metagRoot

F433262

General Info

Members	Datasets	Scaffolds	Average Seq Length
395	296	387	154

Family's Representative Sequence

Representative Sequence	3300035691\|Ga0373931_0630376\|Ga0373931_0630376_53_652
Length	190
Sequence	LWNGVLEIEVILFFTWYQYSASMRCVPRRHCLHTWKENTMSLAPENADTAAQKVRLAEDAWNSRDPARVALAYTPDSRWRNRAEFPQGRAEIEVFLQRKWVRELDYRLIKELWAFDGNRIAVRFAYEWHDAAGQWFRSYGNENWLFDAHGFMAERHASINDLAITEAERKFHWPSGRRPDDHPGLSALGL

Samples

	Sample ID	Description	Type	Environment
1	2599185155	Pseudomonas sp. NFACC10-1	Isolate	Rhizoplane
2	2773857672	Pseudomonas sp. 1766	Isolate	Unclassified
3	2917832318	Pseudomonas rhizoryzae RY24	Isolate	Unclassified
4	2919125081	Pseudomonas psychrotolerans 1545	Isolate	Rhizosphere
5	2974298342	Pseudomonas sp. SORGH_AS 211	Isolate	Unclassified
6	2984499530	Pseudomonas sp. SORGH_AS199	Isolate	Aerial Root
7	2984504281	Pseudomonas psychrotolerans SORGH_AS201	Isolate	Aerial Root
8	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
9	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
10	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
11	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
12	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
13	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
14	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
15	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
16	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
17	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
18	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
19	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
20	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
21	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
22	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
23	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
24	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
25	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
26	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
27	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
28	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
29	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
30	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
31	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
32	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
33	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
34	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
35	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
36	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
37	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
38	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
39	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
40	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
41	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
42	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
43	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
44	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
45	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
46	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
47	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
48	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
49	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
50	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
51	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
52	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
53	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
54	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
55	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
56	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
57	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
58	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
59	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
60	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
61	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
62	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
63	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
64	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
65	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
66	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
67	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
68	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
69	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
70	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
71	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
72	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
73	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
74	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
75	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
76	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
77	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
78	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
79	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
80	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
81	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
82	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
83	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
84	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
85	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
86	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
87	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
88	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
89	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
90	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
91	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
92	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
93	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
94	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
95	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
96	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
97	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
98	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
99	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
100	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
101	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
102	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
103	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
104	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
105	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
106	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
107	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
108	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
109	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
110	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
111	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
112	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
113	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
114	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
115	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
116	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
117	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
118	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
119	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
120	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
121	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
168	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
172	3300030863	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
173	3300030878	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
174	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
175	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
176	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
177	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
178	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
179	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
180	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
181	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
182	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
183	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
184	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
185	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
186	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
187	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
188	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
189	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
190	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
191	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
192	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
193	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
194	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
195	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
196	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
197	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
198	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
199	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
200	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
201	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
202	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
203	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
204	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
205	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
206	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
207	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
208	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
209	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
210	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
211	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
212	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
213	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
214	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
215	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
216	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
217	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
218	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
219	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
220	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
221	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
222	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
223	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
224	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
225	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
226	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
227	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
228	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
229	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
230	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
231	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
232	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
233	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
234	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
235	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
236	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
237	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
238	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
239	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
240	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
241	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
242	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
243	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
244	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
245	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
246	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
247	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
248	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
249	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
250	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
251	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
252	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
253	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
254	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
255	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
256	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
257	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
258	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
259	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
260	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
261	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
262	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
263	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
264	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
265	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
266	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
267	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
268	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
269	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
270	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
271	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
272	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
273	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
274	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
275	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
276	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
277	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
278	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
279	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
280	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
281	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
282	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
283	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
284	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
285	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
286	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
287	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
288	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
289	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
290	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
291	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
292	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
293	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
294	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
295	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
296	8016728285	Pseudomonas psychrotolerans SORGH_AS 227	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	97.47
Metatranscriptomes	0.51
Isolates	2.03

Biome Distribution

Category	Percentage (%)
Aerial Root	0.51
Bulb	0
Endosphere	14.18
Nodule	0
Rhizoplane	6.58
Rhizosphere	69.62
Stem	0
Stem Tuber	0
Unclassified	9.11

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24739J22299_10020224	3300001989	Bacteria	2378
2	JGI24743J22301_10055974	3300001991	Bacteria	808
3	JGI24750J21931_1086819	3300002070	Bacteria	526
4	JGI24748J21848_1024288	3300002074	Bacteria	737
5	JGI24738J21930_10067036	3300002075	Bacteria	741
6	JGI24749J21850_1058341	3300002076	Bacteria	584
7	JGI24744J21845_10004809	3300002077	Bacteria	2793
8	JGI24034J26672_10011342	3300002239	Bacteria	1334
9	JGI24742J22300_10003437	3300002244	Bacteria	2569
10	JGI25156J39149_1003533	3300002705	Bacteria	5081
11	JGI25156J39149_1014302	3300002705	Bacteria	1643
12	JGI25162J39368_1000156	3300002737	Bacteria	75086
13	JGI25157J39369_1000165	3300002741	Bacteria	55870
14	JGI25157J39369_1000303	3300002741	Bacteria	35643
15	JGI25163J39215_1000178	3300002771	Bacteria	24716
16	JGI25164J39214_1000086	3300002772	Bacteria	91769
17	JGI25165J46597_1000144	3300003214	Bacteria	117624
18	Ga0055538_1000418	3300003751	Bacteria	16545
19	Ga0055527_1010797	3300003760	Bacteria	1051
20	Ga0055535_1000061	3300003761	Bacteria	117624
21	Ga0055542_1000099	3300003762	Bacteria	117624
22	Ga0055529_1000117	3300003763	Bacteria	117613
23	Ga0068869_100263630	3300005334	Bacteria	1380
24	Ga0070666_10063772	3300005335	Bacteria	2498
25	Ga0070682_100643885	3300005337	Bacteria	843
26	Ga0068868_100023691	3300005338	Bacteria	4649
27	Ga0070689_100072113	3300005340	Bacteria	2699
28	Ga0070691_10015133	3300005341	Bacteria	3544
29	Ga0070675_100191838	3300005354	Bacteria	1771
30	Ga0070671_100125565	3300005355	Bacteria	2160
31	Ga0070671_100718600	3300005355	Bacteria	867
32	Ga0070674_100002232	3300005356	Bacteria	10660
33	Ga0070673_101532499	3300005364	Bacteria	629
34	Ga0070688_100009310	3300005365	Bacteria	5366
35	Ga0070659_100037130	3300005366	Bacteria	3798
36	Ga0070667_100005654	3300005367	Bacteria	10439
37	Ga0070667_100111711	3300005367	Bacteria	2370
38	Ga0070709_10127045	3300005434	Bacteria	1736
39	Ga0070710_10001375	3300005437	Bacteria	11465
40	Ga0070701_10006444	3300005438	Bacteria	4940
41	Ga0070711_100001275	3300005439	Bacteria	13678
42	Ga0070711_100215448	3300005439	Bacteria	1490
43	Ga0070705_100012512	3300005440	Bacteria	4315
44	Ga0070694_100008976	3300005444	Bacteria	6125
45	Ga0070708_100206502	3300005445	Bacteria	1840
46	Ga0070663_101858015	3300005455	Bacteria	540
47	Ga0070678_100007464	3300005456	Bacteria	6491
48	Ga0068867_100007674	3300005459	Bacteria	7635
49	Ga0068867_101740874	3300005459	Bacteria	585
50	Ga0070685_10984581	3300005466	Bacteria	632
51	Ga0070698_100083074	3300005471	Bacteria	3194
52	Ga0070697_100628068	3300005536	Bacteria	945
53	Ga0068853_100002989	3300005539	Bacteria	12893
54	Ga0068853_101132220	3300005539	Bacteria	755
55	Ga0070686_100641987	3300005544	Bacteria	841
56	Ga0070695_100006697	3300005545	Bacteria	6815
57	Ga0070696_100004216	3300005546	Bacteria	9577
58	Ga0070693_100022060	3300005547	Bacteria	3380
59	Ga0070665_100037204	3300005548	Bacteria	4896
60	Ga0070665_100150893	3300005548	Bacteria	2327
61	Ga0070665_100786350	3300005548	Bacteria	965
62	Ga0070665_100851389	3300005548	Bacteria	925
63	Ga0070665_101659414	3300005548	Bacteria	647
64	Ga0068855_100210981	3300005563	Bacteria	2182
65	Ga0068855_100434372	3300005563	Bacteria	1435
66	Ga0070702_100000870	3300005615	Bacteria	11702
67	Ga0070702_100088605	3300005615	Bacteria	1871
68	Ga0068852_100014689	3300005616	Bacteria	6039
69	Ga0068852_100096846	3300005616	Bacteria	2653
70	Ga0068852_100797039	3300005616	Bacteria	959
71	Ga0068859_100006082	3300005617	Bacteria	12256
72	Ga0068859_100187221	3300005617	Bacteria	2154
73	Ga0068866_10250921	3300005718	Bacteria	1082
74	Ga0068861_100004706	3300005719	Bacteria	9173
75	Ga0068851_10525129	3300005834	Bacteria	712
76	Ga0068870_10261071	3300005840	Bacteria	1078
77	Ga0068863_100000256	3300005841	Bacteria	55559
78	Ga0068858_100001861	3300005842	Bacteria	21521
79	Ga0068860_100004907	3300005843	Bacteria	13628
80	Ga0068862_100004979	3300005844	Bacteria	11182
81	Ga0081540_1164395	3300005983	Bacteria	855
82	Ga0075365_10054027	3300006038	Bacteria	2662
83	Ga0075365_10232468	3300006038	Bacteria	1294
84	Ga0075368_10485747	3300006042	Bacteria	550
85	Ga0075363_100444178	3300006048	Bacteria	765
86	Ga0075364_10027155	3300006051	Bacteria	3656
87	Ga0070715_10009628	3300006163	Bacteria	3413
88	Ga0070712_100005194	3300006175	Bacteria	8055
89	Ga0070712_100326530	3300006175	Bacteria	1249
90	Ga0075362_10015183	3300006177	Bacteria	3128
91	Ga0075369_10009367	3300006186	Bacteria	3803
92	Ga0075369_10078057	3300006186	Bacteria	1465
93	Ga0075369_10100077	3300006186	Bacteria	1300
94	Ga0075366_10079760	3300006195	Bacteria	1954
95	Ga0075366_10620502	3300006195	Bacteria	670
96	Ga0075370_10502706	3300006353	Bacteria	732
97	Ga0075430_100152821	3300006846	Bacteria	1922
98	Ga0068865_100016809	3300006881	Bacteria	4690
99	Ga0097620_100006082	3300006931	Bacteria	12256
100	Ga0097620_100187212	3300006931	Bacteria	2154
101	Ga0105251_10030406	3300009011	Bacteria	2712
102	Ga0105244_10005421	3300009036	Bacteria	8484
103	Ga0105240_10975008	3300009093	Bacteria	908
104	Ga0105240_11378132	3300009093	Bacteria	742
105	Ga0105245_10006468	3300009098	Bacteria	10306
106	Ga0105247_10306337	3300009101	Bacteria	1104
107	Ga0105242_10002532	3300009176	Bacteria	14345
108	Ga0105248_10012667	3300009177	Bacteria	9306
109	Ga0105248_10146247	3300009177	Bacteria	2667
110	Ga0105249_10165704	3300009553	Bacteria	2139
111	Ga0105249_10731564	3300009553	Bacteria	1051
112	Ga0105239_10017263	3300010375	Bacteria	7980
113	Ga0105239_11160305	3300010375	Bacteria	890
114	Ga0157371_10060289	3300013102	Bacteria	2691
115	Ga0157371_10169898	3300013102	Bacteria	1558
116	Ga0157370_10290425	3300013104	Bacteria	1510
117	Ga0157369_10027210	3300013105	Bacteria	6341
118	Ga0157369_10248642	3300013105	Bacteria	1856
119	Ga0157374_10167105	3300013296	Bacteria	2144
120	Ga0157374_11099297	3300013296	Bacteria	815
121	Ga0157378_10075224	3300013297	Bacteria	3040
122	Ga0163162_10049411	3300013306	Bacteria	4215
123	Ga0163162_11112543	3300013306	Bacteria	895
124	Ga0163162_11165126	3300013306	Bacteria	874
125	Ga0157372_10327751	3300013307	Bacteria	1783
126	Ga0157375_10035410	3300013308	Bacteria	4765
127	Ga0157375_11881693	3300013308	Bacteria	710
128	Ga0163163_10017428	3300014325	Bacteria	6699
129	Ga0163163_10128954	3300014325	Bacteria	2569
130	Ga0157380_10010309	3300014326	Bacteria	6719
131	Ga0157377_10088259	3300014745	Bacteria	1826
132	Ga0157379_10049152	3300014968	Bacteria	3766
133	Ga0157379_10533976	3300014968	Bacteria	1090
134	Ga0163161_10003468	3300017792	Bacteria	11050
135	Ga0163161_10127799	3300017792	Bacteria	1915
136	Ga0209760_100368	3300025207	Bacteria	12036
137	Ga0209784_100043	3300025224	Bacteria	217823
138	Ga0209672_100920	3300025228	Bacteria	13305
139	Ga0207427_100087	3300025231	Bacteria	140098
140	Ga0209437_100173	3300025233	Bacteria	140098
141	Ga0209437_116723	3300025233	Bacteria	978
142	Ga0209258_100092	3300025242	Bacteria	226544
143	Ga0209646_1006607	3300025246	Bacteria	1941
144	Ga0209646_1007397	3300025246	Bacteria	1797
145	Ga0209026_1000013	3300025250	Bacteria	415633
146	Ga0209026_1000056	3300025250	Bacteria	236450
147	Ga0209026_1000112	3300025250	Bacteria	140098
148	Ga0209148_1000047	3300025254	Bacteria	434369
149	Ga0209759_1000166	3300025256	Bacteria	113080
150	Ga0209759_1000241	3300025256	Bacteria	81497
151	Ga0209759_1000335	3300025256	Bacteria	61951
152	Ga0209233_1000179	3300025261	Bacteria	140518
153	Ga0209455_1000056	3300025272	Bacteria	349821
154	Ga0209257_1013148	3300025304	Bacteria	3719
155	Ga0207655_1025739	3300025728	Bacteria	2848
156	Ga0207713_1000009	3300025735	Bacteria	551314
157	Ga0207713_1078877	3300025735	Bacteria	1191
158	Ga0207682_10089127	3300025893	Bacteria	1335
159	Ga0207682_10284105	3300025893	Bacteria	774
160	Ga0207692_10014806	3300025898	Bacteria	3416
161	Ga0207642_10001313	3300025899	Bacteria	7686
162	Ga0207710_10010894	3300025900	Bacteria	3829
163	Ga0207688_10001165	3300025901	Bacteria	13555
164	Ga0207688_10001981	3300025901	Bacteria	10975
165	Ga0207680_10028423	3300025903	Bacteria	3128
166	Ga0207685_10078695	3300025905	Bacteria	1358
167	Ga0207699_10182082	3300025906	Bacteria	1413
168	Ga0207699_10309398	3300025906	Bacteria	1105
169	Ga0207705_10895071	3300025909	Bacteria	688
170	Ga0207684_11012314	3300025910	Bacteria	695
171	Ga0207695_10871801	3300025913	Bacteria	780
172	Ga0207695_11462491	3300025913	Bacteria	564
173	Ga0207671_10048446	3300025914	Bacteria	3145
174	Ga0207693_10003097	3300025915	Bacteria	14324
175	Ga0207693_10296686	3300025915	Bacteria	1266
176	Ga0207663_10019088	3300025916	Bacteria	3854
177	Ga0207663_10572720	3300025916	Bacteria	885
178	Ga0207681_10022828	3300025923	Bacteria	3995
179	Ga0207694_10058889	3300025924	Bacteria	2988
180	Ga0207694_10852962	3300025924	Bacteria	770
181	Ga0207694_11340729	3300025924	Bacteria	605
182	Ga0207687_10003256	3300025927	Bacteria	10997
183	Ga0207700_10323806	3300025928	Bacteria	1336
184	Ga0207644_10053352	3300025931	Bacteria	2908
185	Ga0207686_10003682	3300025934	Bacteria	8215
186	Ga0207709_10017232	3300025935	Bacteria	4029
187	Ga0207670_10014462	3300025936	Bacteria	4685
188	Ga0207669_10000908	3300025937	Bacteria	12534
189	Ga0207704_10000785	3300025938	Bacteria	14008
190	Ga0207665_10003242	3300025939	Bacteria	10900
191	Ga0207711_10022102	3300025941	Bacteria	5317
192	Ga0207711_10110570	3300025941	Bacteria	2443
193	Ga0207689_10007123	3300025942	Bacteria	9833
194	Ga0207667_10109674	3300025949	Bacteria	2846
195	Ga0207667_10463170	3300025949	Bacteria	1287
196	Ga0207651_10282831	3300025960	Bacteria	1372
197	Ga0207651_11400075	3300025960	Bacteria	629
198	Ga0207712_10003389	3300025961	Bacteria	10078
199	Ga0207668_10003025	3300025972	Bacteria	9853
200	Ga0207640_10002378	3300025981	Bacteria	10073
201	Ga0207658_10023720	3300025986	Bacteria	4285
202	Ga0207658_10046134	3300025986	Bacteria	3180
203	Ga0207677_10006701	3300026023	Bacteria	6328
204	Ga0207703_10006348	3300026035	Bacteria	9450
205	Ga0207639_10005054	3300026041	Bacteria	8886
206	Ga0207639_10010782	3300026041	Bacteria	6334
207	Ga0207639_10162565	3300026041	Bacteria	1883
208	Ga0207678_11767551	3300026067	Bacteria	542
209	Ga0207708_10010913	3300026075	Bacteria	6758
210	Ga0207702_10851673	3300026078	Bacteria	902
211	Ga0207641_10466314	3300026088	Bacteria	1222
212	Ga0207648_10001653	3300026089	Bacteria	24447
213	Ga0207648_10318484	3300026089	Bacteria	1397
214	Ga0207675_100004536	3300026118	Bacteria	13396
215	Ga0207675_100033153	3300026118	Bacteria	4812
216	Ga0207683_10002518	3300026121	Bacteria	15995
217	Ga0207698_10003261	3300026142	Bacteria	9747
218	Ga0209813_10083905	3300027866	Bacteria	1058
219	Ga0209813_10418410	3300027866	Bacteria	543
220	Ga0268266_10027547	3300028379	Bacteria	4831
221	Ga0268266_10246872	3300028379	Bacteria	1650
222	Ga0268266_10695151	3300028379	Bacteria	980
223	Ga0268265_10013972	3300028380	Bacteria	5467
224	Ga0268264_10004403	3300028381	Bacteria	12016
225	Ga0265338_10102840	3300028800	Bacteria	2322
226	Ga0265766_1016329	3300030863	Bacteria	581
227	Ga0265770_1029177	3300030878	Bacteria	915
228	Ga0265328_10147586	3300031239	Bacteria	884
229	Ga0265340_10004433	3300031247	Bacteria	7844
230	Ga0265340_10079838	3300031247	Bacteria	1541
231	Ga0307509_10109247	3300031507	Bacteria	2776
232	Ga0265313_10176172	3300031595	Bacteria	901
233	Ga0307508_10000368	3300031616	Bacteria	54659
234	Ga0307508_10276750	3300031616	Bacteria	1272
235	Ga0265314_10125443	3300031711	Bacteria	1609
236	Ga0265314_10250629	3300031711	Bacteria	1017
237	Ga0307405_10655624	3300031731	Bacteria	864
238	Ga0307518_10142680	3300031838	Bacteria	1668
239	Ga0307410_10058542	3300031852	Bacteria	2627
240	Ga0307406_10514691	3300031901	Bacteria	973
241	Ga0307412_10014338	3300031911	Bacteria	4671
242	Ga0307416_100119697	3300032002	Bacteria	2343
243	Ga0307414_10204602	3300032004	Bacteria	1608
244	Ga0373949_0066225	3300035090	Bacteria	938
245	Ga0373960_0283260	3300035121	Bacteria	611
246	Ga0373961_0257168	3300035241	Bacteria	634
247	Ga0373931_0337553	3300035691	Bacteria	940
248	Ga0373931_0630376	3300035691	Bacteria	703
249	Ga0395899_0000404	3300037312	Bacteria	50522
250	Ga0395898_0000078	3300037466	Bacteria	244514
251	Ga0395898_0000555	3300037466	Bacteria	70108
252	Ga0395905_0057616	3300037471	Bacteria	3634
253	Ga0395901_0023122	3300038443	Bacteria	6371
254	Ga0395901_0072312	3300038443	Bacteria	3595
255	Ga0400483_180610	3300039062	Bacteria	7899
256	Ga0451835_0448122	3300041492	Bacteria	1579
257	Ga0451839_1368858	3300041496	Bacteria	2082
258	Ga0451845_0837907	3300041501	Bacteria	1234
259	Ga0451855_1188497	3300041511	Bacteria	774
260	Ga0451853_1915224	3300041512	Bacteria	1573
261	Ga0451853_3519994	3300041512	Bacteria	1227
262	Ga0451853_3651013	3300041512	Bacteria	2298
263	Ga0439462_0000315	3300042015	Bacteria	8988
264	Ga0466972_0100008	3300044658	Bacteria	1372
265	Ga0466961_0192854	3300044693	Bacteria	1262
266	Ga0466964_0088753	3300044706	Bacteria	1342
267	Ga0453684_0018474	3300044712	Bacteria	10699
268	Ga0453684_0429033	3300044712	Unclassified	1475
269	Ga0466970_0156467	3300044765	Bacteria	1259
270	Ga0466957_0009096	3300044842	Bacteria	5662
271	Ga0466959_0574036	3300045049	Bacteria	760
272	Ga0451576_1320879	3300045051	Bacteria	752
273	Ga0466967_0080886	3300045976	Bacteria	2933
274	Ga0466967_0631068	3300045976	Bacteria	1059
275	Ga0495592_0000205	3300046454	Bacteria	50544
276	Ga0495603_0000721	3300046455	Bacteria	18729
277	Ga0495591_052797	3300046458	Bacteria	1104
278	Ga0495629_0004324	3300046459	Bacteria	10652
279	Ga0495629_0030445	3300046459	Bacteria	3826
280	Ga0495641_0015248	3300046461	Bacteria	4114
281	Ga0495650_0001025	3300046471	Bacteria	31388
282	Ga0495580_0004502	3300046472	Bacteria	11707
283	Ga0495582_0031552	3300046473	Bacteria	2912
284	Ga0495582_0078052	3300046473	Bacteria	1836
285	Ga0495585_0412588	3300046492	Bacteria	649
286	Ga0495594_0825375	3300046499	Bacteria	522
287	Ga0495583_0057542	3300046506	Bacteria	1748
288	Ga0495606_0000459	3300046507	Bacteria	66924
289	Ga0495606_0017105	3300046507	Bacteria	5498
290	Ga0495610_0244359	3300046512	Bacteria	714
291	Ga0495616_0212901	3300046513	Bacteria	845
292	Ga0495618_0487558	3300046514	Bacteria	744
293	Ga0495620_0083046	3300046515	Bacteria	1294
294	Ga0495631_0149357	3300046518	Bacteria	1003
295	Ga0495648_0129035	3300046524	Bacteria	1347
296	Ga0495642_0003359	3300046528	Bacteria	6325
297	Ga0495652_1146806	3300046529	Bacteria	503
298	Ga0495654_0005533	3300046530	Bacteria	7319
299	Ga0495654_0010049	3300046530	Bacteria	5165
300	Ga0495640_0048024	3300046533	Bacteria	2952
301	Ga0495645_0000569	3300046543	Bacteria	25279
302	Ga0495622_0374983	3300046557	Bacteria	614
303	Ga0495656_0126997	3300046615	Bacteria	1210
304	Ga0495635_0222896	3300046663	Bacteria	1275
305	Ga0495623_0126284	3300046679	Bacteria	1536
306	Ga0495646_0136919	3300046680	Bacteria	1373
307	Ga0495624_0205521	3300046690	Bacteria	1195
308	Ga0495670_0000002	3300046691	Bacteria	601814
309	Ga0495671_0383178	3300046692	Bacteria	674
310	Ga0495671_0470056	3300046692	Bacteria	600
311	Ga0495649_0000929	3300046694	Bacteria	23212
312	Ga0495649_0003937	3300046694	Bacteria	9812
313	Ga0495589_0021947	3300046794	Bacteria	3262
314	Ga0495581_0000339	3300047315	Bacteria	23332
315	Ga0495674_0078428	3300047319	Bacteria	2838
316	Ga0495676_0258926	3300047321	Bacteria	1184
317	Ga0495680_0623624	3300047322	Bacteria	719
318	Ga0495683_0006790	3300047323	Bacteria	6221
319	Ga0495681_0131301	3300047470	Bacteria	1066
320	Ga0495593_0002181	3300047673	Bacteria	11719
321	Ga0495593_0032566	3300047673	Bacteria	2841
322	Ga0495614_0095780	3300048089	Bacteria	1294
323	Ga0496101_0004208	3300048904	Bacteria	9014
324	Ga0496101_0089784	3300048904	Bacteria	2284
325	Ga0496101_0328849	3300048904	Bacteria	1200
326	Ga0496101_0682078	3300048904	Bacteria	811
327	Ga0496102_0024612	3300048905	Bacteria	5353
328	Ga0496102_0100439	3300048905	Bacteria	2687
329	Ga0496103_0004794	3300048906	Bacteria	8177
330	Ga0496103_0018255	3300048906	Bacteria	4207
331	Ga0496103_0180770	3300048906	Bacteria	1356
332	Ga0496104_0026251	3300048907	Bacteria	5376
333	Ga0496104_0056635	3300048907	Bacteria	3708
334	Ga0496105_0117641	3300048908	Bacteria	2192
335	Ga0496106_0001575	3300048909	Bacteria	17163
336	Ga0496107_0000923	3300048910	Bacteria	17311
337	Ga0496108_0594817	3300048911	Bacteria	964
338	Ga0496108_1373198	3300048911	Bacteria	592
339	Ga0496110_0029558	3300048913	Bacteria	4718
340	Ga0496111_0044679	3300048914	Bacteria	3185
341	Ga0496111_0175075	3300048914	Bacteria	1595
342	Ga0496113_0528263	3300048916	Bacteria	947
343	Ga0496114_0003236	3300048917	Bacteria	12492
344	Ga0496114_0003250	3300048917	Bacteria	12481
345	Ga0496115_0000391	3300048918	Bacteria	36055
346	Ga0496115_0134896	3300048918	Bacteria	2035
347	Ga0496115_0159175	3300048918	Bacteria	1866
348	Ga0496116_0031911	3300048919	Bacteria	3762
349	Ga0496117_0006032	3300048920	Bacteria	12451
350	Ga0496118_0012581	3300048921	Bacteria	8104
351	Ga0496121_0000035	3300048924	Bacteria	374316
352	Ga0496121_0435723	3300048924	Bacteria	849
353	Ga0496123_0164013	3300048926	Bacteria	1181
354	Ga0496124_0009565	3300048927	Bacteria	9959
355	Ga0496126_0069486	3300048929	Bacteria	3142
356	Ga0495678_007616	3300049459	Bacteria	5589
357	Ga0495682_0006709	3300049460	Bacteria	4649
358	Ga0501033_0385597	3300049570	Bacteria	979
359	Ga0501043_0380467	3300049579	Bacteria	1069
360	Ga0501046_1129814	3300049580	Bacteria	540
361	Ga0501047_0501873	3300049581	Bacteria	1040
362	Ga0501070_0689906	3300049586	Bacteria	808
363	Ga0501083_0573712	3300049744	Bacteria	734
364	Ga0501035_0792146	3300049822	Bacteria	758
365	Ga0501044_0328804	3300049823	Bacteria	1452
366	nmdc:mga03683_17887_c1	3300050489	Bacteria	2688
367	nmdc:mga03683_90651_c1	3300050489	Bacteria	1332
368	nmdc:mga03n38_20152_c1	3300050490	Bacteria	2663
369	nmdc:mga00v17_18234_c1	3300050491	Bacteria	3982
370	nmdc:mga0yw44_27511_c1	3300050492	Bacteria	3258
371	nmdc:mga0yw44_69231_c1	3300050492	Bacteria	2185
372	nmdc:mga0yw44_83192_c1	3300050492	Bacteria	2010
373	nmdc:mga0k408_112921_c1	3300050493	Bacteria	1606
374	nmdc:mga0k408_72286_c1	3300050493	Bacteria	2014
375	nmdc:mga0k408_765486_c1	3300050493	Bacteria	564
376	nmdc:mga06z11_519568_c1	3300050494	Bacteria	722
377	nmdc:mga07m45_345620_c1	3300050496	Bacteria	864
378	nmdc:mga07m45_720135_c1	3300050496	Bacteria	573
379	nmdc:mga0sz30_11270_c1	3300050516	Bacteria	3448
380	nmdc:mga0sz30_14202_c1	3300050516	Bacteria	3130
381	nmdc:mga0sz30_19259_c1	3300050516	Bacteria	2741
382	Ga0500651_0012207	3300053093	Bacteria	5205
383	Ga0500572_000485	3300053111	Bacteria	13743
384	Ga0500564_307508	3300053138	Bacteria	605
385	Ga0500620_000069	3300053155	Bacteria	19720
386	Ga0500622_0012660	3300053156	Bacteria	4564
387	Ga0500627_0261010	3300053158	Bacteria	764

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300031616	Ga0307508_10000368	Ga0307508_1000036844	148
2	iso_pu_bacteria	2773857672	2774131407	148
3	iso_pu_bacteria	2917832318	2917834276	148
4	iso_pu_bacteria	2919125081	2919127824	148
5	iso_pu_bacteria	2974298342	2974298574	148
6	iso_pu_bacteria	2984499530	2984500816	148
7	iso_pu_bacteria	2984504281	2984505735	148
8	iso_pu_bacteria	8016728285	8016732321	148
9	3300025893	Ga0207682_10089127	Ga0207682_100891271	149
10	3300031731	Ga0307405_10655624	Ga0307405_106556242	149
11	3300031852	Ga0307410_10058542	Ga0307410_100585422	149
12	3300031901	Ga0307406_10514691	Ga0307406_105146912	149
13	3300031911	Ga0307412_10014338	Ga0307412_100143385	149
14	3300032002	Ga0307416_100119697	Ga0307416_1001196972	149
15	3300032004	Ga0307414_10204602	Ga0307414_102046022	149
16	3300035691	Ga0373931_0630376	Ga0373931_0630376_53_652	149
17	3300041512	Ga0451853_1915224	Ga0451853_1915224_890_1351	149
18	3300042015	Ga0439462_0000315	Ga0439462_0000315_4570_5031	149
19	3300048924	Ga0496121_0435723	Ga0496121_0435723_147_608	149
20	iso_pu_bacteria	2599185155	2599330391	149
21	3300005354	Ga0070675_100191838	Ga0070675_1001918382	150
22	3300005364	Ga0070673_101532499	Ga0070673_1015324991	150
23	3300005455	Ga0070663_101858015	Ga0070663_1018580151	150
24	3300005459	Ga0068867_101740874	Ga0068867_1017408741	150
25	3300005539	Ga0068853_101132220	Ga0068853_1011322201	150
26	3300005548	Ga0070665_100786350	Ga0070665_1007863502	150
27	3300005548	Ga0070665_100851389	Ga0070665_1008513891	150
28	3300005548	Ga0070665_101659414	Ga0070665_1016594141	150
29	3300005616	Ga0068852_100096846	Ga0068852_1000968463	150
30	3300005834	Ga0068851_10525129	Ga0068851_105251291	150
31	3300006038	Ga0075365_10232468	Ga0075365_102324682	150
32	3300006048	Ga0075363_100444178	Ga0075363_1004441782	150
33	3300006186	Ga0075369_10078057	Ga0075369_100780572	150
34	3300006186	Ga0075369_10100077	Ga0075369_101000772	150
35	3300006353	Ga0075370_10502706	Ga0075370_105027061	150
36	3300009177	Ga0105248_10146247	Ga0105248_101462473	150
37	3300013104	Ga0157370_10290425	Ga0157370_102904252	150
38	3300013306	Ga0163162_11165126	Ga0163162_111651261	150
39	3300014325	Ga0163163_10128954	Ga0163163_101289542	150
40	3300014968	Ga0157379_10049152	Ga0157379_100491523	150
41	3300017792	Ga0163161_10127799	Ga0163161_101277992	150
42	3300025246	Ga0209646_1007397	Ga0209646_10073971	150
43	3300025250	Ga0209026_1000013	Ga0209026_1000013328	150
44	3300025256	Ga0209759_1000241	Ga0209759_100024165	150
45	3300025909	Ga0207705_10895071	Ga0207705_108950711	150
46	3300025910	Ga0207684_11012314	Ga0207684_110123141	150
47	3300025913	Ga0207695_11462491	Ga0207695_114624911	150
48	3300025914	Ga0207671_10048446	Ga0207671_100484462	150
49	3300025924	Ga0207694_10058889	Ga0207694_100588892	150
50	3300025924	Ga0207694_10852962	Ga0207694_108529622	150
51	3300025924	Ga0207694_11340729	Ga0207694_113407291	150
52	3300025941	Ga0207711_10110570	Ga0207711_101105702	150
53	3300025949	Ga0207667_10463170	Ga0207667_104631702	150
54	3300025960	Ga0207651_10282831	Ga0207651_102828312	150
55	3300025960	Ga0207651_11400075	Ga0207651_114000751	150
56	3300026041	Ga0207639_10010782	Ga0207639_100107823	150
57	3300026041	Ga0207639_10162565	Ga0207639_101625652	150
58	3300026067	Ga0207678_11767551	Ga0207678_117675511	150
59	3300026078	Ga0207702_10851673	Ga0207702_108516732	150
60	3300026089	Ga0207648_10318484	Ga0207648_103184843	150
61	3300027866	Ga0209813_10083905	Ga0209813_100839052	150
62	3300028379	Ga0268266_10246872	Ga0268266_102468724	150
63	3300028379	Ga0268266_10695151	Ga0268266_106951512	150
64	3300028800	Ga0265338_10102840	Ga0265338_101028402	150
65	3300031239	Ga0265328_10147586	Ga0265328_101475862	150
66	3300031247	Ga0265340_10004433	Ga0265340_100044337	150
67	3300031247	Ga0265340_10079838	Ga0265340_100798382	150
68	3300031595	Ga0265313_10176172	Ga0265313_101761721	150
69	3300031711	Ga0265314_10125443	Ga0265314_101254432	150
70	3300031711	Ga0265314_10250629	Ga0265314_102506292	150
71	3300041492	Ga0451835_0448122	Ga0451835_0448122_435_899	150
72	3300041496	Ga0451839_1368858	Ga0451839_1368858_281_745	150
73	3300041501	Ga0451845_0837907	Ga0451845_0837907_599_1063	150
74	3300041511	Ga0451855_1188497	Ga0451855_1188497_120_587	150
75	3300041512	Ga0451853_3651013	Ga0451853_3651013_1736_2200	150
76	3300044658	Ga0466972_0100008	Ga0466972_0100008_700_1164	150
77	3300044712	Ga0453684_0018474	Ga0453684_0018474_10061_10525	150
78	3300044712	Ga0453684_0429033	Ga0453684_0429033_161_625	150
79	3300045049	Ga0466959_0574036	Ga0466959_0574036_195_662	150
80	3300045051	Ga0451576_1320879	Ga0451576_1320879_106_570	150
81	3300045976	Ga0466967_0080886	Ga0466967_0080886_1258_1725	150
82	3300046499	Ga0495594_0825375	Ga0495594_0825375_18_482	150
83	3300046512	Ga0495610_0244359	Ga0495610_0244359_36_503	150
84	3300046513	Ga0495616_0212901	Ga0495616_0212901_300_764	150
85	3300046514	Ga0495618_0487558	Ga0495618_0487558_236_718	150
86	3300046515	Ga0495620_0083046	Ga0495620_0083046_203_667	150
87	3300046518	Ga0495631_0149357	Ga0495631_0149357_62_529	150
88	3300046529	Ga0495652_1146806	Ga0495652_1146806_10_477	150
89	3300046557	Ga0495622_0374983	Ga0495622_0374983_23_505	150
90	3300046690	Ga0495624_0205521	Ga0495624_0205521_586_1068	150
91	3300047470	Ga0495681_0131301	Ga0495681_0131301_574_1038	150
92	3300047673	Ga0495593_0032566	Ga0495593_0032566_2170_2652	150
93	3300048089	Ga0495614_0095780	Ga0495614_0095780_581_1063	150
94	3300048905	Ga0496102_0024612	Ga0496102_0024612_492_956	150
95	3300048906	Ga0496103_0180770	Ga0496103_0180770_482_946	150
96	3300048918	Ga0496115_0159175	Ga0496115_0159175_928_1395	150
97	3300048919	Ga0496116_0031911	Ga0496116_0031911_2223_2687	150
98	3300048920	Ga0496117_0006032	Ga0496117_0006032_5977_6441	150
99	3300048921	Ga0496118_0012581	Ga0496118_0012581_5624_6088	150
100	3300048924	Ga0496121_0000035	Ga0496121_0000035_344171_344635	150
101	3300049570	Ga0501033_0385597	Ga0501033_0385597_220_684	150
102	3300049579	Ga0501043_0380467	Ga0501043_0380467_159_623	150
103	3300049586	Ga0501070_0689906	Ga0501070_0689906_280_744	150
104	3300049822	Ga0501035_0792146	Ga0501035_0792146_183_647	150
105	3300050492	nmdc:mga0yw44_27511_c1	nmdc:mga0yw44_27511_c1_1925_2392	150
106	3300050493	nmdc:mga0k408_72286_c1	nmdc:mga0k408_72286_c1_127_591	150
107	3300050494	nmdc:mga06z11_519568_c1	nmdc:mga06z11_519568_c1_208_672	150
108	3300050496	nmdc:mga07m45_345620_c1	nmdc:mga07m45_345620_c1_218_682	150
109	3300050516	nmdc:mga0sz30_14202_c1	nmdc:mga0sz30_14202_c1_786_1253	150
110	3300053111	Ga0500572_000485	Ga0500572_000485_6088_6552	150
111	3300053158	Ga0500627_0261010	Ga0500627_0261010_100_564	150
112	3300002705	JGI25156J39149_1014302	JGI25156J39149_10143022	151
113	3300002737	JGI25162J39368_1000156	JGI25162J39368_100015628	151
114	3300002741	JGI25157J39369_1000165	JGI25157J39369_100016531	151
115	3300002771	JGI25163J39215_1000178	JGI25163J39215_100017813	151
116	3300002772	JGI25164J39214_1000086	JGI25164J39214_100008637	151
117	3300003214	JGI25165J46597_1000144	JGI25165J46597_100014466	151
118	3300003751	Ga0055538_1000418	Ga0055538_10004185	151
119	3300003760	Ga0055527_1010797	Ga0055527_10107972	151
120	3300003761	Ga0055535_1000061	Ga0055535_100006137	151
121	3300003762	Ga0055542_1000099	Ga0055542_100009966	151
122	3300003763	Ga0055529_1000117	Ga0055529_100011766	151
123	3300005355	Ga0070671_100718600	Ga0070671_1007186002	151
124	3300006042	Ga0075368_10485747	Ga0075368_104857471	151
125	3300006175	Ga0070712_100326530	Ga0070712_1003265301	151
126	3300006177	Ga0075362_10015183	Ga0075362_100151831	151
127	3300006195	Ga0075366_10079760	Ga0075366_100797603	151
128	3300006195	Ga0075366_10620502	Ga0075366_106205021	151
129	3300013297	Ga0157378_10075224	Ga0157378_100752243	151
130	3300013308	Ga0157375_11881693	Ga0157375_118816931	151
131	3300025207	Ga0209760_100368	Ga0209760_1003688	151
132	3300025224	Ga0209784_100043	Ga0209784_10004357	151
133	3300025228	Ga0209672_100920	Ga0209672_10092011	151
134	3300025231	Ga0207427_100087	Ga0207427_10008757	151
135	3300025233	Ga0209437_100173	Ga0209437_10017357	151
136	3300025233	Ga0209437_116723	Ga0209437_1167231	151
137	3300025242	Ga0209258_100092	Ga0209258_100092128	151
138	3300025246	Ga0209646_1006607	Ga0209646_10066073	151
139	3300025250	Ga0209026_1000112	Ga0209026_100011257	151
140	3300025254	Ga0209148_1000047	Ga0209148_1000047325	151
141	3300025256	Ga0209759_1000335	Ga0209759_10003359	151
142	3300025261	Ga0209233_1000179	Ga0209233_100017958	151
143	3300025272	Ga0209455_1000056	Ga0209455_1000056249	151
144	3300025304	Ga0209257_1013148	Ga0209257_10131484	151
145	3300025893	Ga0207682_10284105	Ga0207682_102841052	151
146	3300025915	Ga0207693_10296686	Ga0207693_102966862	151
147	3300027866	Ga0209813_10418410	Ga0209813_104184101	151
148	3300030863	Ga0265766_1016329	Ga0265766_10163291	151
149	3300031507	Ga0307509_10109247	Ga0307509_101092472	151
150	3300031616	Ga0307508_10276750	Ga0307508_102767502	151
151	3300031838	Ga0307518_10142680	Ga0307518_101426802	151
152	3300046454	Ga0495592_0000205	Ga0495592_0000205_17575_18042	151
153	3300046455	Ga0495603_0000721	Ga0495603_0000721_17216_17683	151
154	3300046458	Ga0495591_052797	Ga0495591_052797_99_566	151
155	3300046459	Ga0495629_0004324	Ga0495629_0004324_4094_4561	151
156	3300046471	Ga0495650_0001025	Ga0495650_0001025_4600_5067	151
157	3300046472	Ga0495580_0004502	Ga0495580_0004502_9536_10003	151
158	3300046473	Ga0495582_0031552	Ga0495582_0031552_2122_2589	151
159	3300046492	Ga0495585_0412588	Ga0495585_0412588_16_483	151
160	3300046506	Ga0495583_0057542	Ga0495583_0057542_642_1109	151
161	3300046507	Ga0495606_0000459	Ga0495606_0000459_6381_6848	151
162	3300046507	Ga0495606_0017105	Ga0495606_0017105_4176_4643	151
163	3300046524	Ga0495648_0129035	Ga0495648_0129035_388_855	151
164	3300046528	Ga0495642_0003359	Ga0495642_0003359_4395_4862	151
165	3300046530	Ga0495654_0005533	Ga0495654_0005533_4025_4492	151
166	3300046530	Ga0495654_0010049	Ga0495654_0010049_2092_2559	151
167	3300046543	Ga0495645_0000569	Ga0495645_0000569_18407_18874	151
168	3300046615	Ga0495656_0126997	Ga0495656_0126997_28_495	151
169	3300046679	Ga0495623_0126284	Ga0495623_0126284_987_1454	151
170	3300046680	Ga0495646_0136919	Ga0495646_0136919_212_679	151
171	3300046692	Ga0495671_0470056	Ga0495671_0470056_16_483	151
172	3300046694	Ga0495649_0000929	Ga0495649_0000929_17838_18305	151
173	3300046694	Ga0495649_0003937	Ga0495649_0003937_8200_8667	151
174	3300046794	Ga0495589_0021947	Ga0495589_0021947_1970_2437	151
175	3300047315	Ga0495581_0000339	Ga0495581_0000339_2311_2778	151
176	3300047322	Ga0495680_0623624	Ga0495680_0623624_115_582	151
177	3300047323	Ga0495683_0006790	Ga0495683_0006790_2526_2993	151
178	3300048904	Ga0496101_0089784	Ga0496101_0089784_705_1172	151
179	3300048907	Ga0496104_0056635	Ga0496104_0056635_17_484	151
180	3300048911	Ga0496108_0594817	Ga0496108_0594817_244_711	151
181	3300048914	Ga0496111_0175075	Ga0496111_0175075_809_1276	151
182	3300048917	Ga0496114_0003250	Ga0496114_0003250_4721_5188	151
183	3300048918	Ga0496115_0000391	Ga0496115_0000391_15245_15712	151
184	3300048918	Ga0496115_0134896	Ga0496115_0134896_216_683	151
185	3300048929	Ga0496126_0069486	Ga0496126_0069486_874_1341	151
186	3300049459	Ga0495678_007616	Ga0495678_007616_1731_2198	151
187	3300049460	Ga0495682_0006709	Ga0495682_0006709_664_1131	151
188	3300050489	nmdc:mga03683_90651_c1	nmdc:mga03683_90651_c1_21_488	151
189	3300050492	nmdc:mga0yw44_69231_c1	nmdc:mga0yw44_69231_c1_973_1440	151
190	3300050493	nmdc:mga0k408_112921_c1	nmdc:mga0k408_112921_c1_526_993	151
191	3300050493	nmdc:mga0k408_765486_c1	nmdc:mga0k408_765486_c1_43_510	151
192	3300050496	nmdc:mga07m45_720135_c1	nmdc:mga07m45_720135_c1_90_557	151
193	3300053093	Ga0500651_0012207	Ga0500651_0012207_1090_1557	151
194	3300053138	Ga0500564_307508	Ga0500564_307508_76_543	151
195	3300002705	JGI25156J39149_1003533	JGI25156J39149_10035334	152
196	3300002741	JGI25157J39369_1000303	JGI25157J39369_100030327	152
197	3300005439	Ga0070711_100215448	Ga0070711_1002154483	152
198	3300005445	Ga0070708_100206502	Ga0070708_1002065022	152
199	3300005471	Ga0070698_100083074	Ga0070698_1000830742	152
200	3300005563	Ga0068855_100210981	Ga0068855_1002109813	152
201	3300009011	Ga0105251_10030406	Ga0105251_100304062	152
202	3300009036	Ga0105244_10005421	Ga0105244_100054211	152
203	3300009093	Ga0105240_10975008	Ga0105240_109750082	152
204	3300010375	Ga0105239_11160305	Ga0105239_111603052	152
205	3300013102	Ga0157371_10060289	Ga0157371_100602893	152
206	3300013102	Ga0157371_10169898	Ga0157371_101698981	152
207	3300013105	Ga0157369_10027210	Ga0157369_100272106	152
208	3300013307	Ga0157372_10327751	Ga0157372_103277513	152
209	3300025250	Ga0209026_1000056	Ga0209026_1000056196	152
210	3300025256	Ga0209759_1000166	Ga0209759_100016677	152
211	3300025728	Ga0207655_1025739	Ga0207655_10257392	152
212	3300025735	Ga0207713_1000009	Ga0207713_100000920	152
213	3300025735	Ga0207713_1078877	Ga0207713_10788772	152
214	3300025906	Ga0207699_10309398	Ga0207699_103093982	152
215	3300025913	Ga0207695_10871801	Ga0207695_108718012	152
216	3300025916	Ga0207663_10572720	Ga0207663_105727202	152
217	3300025928	Ga0207700_10323806	Ga0207700_103238062	152
218	3300030878	Ga0265770_1029177	Ga0265770_10291772	152
219	3300035241	Ga0373961_0257168	Ga0373961_0257168_71_529	152
220	3300037312	Ga0395899_0000404	Ga0395899_0000404_10758_11279	152
221	3300037466	Ga0395898_0000078	Ga0395898_0000078_10417_10893	152
222	3300037466	Ga0395898_0000555	Ga0395898_0000555_68139_68660	152
223	3300037471	Ga0395905_0057616	Ga0395905_0057616_1604_2107	152
224	3300038443	Ga0395901_0023122	Ga0395901_0023122_278_799	152
225	3300038443	Ga0395901_0072312	Ga0395901_0072312_1611_2114	152
226	3300039062	Ga0400483_180610	Ga0400483_180610_3192_3662	152
227	3300041512	Ga0451853_3519994	Ga0451853_3519994_592_1062	152
228	3300044693	Ga0466961_0192854	Ga0466961_0192854_362_838	152
229	3300044706	Ga0466964_0088753	Ga0466964_0088753_18_494	152
230	3300044765	Ga0466970_0156467	Ga0466970_0156467_375_851	152
231	3300044842	Ga0466957_0009096	Ga0466957_0009096_4838_5314	152
232	3300045976	Ga0466967_0631068	Ga0466967_0631068_517_975	152
233	3300046691	Ga0495670_0000002	Ga0495670_0000002_113853_114326	152
234	3300046692	Ga0495671_0383178	Ga0495671_0383178_178_654	152
235	3300048904	Ga0496101_0328849	Ga0496101_0328849_216_689	152
236	3300048926	Ga0496123_0164013	Ga0496123_0164013_135_605	152
237	3300048927	Ga0496124_0009565	Ga0496124_0009565_3028_3504	152
238	3300049580	Ga0501046_1129814	Ga0501046_1129814_37_513	152
239	3300050516	nmdc:mga0sz30_19259_c1	nmdc:mga0sz30_19259_c1_262_765	152
240	3300053155	Ga0500620_000069	Ga0500620_000069_15868_16365	152
241	3300053156	Ga0500622_0012660	Ga0500622_0012660_702_1175	152
242	3300001989	JGI24739J22299_10020224	JGI24739J22299_100202242	153
243	3300001991	JGI24743J22301_10055974	JGI24743J22301_100559741	153
244	3300002070	JGI24750J21931_1086819	JGI24750J21931_10868191	153
245	3300002074	JGI24748J21848_1024288	JGI24748J21848_10242881	153
246	3300002075	JGI24738J21930_10067036	JGI24738J21930_100670361	153
247	3300002076	JGI24749J21850_1058341	JGI24749J21850_10583411	153
248	3300002077	JGI24744J21845_10004809	JGI24744J21845_100048093	153
249	3300002239	JGI24034J26672_10011342	JGI24034J26672_100113422	153
250	3300002244	JGI24742J22300_10003437	JGI24742J22300_100034371	153
251	3300005334	Ga0068869_100263630	Ga0068869_1002636302	153
252	3300005335	Ga0070666_10063772	Ga0070666_100637722	153
253	3300005337	Ga0070682_100643885	Ga0070682_1006438852	153
254	3300005338	Ga0068868_100023691	Ga0068868_1000236912	153
255	3300005340	Ga0070689_100072113	Ga0070689_1000721133	153
256	3300005341	Ga0070691_10015133	Ga0070691_100151333	153
257	3300005355	Ga0070671_100125565	Ga0070671_1001255652	153
258	3300005356	Ga0070674_100002232	Ga0070674_10000223210	153
259	3300005365	Ga0070688_100009310	Ga0070688_1000093108	153
260	3300005366	Ga0070659_100037130	Ga0070659_1000371305	153
261	3300005367	Ga0070667_100005654	Ga0070667_1000056546	153
262	3300005367	Ga0070667_100111711	Ga0070667_1001117113	153
263	3300005434	Ga0070709_10127045	Ga0070709_101270451	153
264	3300005437	Ga0070710_10001375	Ga0070710_100013758	153
265	3300005438	Ga0070701_10006444	Ga0070701_100064442	153
266	3300005439	Ga0070711_100001275	Ga0070711_10000127510	153
267	3300005440	Ga0070705_100012512	Ga0070705_1000125122	153
268	3300005444	Ga0070694_100008976	Ga0070694_1000089766	153
269	3300005456	Ga0070678_100007464	Ga0070678_1000074642	153
270	3300005459	Ga0068867_100007674	Ga0068867_1000076747	153
271	3300005466	Ga0070685_10984581	Ga0070685_109845811	153
272	3300005536	Ga0070697_100628068	Ga0070697_1006280681	153
273	3300005539	Ga0068853_100002989	Ga0068853_1000029899	153
274	3300005544	Ga0070686_100641987	Ga0070686_1006419872	153
275	3300005545	Ga0070695_100006697	Ga0070695_1000066973	153
276	3300005546	Ga0070696_100004216	Ga0070696_1000042168	153
277	3300005547	Ga0070693_100022060	Ga0070693_1000220601	153
278	3300005548	Ga0070665_100037204	Ga0070665_1000372045	153
279	3300005548	Ga0070665_100150893	Ga0070665_1001508932	153
280	3300005563	Ga0068855_100434372	Ga0068855_1004343722	153
281	3300005615	Ga0070702_100000870	Ga0070702_10000087010	153
282	3300005615	Ga0070702_100088605	Ga0070702_1000886051	153
283	3300005616	Ga0068852_100014689	Ga0068852_1000146892	153
284	3300005616	Ga0068852_100797039	Ga0068852_1007970391	153
285	3300005617	Ga0068859_100006082	Ga0068859_10000608210	153
286	3300005617	Ga0068859_100187221	Ga0068859_1001872213	153
287	3300005718	Ga0068866_10250921	Ga0068866_102509212	153
288	3300005719	Ga0068861_100004706	Ga0068861_10000470612	153
289	3300005840	Ga0068870_10261071	Ga0068870_102610712	153
290	3300005841	Ga0068863_100000256	Ga0068863_1000002564	153
291	3300005842	Ga0068858_100001861	Ga0068858_10000186121	153
292	3300005843	Ga0068860_100004907	Ga0068860_10000490710	153
293	3300005844	Ga0068862_100004979	Ga0068862_1000049797	153
294	3300005983	Ga0081540_1164395	Ga0081540_11643951	153
295	3300006038	Ga0075365_10054027	Ga0075365_100540272	153
296	3300006051	Ga0075364_10027155	Ga0075364_100271552	153
297	3300006163	Ga0070715_10009628	Ga0070715_100096284	153
298	3300006175	Ga0070712_100005194	Ga0070712_10000519410	153
299	3300006186	Ga0075369_10009367	Ga0075369_100093672	153
300	3300006846	Ga0075430_100152821	Ga0075430_1001528212	153
301	3300006881	Ga0068865_100016809	Ga0068865_1000168092	153
302	3300006931	Ga0097620_100006082	Ga0097620_1000060829	153
303	3300006931	Ga0097620_100187212	Ga0097620_1001872122	153
304	3300009093	Ga0105240_11378132	Ga0105240_113781321	153
305	3300009098	Ga0105245_10006468	Ga0105245_100064685	153
306	3300009101	Ga0105247_10306337	Ga0105247_103063371	153
307	3300009176	Ga0105242_10002532	Ga0105242_100025329	153
308	3300009177	Ga0105248_10012667	Ga0105248_1001266710	153
309	3300009553	Ga0105249_10165704	Ga0105249_101657042	153
310	3300009553	Ga0105249_10731564	Ga0105249_107315642	153
311	3300010375	Ga0105239_10017263	Ga0105239_1001726310	153
312	3300013105	Ga0157369_10248642	Ga0157369_102486422	153
313	3300013296	Ga0157374_10167105	Ga0157374_101671052	153
314	3300013296	Ga0157374_11099297	Ga0157374_110992972	153
315	3300013306	Ga0163162_10049411	Ga0163162_100494111	153
316	3300013306	Ga0163162_11112543	Ga0163162_111125432	153
317	3300013308	Ga0157375_10035410	Ga0157375_100354102	153
318	3300014325	Ga0163163_10017428	Ga0163163_100174287	153
319	3300014326	Ga0157380_10010309	Ga0157380_100103099	153
320	3300014745	Ga0157377_10088259	Ga0157377_100882592	153
321	3300014968	Ga0157379_10533976	Ga0157379_105339761	153
322	3300017792	Ga0163161_10003468	Ga0163161_1000346811	153
323	3300025898	Ga0207692_10014806	Ga0207692_100148063	153
324	3300025899	Ga0207642_10001313	Ga0207642_1000131311	153
325	3300025900	Ga0207710_10010894	Ga0207710_100108944	153
326	3300025901	Ga0207688_10001165	Ga0207688_100011656	153
327	3300025901	Ga0207688_10001981	Ga0207688_100019812	153
328	3300025903	Ga0207680_10028423	Ga0207680_100284234	153
329	3300025905	Ga0207685_10078695	Ga0207685_100786952	153
330	3300025906	Ga0207699_10182082	Ga0207699_101820822	153
331	3300025915	Ga0207693_10003097	Ga0207693_100030979	153
332	3300025916	Ga0207663_10019088	Ga0207663_100190884	153
333	3300025923	Ga0207681_10022828	Ga0207681_100228285	153
334	3300025927	Ga0207687_10003256	Ga0207687_100032566	153
335	3300025931	Ga0207644_10053352	Ga0207644_100533525	153
336	3300025934	Ga0207686_10003682	Ga0207686_100036823	153
337	3300025935	Ga0207709_10017232	Ga0207709_100172325	153
338	3300025936	Ga0207670_10014462	Ga0207670_100144627	153
339	3300025937	Ga0207669_10000908	Ga0207669_1000090811	153
340	3300025938	Ga0207704_10000785	Ga0207704_1000078511	153
341	3300025939	Ga0207665_10003242	Ga0207665_1000324211	153
342	3300025941	Ga0207711_10022102	Ga0207711_100221022	153
343	3300025942	Ga0207689_10007123	Ga0207689_1000712312	153
344	3300025949	Ga0207667_10109674	Ga0207667_101096743	153
345	3300025961	Ga0207712_10003389	Ga0207712_100033897	153
346	3300025972	Ga0207668_10003025	Ga0207668_1000302510	153
347	3300025981	Ga0207640_10002378	Ga0207640_100023784	153
348	3300025986	Ga0207658_10023720	Ga0207658_100237206	153
349	3300025986	Ga0207658_10046134	Ga0207658_100461343	153
350	3300026023	Ga0207677_10006701	Ga0207677_100067014	153
351	3300026035	Ga0207703_10006348	Ga0207703_100063488	153
352	3300026041	Ga0207639_10005054	Ga0207639_100050549	153
353	3300026075	Ga0207708_10010913	Ga0207708_100109132	153
354	3300026088	Ga0207641_10466314	Ga0207641_104663142	153
355	3300026089	Ga0207648_10001653	Ga0207648_100016538	153
356	3300026118	Ga0207675_100004536	Ga0207675_10000453610	153
357	3300026118	Ga0207675_100033153	Ga0207675_1000331533	153
358	3300026121	Ga0207683_10002518	Ga0207683_1000251813	153
359	3300026142	Ga0207698_10003261	Ga0207698_1000326110	153
360	3300028379	Ga0268266_10027547	Ga0268266_100275473	153
361	3300028380	Ga0268265_10013972	Ga0268265_100139722	153
362	3300028381	Ga0268264_10004403	Ga0268264_1000440310	153
363	3300035090	Ga0373949_0066225	Ga0373949_0066225_227_688	153
364	3300035121	Ga0373960_0283260	Ga0373960_0283260_139_600	153
365	3300035691	Ga0373931_0337553	Ga0373931_0337553_201_662	153
366	3300046459	Ga0495629_0030445	Ga0495629_0030445_1449_1910	153
367	3300046461	Ga0495641_0015248	Ga0495641_0015248_1703_2164	153
368	3300046473	Ga0495582_0078052	Ga0495582_0078052_597_1058	153
369	3300046533	Ga0495640_0048024	Ga0495640_0048024_2299_2760	153
370	3300046663	Ga0495635_0222896	Ga0495635_0222896_801_1262	153
371	3300047319	Ga0495674_0078428	Ga0495674_0078428_106_567	153
372	3300047321	Ga0495676_0258926	Ga0495676_0258926_290_751	153
373	3300047673	Ga0495593_0002181	Ga0495593_0002181_1780_2241	153
374	3300048904	Ga0496101_0004208	Ga0496101_0004208_480_941	153
375	3300048904	Ga0496101_0682078	Ga0496101_0682078_118_579	153
376	3300048905	Ga0496102_0100439	Ga0496102_0100439_372_833	153
377	3300048906	Ga0496103_0004794	Ga0496103_0004794_463_924	153
378	3300048906	Ga0496103_0018255	Ga0496103_0018255_3711_4172	153
379	3300048907	Ga0496104_0026251	Ga0496104_0026251_2725_3186	153
380	3300048908	Ga0496105_0117641	Ga0496105_0117641_999_1460	153
381	3300048909	Ga0496106_0001575	Ga0496106_0001575_7382_7843	153
382	3300048910	Ga0496107_0000923	Ga0496107_0000923_10822_11283	153
383	3300048911	Ga0496108_1373198	Ga0496108_1373198_38_499	153
384	3300048913	Ga0496110_0029558	Ga0496110_0029558_1880_2341	153
385	3300048914	Ga0496111_0044679	Ga0496111_0044679_2113_2574	153
386	3300048916	Ga0496113_0528263	Ga0496113_0528263_30_491	153
387	3300048917	Ga0496114_0003236	Ga0496114_0003236_3978_4439	153
388	3300049581	Ga0501047_0501873	Ga0501047_0501873_144_605	153
389	3300049744	Ga0501083_0573712	Ga0501083_0573712_184_645	153
390	3300049823	Ga0501044_0328804	Ga0501044_0328804_587_1048	153
391	3300050489	nmdc:mga03683_17887_c1	nmdc:mga03683_17887_c1_1811_2272	153
392	3300050490	nmdc:mga03n38_20152_c1	nmdc:mga03n38_20152_c1_693_1154	153
393	3300050491	nmdc:mga00v17_18234_c1	nmdc:mga00v17_18234_c1_2775_3236	153
394	3300050492	nmdc:mga0yw44_83192_c1	nmdc:mga0yw44_83192_c1_576_1037	153
395	3300050516	nmdc:mga0sz30_11270_c1	nmdc:mga0sz30_11270_c1_1470_1931	153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07080

DUF1348

Protein of unknown function (DUF1348)

43

172

0.98 PF12680

SnoaL_2

SnoaL-like domain

54

155

0.82 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2imj-assembly2.cif.gz_D	x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14.	0.9462	1	148
6uad-assembly1.cif.gz_A	ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38	0.8928	11	126
1cqs-assembly1.cif.gz_B	crystal structure of d103e mutant with equilenineof ksi in pseudomonas putida	0.8793	12	123
6f50-assembly2.cif.gz_B	crystal structure of ketosteroid isomerase double variant v88i/l99v	0.8729	12	123
2inx-assembly1.cif.gz_A	crystal structure of ketosteroid isomerase d40n from pseudomonas putida (pksi) with bound 2,6-difluorophenol	0.8726	11	123

ID	Description	Score	Start	End	Superfamily
2imjD01	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.9551	12	148	3.10.450.50
2imjD01	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.9283	12	148	3.10.450.50
5aigB00	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.8651	16	126	3.10.450.50
3ebtA00	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.8627	16	126	3.10.450.50
af_A0A1D8PLG7_39_140_3.10.450.50	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.86	39	126	3.10.450.50

ID	Description	Score	Start	End
AF-A0A7J7Q248-F1-model_v4	SnoaL-like domain-containing protein	1.003	23	97
AF-A0A1N6DYQ3-F1-model_v4	DUF4440 domain-containing protein	1.001	8	138
AF-A0A7Y7B283-F1-model_v4	Nuclear transport factor 2 family protein	1.001	11	136
AF-A0A3C0NIB0-F1-model_v4	DUF1348 domain-containing protein	1.001	17	138
AF-A0A519YSE8-F1-model_v4	Nuclear transport factor 2 family protein	1.001	20	137

Feature Viewer

pLDDT	pTM	Quality
94.19	0.88	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F433262

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF07080

DUF1348

Protein of unknown function (DUF1348)

43

172

0.98

PF12680

SnoaL_2

SnoaL-like domain

54

155

0.82

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map