0501324_006905
744 Ga0501324_012307
745 Ga0501324_015596
746 Ga0501325_007947
747 Ga0501032_0015763
748 Ga0501032_0464782
749 Ga0501034_0000016
750 Ga0501037_0004927
751 Ga0501037_0065681
752 Ga0501038_0052584
753 Ga0501038_0093535
754 Ga0501038_0099810
755 Ga0501038_0177707
756 Ga0501039_0067545
757 Ga0501039_0162611
758 Ga0501039_0749736
759 Ga0501043_0031178
760 Ga0501043_0083113
761 Ga0501043_0771313
762 Ga0501070_0499832
763 Ga0501202_068970
764 Ga0587085_019336
765 Ga0587086_005638
766 Ga0587090_007318
767 Ga0587090_035806
768 Ga0587101_041887
769 Ga0587115_023670
770 Ga0587062_006935
771 Ga0587072_012872
772 Ga0587072_048307
773 Ga0587124_002000
774 2691513857
775 2808852388
776 2808891178
777 2857742123
778 2904498234
779 2904777596
780 2919059793
781 2933421119
782 2939601317
783 2939648688
784 2945920699
785 2945943115
786 2946025910
787 2946039008
788 2954000415
789 2974306919
790 8054107876

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e1r-assembly1.cif.gz_A crystal structure of the dimerization domain of lsr2 from mycobacterium tuberculosis in the p 31 2 1 space group 0.7043 20 67
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.6951 32 74
7vea-assembly1.cif.gz_fM pentacylindrical allophycocyanin core from thermosynechococcus vulcanus 0.6627 32 74
8imk-assembly1.cif.gz_z d3-d4, d1-d2, d'3-d'4, d'1-d'2 cylinder in cyanobacterial phycobilisome from anthocerotibacter panamensis (cluster c) 0.6493 32 73
4f3q-assembly1.cif.gz_A structure of a yebc family protein (cbu_1566) from coxiella burnetii 0.641 32 76
ID Description Score Start End Superfamily
4e1pA00 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1;Lsr2, dimerisation domain 0.6924 18 68 3.30.60.230
1b33O01 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;Allophycocyanin linker chain (domain) 0.6655 32 74 3.30.1490.170
af_Q2QTK4_151_212_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.6172 29 55 2.30.30.140
af_Q2FZG8_1_59_3.10.20.730 Alpha Beta;Roll;Ubiquitin-like (UB roll);RNAP, epsilon subunit-like 0.5979 30 75 3.10.20.730
4e1pA00 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1;Lsr2, dimerisation domain 0.5915 18 68 3.30.60.230
ID Description Score Start End GO Terms
AF-A0A7X7J9D7-F1-model_v4 Acetone carboxylase 0.8928 18 75
AF-A0A7Y0GM12-F1-model_v4 Acetone carboxylase 0.888 19 75
AF-A0A2M9CRE7-F1-model_v4 Acetone carboxylase 0.8839 19 75
AF-A0A1D9DZ77-F1-model_v4 Acetone carboxylase 0.8828 18 75
AF-A0A3D4WYT5-F1-model_v4 Acetone carboxylase 0.8821 18 75

Map