F433151

General Info

Members Datasets Scaffolds Average Seq Length
395 214 790 183

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100633551|Ga0070707_1006335512
Length 199
Sequence VAGGDRLRLFCALRLPDEVVAAIASWQQRELSGRGRIVSPSNLHVTLAFLGARPAGELPAIAAALRIAAADAGEPRLRLRGYRETRSVGMLTFDDEEGRAVSLAERLHGRLEELGVYRREARPWLPHVTVLRFRERPRLDPPLPALAEVSPSDAAVYSSVLRSGGAQYEALEVVPLGQSSVGPPLSAAPGKGEVDEGGS

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
92 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
110 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
111 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
112 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
127 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
128 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 4.56
Rhizosphere 94.94
Stem 0
Stem Tuber 0
Unclassified 4.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100633551 3300005468 Bacteria 1032
2 JGI25406J46586_10086319 3300003203 Bacteria 953
3 JGI25407J50210_10082968 3300003373 Bacteria 795
4 Ga0070683_100238786 3300005329 Bacteria 1728
5 Ga0070683_100259250 3300005329 Bacteria 1654
6 Ga0070661_100874572 3300005344 Bacteria 741
7 Ga0070692_10299330 3300005345 Bacteria 982
8 Ga0070675_100154034 3300005354 Bacteria 1972
9 Ga0070674_101042868 3300005356 Bacteria 719
10 Ga0070659_100286676 3300005366 Bacteria 1371
11 Ga0070714_100036018 3300005435 Bacteria 4148
12 Ga0070714_100612070 3300005435 Bacteria 1047
13 Ga0070713_100238908 3300005436 Bacteria 1654
14 Ga0070710_10239924 3300005437 Bacteria 1161
15 Ga0070701_10179012 3300005438 Bacteria 1240
16 Ga0070711_100493100 3300005439 Bacteria 1009
17 Ga0070700_100382787 3300005441 Bacteria 1053
18 Ga0070694_100424824 3300005444 Bacteria 1045
19 Ga0070708_100106698 3300005445 Bacteria 2571
20 Ga0070678_100609403 3300005456 Bacteria 976
21 Ga0070678_100668339 3300005456 Bacteria 933
22 Ga0070678_100937181 3300005456 Bacteria 793
23 Ga0070681_10816100 3300005458 Unclassified 850
24 Ga0068867_100832109 3300005459 Bacteria 826
25 Ga0070706_100005508 3300005467 Bacteria 12052
26 Ga0070707_100284812 3300005468 Bacteria 1606
27 Ga0070707_100834656 3300005468 Bacteria 885
28 Ga0070698_100130961 3300005471 Bacteria 2464
29 Ga0070699_100048798 3300005518 Bacteria 3664
30 Ga0070679_100233695 3300005530 Bacteria 1798
31 Ga0070684_100329250 3300005535 Bacteria 1404
32 Ga0070697_100055277 3300005536 Bacteria 3227
33 Ga0070697_101288466 3300005536 Bacteria 652
34 Ga0070665_100101015 3300005548 Bacteria 2889
35 Ga0070704_100203489 3300005549 Bacteria 1600
36 Ga0068855_100041494 3300005563 Bacteria 5453
37 Ga0068855_100225413 3300005563 Bacteria 2100
38 Ga0068870_10209354 3300005840 Bacteria 1187
39 Ga0081455_10009394 3300005937 Bacteria 10061
40 Ga0081455_10051281 3300005937 Bacteria 3540
41 Ga0081538_10002129 3300005981 Bacteria 19726
42 Ga0081539_10001472 3300005985 Bacteria 39944
43 Ga0070717_10009821 3300006028 Bacteria 7207
44 Ga0070717_10216705 3300006028 Bacteria 1681
45 Ga0070716_100059752 3300006173 Bacteria 2199
46 Ga0070712_100668214 3300006175 Bacteria 884
47 Ga0075428_100319357 3300006844 Bacteria 1669
48 Ga0105240_10073046 3300009093 Bacteria 4237
49 Ga0111539_10035280 3300009094 Bacteria 6057
50 Ga0111539_10368417 3300009094 Bacteria 1672
51 Ga0105245_10382971 3300009098 Bacteria 1401
52 Ga0114129_10360371 3300009147 Bacteria 1924
53 Ga0114129_12566723 3300009147 Unclassified 608
54 Ga0105242_10016287 3300009176 Bacteria 5780
55 Ga0105237_10029539 3300009545 Bacteria 5572
56 Ga0105238_10125955 3300009551 Bacteria 2540
57 Ga0105249_10675575 3300009553 Bacteria 1092
58 Ga0157370_10029740 3300013104 Bacteria 5358
59 Ga0157370_10036747 3300013104 Bacteria 4751
60 Ga0157369_10110354 3300013105 Bacteria 2924
61 Ga0157372_10085611 3300013307 Bacteria 3575
62 Ga0157375_10752766 3300013308 Bacteria 1125
63 Ga0157375_10761902 3300013308 Bacteria 1119
64 Ga0157380_10373212 3300014326 Bacteria 1343
65 Ga0157377_10138631 3300014745 Bacteria 1492
66 Ga0157377_10241872 3300014745 Bacteria 1165
67 Ga0206356_11218721 3300020070 Bacteria 2088
68 Ga0224712_10005912 3300022467 Bacteria 3449
69 Ga0207692_10095370 3300025898 Bacteria 1622
70 Ga0207692_10273344 3300025898 Bacteria 1020
71 Ga0207643_10125702 3300025908 Bacteria 1522
72 Ga0207684_10054880 3300025910 Bacteria 3381
73 Ga0207684_10116109 3300025910 Bacteria 2293
74 Ga0207707_10678099 3300025912 Unclassified 867
75 Ga0207671_10047075 3300025914 Bacteria 3191
76 Ga0207652_10245707 3300025921 Bacteria 1614
77 Ga0207646_10001294 3300025922 Bacteria 31152
78 Ga0207646_10596398 3300025922 Bacteria 992
79 Ga0207646_11185728 3300025922 Unclassified 670
80 Ga0207659_10130179 3300025926 Bacteria 1941
81 Ga0207687_10222119 3300025927 Bacteria 1488
82 Ga0207664_10061504 3300025929 Bacteria 2996
83 Ga0207664_10335558 3300025929 Bacteria 1336
84 Ga0207644_10208500 3300025931 Bacteria 1544
85 Ga0207665_10240096 3300025939 Bacteria 1335
86 Ga0207689_10628372 3300025942 Bacteria 904
87 Ga0207661_10179588 3300025944 Bacteria 1848
88 Ga0207667_10464928 3300025949 Bacteria 1285
89 Ga0207667_10753259 3300025949 Bacteria 973
90 Ga0207651_10305908 3300025960 Bacteria 1324
91 Ga0207708_10378006 3300026075 Bacteria 1167
92 Ga0207683_10608413 3300026121 Bacteria 1012
93 Ga0268266_10087229 3300028379 Bacteria 2730
94 Ga0265334_10125417 3300028573 Bacteria 916
95 Ga0265322_10124796 3300028654 Bacteria 733
96 Ga0265338_10007087 3300028800 Bacteria 14052
97 Ga0265338_10121974 3300028800 Bacteria 2076
98 Ga0265330_10037517 3300031235 Bacteria 2157
99 Ga0265325_10039014 3300031241 Bacteria 2503
100 Ga0265340_10141072 3300031247 Archaea 1102
101 Ga0265339_10030046 3300031249 Bacteria 3079
102 Ga0265331_10083290 3300031250 Bacteria 1483
103 Ga0265327_10009230 3300031251 Bacteria 7154
104 Ga0265316_10013742 3300031344 Bacteria 7175
105 Ga0307408_100577739 3300031548 Bacteria 995
106 Ga0265313_10007372 3300031595 Bacteria 7537
107 Ga0265314_10003399 3300031711 Bacteria 15417
108 Ga0265342_10076796 3300031712 Bacteria 1936
109 Ga0307416_100025346 3300032002 Bacteria 4346
110 Ga0307411_11134157 3300032005 Unclassified 706
111 Ga0307415_100024131 3300032126 Bacteria 3791
112 Ga0373923_0173911 3300035111 Bacteria 987
113 Ga0373945_0129874 3300035116 Bacteria 1009
114 Ga0373957_0263974 3300035120 Bacteria 726
115 Ga0373943_0520171 3300035170 Unclassified 696
116 Ga0373946_0028192 3300035171 Bacteria 2226
117 Ga0373924_0164396 3300035410 Bacteria 974
118 Ga0373935_0260702 3300035692 Bacteria 1216
119 Ga0373927_0339666 3300035695 Bacteria 989
120 Ga0373933_0087270 3300035724 Bacteria 1921
121 Ga0373947_0179665 3300035725 Bacteria 1377
122 Ga0373937_0362032 3300036401 Bacteria 1374
123 Ga0373925_0053063 3300037068 Bacteria 3030
124 Ga0373925_0426803 3300037068 Bacteria 1084
125 Ga0395899_0005757 3300037312 Bacteria 9620
126 Ga0395899_0015997 3300037312 Bacteria 5721
127 Ga0395899_0019550 3300037312 Bacteria 5143
128 Ga0395900_0007303 3300037418 Bacteria 11428
129 Ga0395900_0027189 3300037418 Bacteria 5858
130 Ga0395900_0029955 3300037418 Bacteria 5585
131 Ga0395900_0052214 3300037418 Bacteria 4208
132 Ga0395900_0275903 3300037418 Bacteria 1675
133 Ga0395900_1361302 3300037418 Unclassified 623
134 Ga0395898_0019532 3300037466 Bacteria 6894
135 Ga0395898_0023688 3300037466 Bacteria 6197
136 Ga0395898_0110016 3300037466 Bacteria 2641
137 Ga0395898_0167892 3300037466 Bacteria 2098
138 Ga0395898_0179845 3300037466 Bacteria 2021
139 Ga0395898_0324752 3300037466 Bacteria 1468
140 Ga0395898_0632651 3300037466 Bacteria 1012
141 Ga0395905_0002600 3300037471 Bacteria 19872
142 Ga0395905_0035359 3300037471 Bacteria 4691
143 Ga0395905_0045490 3300037471 Bacteria 4116
144 Ga0395901_0018954 3300038443 Bacteria 7035
145 Ga0395901_0042279 3300038443 Bacteria 4724
146 Ga0395901_0053097 3300038443 Bacteria 4211
147 Ga0395901_0132095 3300038443 Bacteria 2623
148 Ga0436360_0494126 3300039438 Bacteria 5949
149 Ga0436363_1421872 3300039450 Bacteria 1447
150 Ga0439441_008634 3300042001 Bacteria 1670
151 Ga0450914_022342 3300042118 Unclassified 713
152 Ga0439446_0039936 3300042156 Bacteria 1380
153 Ga0439434_0125187 3300042435 Bacteria 840
154 Ga0466972_0323656 3300044658 Unclassified 721
155 Ga0466963_0064772 3300044694 Bacteria 2449
156 Ga0466957_0083288 3300044842 Bacteria 1995
157 Ga0451576_0494831 3300045051 Bacteria 1284
158 Ga0466967_0002801 3300045976 Bacteria 11058
159 Ga0466967_0194145 3300045976 Bacteria 1920
160 Ga0466967_0819671 3300045976 Bacteria 924
161 Ga0495592_0104870 3300046454 Bacteria 2009
162 Ga0495592_0222483 3300046454 Bacteria 1261
163 Ga0495641_0100990 3300046461 Bacteria 1287
164 Ga0495641_0227416 3300046461 Bacteria 837
165 Ga0495651_0040134 3300046462 Bacteria 3641
166 Ga0495653_0035349 3300046463 Bacteria 3944
167 Ga0495582_0020673 3300046473 Bacteria 3604
168 Ga0495582_0047035 3300046473 Bacteria 2376
169 Ga0495605_0046743 3300046474 Bacteria 2126
170 Ga0495639_0434564 3300046475 Bacteria 666
171 Ga0495664_0127964 3300046477 Bacteria 1537
172 Ga0495584_0069743 3300046491 Bacteria 1766
173 Ga0495596_0035465 3300046500 Bacteria 1978
174 Ga0495607_0146707 3300046501 Bacteria 1211
175 Ga0495608_0084529 3300046511 Bacteria 2058
176 Ga0495608_0384009 3300046511 Bacteria 861
177 Ga0495618_0019936 3300046514 Bacteria 4128
178 Ga0495628_0060099 3300046516 Bacteria 2983
179 Ga0495663_0023176 3300046525 Bacteria 1797
180 Ga0495666_0211402 3300046526 Bacteria 890
181 Ga0495666_0254308 3300046526 Bacteria 800
182 Ga0495652_0301901 3300046529 Bacteria 1163
183 Ga0495654_0308133 3300046530 Unclassified 645
184 Ga0495665_0265556 3300046531 Bacteria 882
185 Ga0495640_0285522 3300046533 Bacteria 1027
186 Ga0495645_0031464 3300046543 Bacteria 3867
187 Ga0495667_0043402 3300046559 Bacteria 2979
188 Ga0495656_0111940 3300046615 Bacteria 1278
189 Ga0495668_0108898 3300046616 Bacteria 1515
190 Ga0495635_0025911 3300046663 Bacteria 4084
191 Ga0495635_0069663 3300046663 Bacteria 2411
192 Ga0495659_0024654 3300046664 Bacteria 2053
193 Ga0495588_0348963 3300046674 Unclassified 778
194 Ga0495657_0251251 3300046675 Bacteria 1064
195 Ga0495599_0020730 3300046678 Bacteria 4096
196 Ga0495599_0492404 3300046678 Bacteria 722
197 Ga0495658_0256963 3300046683 Bacteria 1099
198 Ga0495658_0705941 3300046683 Unclassified 646
199 Ga0495613_0698769 3300046689 Bacteria 668
200 Ga0495624_0053313 3300046690 Bacteria 2554
201 Ga0495589_0038973 3300046794 Bacteria 2376
202 Ga0495600_0046611 3300046809 Bacteria 2827
203 Ga0495600_0112932 3300046809 Bacteria 1769
204 Ga0495581_0418651 3300047315 Bacteria 781
205 Ga0495604_0016284 3300047317 Bacteria 5941
206 Ga0495604_0294549 3300047317 Unclassified 1092
207 Ga0495674_0031379 3300047319 Bacteria 4827
208 Ga0495680_0063089 3300047322 Bacteria 2846
209 Ga0495677_0022657 3300047445 Bacteria 2279
210 Ga0495684_0172177 3300047471 Bacteria 1609
211 Ga0495602_0107305 3300048088 Bacteria 2276
212 Ga0495614_0248083 3300048089 Bacteria 814
213 Ga0496100_0574409 3300048903 Bacteria 874
214 Ga0496104_0007482 3300048907 Bacteria 9653
215 Ga0496104_0441053 3300048907 Bacteria 1214
216 Ga0496104_1122123 3300048907 Bacteria 690
217 Ga0496105_0004111 3300048908 Bacteria 10909
218 Ga0496105_0187965 3300048908 Bacteria 1690
219 Ga0496107_0060884 3300048910 Bacteria 2732
220 Ga0496108_0123026 3300048911 Bacteria 2226
221 Ga0496109_0125016 3300048912 Bacteria 2398
222 Ga0496110_0255634 3300048913 Bacteria 1595
223 Ga0496110_0355344 3300048913 Bacteria 1335
224 Ga0496112_0184306 3300048915 Bacteria 2051
225 Ga0496113_0245019 3300048916 Bacteria 1430
226 Ga0496114_0005684 3300048917 Bacteria 9779
227 Ga0496114_0220762 3300048917 Bacteria 1664
228 Ga0496114_1036461 3300048917 Bacteria 704
229 Ga0496115_0008505 3300048918 Bacteria 7590
230 Ga0496115_0704167 3300048918 Bacteria 794
231 Ga0501031_0000640 3300049568 Bacteria 20732
232 Ga0501031_0001800 3300049568 Bacteria 13457
233 Ga0501031_0241631 3300049568 Bacteria 1174
234 Ga0501031_0297985 3300049568 Bacteria 1045
235 Ga0501032_0000996 3300049569 Bacteria 22808
236 Ga0501032_0031007 3300049569 Bacteria 3666
237 Ga0501032_0125707 3300049569 Bacteria 1694
238 Ga0501033_0004997 3300049570 Bacteria 10552
239 Ga0501033_0011259 3300049570 Bacteria 6847
240 Ga0501033_0139422 3300049570 Bacteria 1753
241 Ga0501033_0295176 3300049570 Bacteria 1142
242 Ga0501034_0003717 3300049571 Bacteria 17228
243 Ga0501034_0012725 3300049571 Bacteria 8678
244 Ga0501034_0166196 3300049571 Bacteria 2175
245 Ga0501034_0773063 3300049571 Bacteria 855
246 Ga0501036_0000260 3300049572 Bacteria 35885
247 Ga0501036_0009277 3300049572 Bacteria 8086
248 Ga0501036_0020736 3300049572 Bacteria 5519
249 Ga0501036_0135984 3300049572 Bacteria 2074
250 Ga0501036_0799662 3300049572 Archaea 776
251 Ga0501037_0017465 3300049573 Bacteria 5279
252 Ga0501037_0023314 3300049573 Bacteria 4577
253 Ga0501037_0138052 3300049573 Bacteria 1745
254 Ga0501038_0000230 3300049574 Bacteria 47516
255 Ga0501038_0001135 3300049574 Bacteria 24147
256 Ga0501038_0038820 3300049574 Bacteria 4168
257 Ga0501039_0000406 3300049575 Bacteria 30991
258 Ga0501039_0002079 3300049575 Bacteria 14837
259 Ga0501039_0062447 3300049575 Bacteria 2886
260 Ga0501039_0107921 3300049575 Bacteria 2175
261 Ga0501040_0000459 3300049576 Bacteria 24220
262 Ga0501040_0001248 3300049576 Bacteria 16178
263 Ga0501040_0025681 3300049576 Bacteria 3962
264 Ga0501040_0074155 3300049576 Bacteria 2352
265 Ga0501040_0141492 3300049576 Bacteria 1695
266 Ga0501040_0446796 3300049576 Bacteria 930
267 Ga0501040_0470183 3300049576 Bacteria 905
268 Ga0501041_0000974 3300049577 Bacteria 15625
269 Ga0501041_0006239 3300049577 Bacteria 6969
270 Ga0501041_0023671 3300049577 Bacteria 3682
271 Ga0501041_0065846 3300049577 Bacteria 2219
272 Ga0501041_0401244 3300049577 Bacteria 868
273 Ga0501042_0001764 3300049578 Bacteria 12947
274 Ga0501042_0008558 3300049578 Bacteria 6765
275 Ga0501042_0008849 3300049578 Bacteria 6674
276 Ga0501042_0028978 3300049578 Bacteria 3904
277 Ga0501042_0143397 3300049578 Bacteria 1722
278 Ga0501042_0442230 3300049578 Bacteria 943
279 Ga0501042_0477993 3300049578 Bacteria 904
280 Ga0501042_0637717 3300049578 Unclassified 774
281 Ga0501043_0007648 3300049579 Bacteria 8563
282 Ga0501043_0018021 3300049579 Bacteria 5538
283 Ga0501043_0140747 3300049579 Bacteria 1889
284 Ga0501046_0001469 3300049580 Bacteria 22616
285 Ga0501046_0003094 3300049580 Bacteria 15366
286 Ga0501046_0029322 3300049580 Bacteria 4473
287 Ga0501046_0071802 3300049580 Bacteria 2688
288 Ga0501046_0105313 3300049580 Bacteria 2160
289 Ga0501046_0693180 3300049580 Bacteria 718
290 Ga0501047_0004776 3300049581 Bacteria 12747
291 Ga0501047_0133616 3300049581 Bacteria 2361
292 Ga0501047_0748893 3300049581 Bacteria 793
293 Ga0501048_0001500 3300049582 Bacteria 17671
294 Ga0501048_0019237 3300049582 Bacteria 5014
295 Ga0501048_0076458 3300049582 Bacteria 2362
296 Ga0501048_0234055 3300049582 Bacteria 1303
297 Ga0501067_0005976 3300049583 Bacteria 6749
298 Ga0501067_0105778 3300049583 Bacteria 1564
299 Ga0501068_0000011 3300049584 Bacteria 65947
300 Ga0501068_0002246 3300049584 Bacteria 10281
301 Ga0501069_0006431 3300049585 Bacteria 6141
302 Ga0501069_0071869 3300049585 Bacteria 1939
303 Ga0501069_0202513 3300049585 Bacteria 1150
304 Ga0501070_0004007 3300049586 Bacteria 12661
305 Ga0501070_0009816 3300049586 Bacteria 8094
306 Ga0501070_0124273 3300049586 Bacteria 2132
307 Ga0501070_0368203 3300049586 Bacteria 1165
308 Ga0501071_0000668 3300049587 Bacteria 17880
309 Ga0501071_0002651 3300049587 Bacteria 10955
310 Ga0501071_0004512 3300049587 Bacteria 8826
311 Ga0501071_0009372 3300049587 Bacteria 6519
312 Ga0501071_0214077 3300049587 Bacteria 1449
313 Ga0501071_0598571 3300049587 Bacteria 847
314 Ga0501071_0640541 3300049587 Bacteria 818
315 Ga0501072_0000799 3300049588 Bacteria 23157
316 Ga0501072_0004408 3300049588 Bacteria 10689
317 Ga0501072_0610621 3300049588 Unclassified 860
318 Ga0501073_0001745 3300049589 Bacteria 16157
319 Ga0501073_0010364 3300049589 Bacteria 6837
320 Ga0501073_0340655 3300049589 Bacteria 1035
321 Ga0501073_0532528 3300049589 Bacteria 812
322 Ga0501073_0550550 3300049589 Bacteria 797
323 Ga0501074_0003678 3300049590 Bacteria 10875
324 Ga0501074_0007172 3300049590 Bacteria 8047
325 Ga0501074_0024204 3300049590 Bacteria 4412
326 Ga0501074_0087479 3300049590 Bacteria 2231
327 Ga0501074_0320279 3300049590 Bacteria 1101
328 Ga0501074_0508324 3300049590 Bacteria 853
329 Ga0501075_0005261 3300049591 Bacteria 8845
330 Ga0501075_0031132 3300049591 Bacteria 3958
331 Ga0501075_0056892 3300049591 Bacteria 2944
332 Ga0501075_0083377 3300049591 Bacteria 2421
333 Ga0501075_0104962 3300049591 Bacteria 2147
334 Ga0501075_0164274 3300049591 Bacteria 1694
335 Ga0501075_0413473 3300049591 Bacteria 1028
336 Ga0501076_0000089 3300049592 Bacteria 48333
337 Ga0501076_0014704 3300049592 Bacteria 5901
338 Ga0501076_0077518 3300049592 Bacteria 2666
339 Ga0501076_0453056 3300049592 Bacteria 1056
340 Ga0501077_0000172 3300049593 Bacteria 37130
341 Ga0501077_0080007 3300049593 Bacteria 2070
342 Ga0501077_0326966 3300049593 Bacteria 977
343 Ga0501079_0000460 3300049741 Bacteria 26745
344 Ga0501079_0011809 3300049741 Bacteria 6668
345 Ga0501079_0019611 3300049741 Bacteria 5164
346 Ga0501079_0050588 3300049741 Bacteria 3207
347 Ga0501079_0860483 3300049741 Unclassified 714
348 Ga0501079_1012071 3300049741 Archaea 654
349 Ga0501080_0000142 3300049742 Bacteria 50372
350 Ga0501080_0001087 3300049742 Bacteria 22394
351 Ga0501080_0148657 3300049742 Bacteria 2166
352 Ga0501081_0000711 3300049743 Bacteria 19284
353 Ga0501081_0003638 3300049743 Bacteria 9868
354 Ga0501081_0056961 3300049743 Bacteria 2702
355 Ga0501081_0101800 3300049743 Bacteria 2031
356 Ga0501081_0106140 3300049743 Bacteria 1990
357 Ga0501081_0300912 3300049743 Bacteria 1177
358 Ga0501083_0002491 3300049744 Bacteria 12633
359 Ga0501083_0003697 3300049744 Bacteria 10750
360 Ga0501035_0012752 3300049822 Bacteria 7767
361 Ga0501035_0048037 3300049822 Bacteria 3828
362 Ga0501035_0221185 3300049822 Bacteria 1616
363 Ga0501044_0259190 3300049823 Bacteria 1677
364 Ga0501044_0932134 3300049823 Bacteria 742
365 Ga0501045_0000550 3300049824 Bacteria 23509
366 Ga0501045_0008736 3300049824 Bacteria 7066
367 Ga0501045_0057972 3300049824 Bacteria 2834
368 Ga0501045_0219094 3300049824 Bacteria 1417
369 Ga0501045_0593346 3300049824 Bacteria 820
370 nmdc:mga00v17_68607_c1 3300050491 Bacteria 2192
371 nmdc:mga05p37_417201_c1 3300050507 Bacteria 1563
372 nmdc:mga05p37_560394_c1 3300050507 Bacteria 1298
373 nmdc:mga08y16_369221_c1 3300050511 Bacteria 1472
374 nmdc:mga08y16_89676_c1 3300050511 Bacteria 3204
375 nmdc:mga0n895_818098_c1 3300050512 Bacteria 921
376 nmdc:mga0rr50_24793_c1 3300050513 Bacteria 4160
377 nmdc:mga08x19_565246_c1 3300050514 Bacteria 805
378 Ga0495601_0055273 3300053077 Bacteria 2513
379 Ga0495601_0614443 3300053077 Bacteria 697
380 Ga0495655_0001222 3300053083 Bacteria 3963
381 Ga0501084_0000344 3300054114 Bacteria 35488
382 Ga0501084_0000896 3300054114 Bacteria 23036
383 Ga0501084_0032400 3300054114 Bacteria 4372
384 Ga0501084_0269145 3300054114 Bacteria 1438
385 Ga0501082_0000730 3300060353 Bacteria 28954
386 Ga0501082_0022682 3300060353 Bacteria 5405
387 Ga0501082_0102156 3300060353 Bacteria 2480
388 Ga0501082_0107588 3300060353 Bacteria 2412
389 Ga0501082_0882630 3300060353 Bacteria 782
390 Ga0501082_0916400 3300060353 Archaea 766
391 Ga0530510_0000762 3300061734 Bacteria 20931
392 Ga0530510_0003700 3300061734 Bacteria 10521
393 Ga0530510_0095791 3300061734 Bacteria 2168
394 Ga0530510_0375759 3300061734 Bacteria 1069
395 Ga0530510_0515801 3300061734 Bacteria 906
396 Ga0070707_100633551
397 JGI25406J46586_10086319
398 JGI25407J50210_10082968
399 Ga0070683_100238786
400 Ga0070683_100259250
401 Ga0070661_100874572
402 Ga0070692_10299330
403 Ga0070675_100154034
404 Ga0070674_101042868
405 Ga0070659_100286676
406 Ga0070714_100036018
407 Ga0070714_100612070
408 Ga0070713_100238908
409 Ga0070710_10239924
410 Ga0070701_10179012
411 Ga0070711_100493100
412 Ga0070700_100382787
413 Ga0070694_100424824
414 Ga0070708_100106698
415 Ga0070678_100609403
416 Ga0070678_100668339
417 Ga0070678_100937181
418 Ga0070681_10816100
419 Ga0068867_100832109
420 Ga0070706_100005508
421 Ga0070707_100284812
422 Ga0070707_100834656
423 Ga0070698_100130961
424 Ga0070699_100048798
425 Ga0070679_100233695
426 Ga0070684_100329250
427 Ga0070697_100055277
428 Ga0070697_101288466
429 Ga0070665_100101015
430 Ga0070704_100203489
431 Ga0068855_100041494
432 Ga0068855_100225413
433 Ga0068870_10209354
434 Ga0081455_10009394
435 Ga0081455_10051281
436 Ga0081538_10002129
437 Ga0081539_10001472
438 Ga0070717_10009821
439 Ga0070717_10216705
440 Ga0070716_100059752
441 Ga0070712_100668214
442 Ga0075428_100319357
443 Ga0105240_10073046
444 Ga0111539_10035280
445 Ga0111539_10368417
446 Ga0105245_10382971
447 Ga0114129_10360371
448 Ga0114129_12566723
449 Ga0105242_10016287
450 Ga0105237_10029539
451 Ga0105238_10125955
452 Ga0105249_10675575
453 Ga0157370_10029740
454 Ga0157370_10036747
455 Ga0157369_10110354
456 Ga0157372_10085611
457 Ga0157375_10752766
458 Ga0157375_10761902
459 Ga0157380_10373212
460 Ga0157377_10138631
461 Ga0157377_10241872
462 Ga0206356_11218721
463 Ga0224712_10005912
464 Ga0207692_10095370
465 Ga0207692_10273344
466 Ga0207643_10125702
467 Ga0207684_10054880
468 Ga0207684_10116109
469 Ga0207707_10678099
470 Ga0207671_10047075
471 Ga0207652_10245707
472 Ga0207646_10001294
473 Ga0207646_10596398
474 Ga0207646_11185728
475 Ga0207659_10130179
476 Ga0207687_10222119
477 Ga0207664_10061504
478 Ga0207664_10335558
479 Ga0207644_10208500
480 Ga0207665_10240096
481 Ga0207689_10628372
482 Ga0207661_10179588
483 Ga0207667_10464928
484 Ga0207667_10753259
485 Ga0207651_10305908
486 Ga0207708_10378006
487 Ga0207683_10608413
488 Ga0268266_10087229
489 Ga0265334_10125417
490 Ga0265322_10124796
491 Ga0265338_10007087
492 Ga0265338_10121974
493 Ga0265330_10037517
494 Ga0265325_10039014
495 Ga0265340_10141072
496 Ga0265339_10030046
497 Ga0265331_10083290
498 Ga0265327_10009230
499 Ga0265316_10013742
500 Ga0307408_100577739
501 Ga0265313_10007372
502 Ga0265314_10003399
503 Ga0265342_10076796
504 Ga0307416_100025346
505 Ga0307411_11134157
506 Ga0307415_100024131
507 Ga0373923_0173911
508 Ga0373945_0129874
509 Ga0373957_0263974
510 Ga0373943_0520171
511 Ga0373946_0028192
512 Ga0373924_0164396
513 Ga0373935_0260702
514 Ga0373927_0339666
515 Ga0373933_0087270
516 Ga0373947_0179665
517 Ga0373937_0362032
518 Ga0373925_0053063
519 Ga0373925_0426803
520 Ga0395899_0005757
521 Ga0395899_0015997
522 Ga0395899_0019550
523 Ga0395900_0007303
524 Ga0395900_0027189
525 Ga0395900_0029955
526 Ga0395900_0052214
527 Ga0395900_0275903
528 Ga0395900_1361302
529 Ga0395898_0019532
530 Ga0395898_0023688
531 Ga0395898_0110016
532 Ga0395898_0167892
533 Ga0395898_0179845
534 Ga0395898_0324752
535 Ga0395898_0632651
536 Ga0395905_0002600
537 Ga0395905_0035359
538 Ga0395905_0045490
539 Ga0395901_0018954
540 Ga0395901_0042279
541 Ga0395901_0053097
542 Ga0395901_0132095
543 Ga0436360_0494126
544 Ga0436363_1421872
545 Ga0439441_008634
546 Ga0450914_022342
547 Ga0439446_0039936
548 Ga0439434_0125187
549 Ga0466972_0323656
550 Ga0466963_0064772
551 Ga0466957_0083288
552 Ga0451576_0494831
553 Ga0466967_0002801
554 Ga0466967_0194145
555 Ga0466967_0819671
556 Ga0495592_0104870
557 Ga0495592_0222483
558 Ga0495641_0100990
559 Ga0495641_0227416
560 Ga0495651_0040134
561 Ga0495653_0035349
562 Ga0495582_0020673
563 Ga0495582_0047035
564 Ga0495605_0046743
565 Ga0495639_0434564
566 Ga0495664_0127964
567 Ga0495584_0069743
568 Ga0495596_0035465
569 Ga0495607_0146707
570 Ga0495608_0084529
571 Ga0495608_0384009
572 Ga0495618_0019936
573 Ga0495628_0060099
574 Ga0495663_0023176
575 Ga0495666_0211402
576 Ga0495666_0254308
577 Ga0495652_0301901
578 Ga0495654_0308133
579 Ga0495665_0265556
580 Ga0495640_0285522
581 Ga0495645_0031464
582 Ga0495667_0043402
583 Ga0495656_0111940
584 Ga0495668_0108898
585 Ga0495635_0025911
586 Ga0495635_0069663
587 Ga0495659_0024654
588 Ga0495588_0348963
589 Ga0495657_0251251
590 Ga0495599_0020730
591 Ga0495599_0492404
592 Ga0495658_0256963
593 Ga0495658_0705941
594 Ga0495613_0698769
595 Ga0495624_0053313
596 Ga0495589_0038973
597 Ga0495600_0046611
598 Ga0495600_0112932
599 Ga0495581_0418651
600 Ga0495604_0016284
601 Ga0495604_0294549
602 Ga0495674_0031379
603 Ga0495680_0063089
604 Ga0495677_0022657
605 Ga0495684_0172177
606 Ga0495602_0107305
607 Ga0495614_0248083
608 Ga0496100_0574409
609 Ga0496104_0007482
610 Ga0496104_0441053
611 Ga0496104_1122123
612 Ga0496105_0004111
613 Ga0496105_0187965
614 Ga0496107_0060884
615 Ga0496108_0123026
616 Ga0496109_0125016
617 Ga0496110_0255634
618 Ga0496110_0355344
619 Ga0496112_0184306
620 Ga0496113_0245019
621 Ga0496114_0005684
622 Ga0496114_0220762
623 Ga0496114_1036461
624 Ga0496115_0008505
625 Ga0496115_0704167
626 Ga0501031_0000640
627 Ga0501031_0001800
628 Ga0501031_0241631
629 Ga0501031_0297985
630 Ga0501032_0000996
631 Ga0501032_0031007
632 Ga0501032_0125707
633 Ga0501033_0004997
634 Ga0501033_0011259
635 Ga0501033_0139422
636 Ga0501033_0295176
637 Ga0501034_0003717
638 Ga0501034_0012725
639 Ga0501034_0166196
640 Ga0501034_0773063
641 Ga0501036_0000260
642 Ga0501036_0009277
643 Ga0501036_0020736
644 Ga0501036_0135984
645 Ga0501036_0799662
646 Ga0501037_0017465
647 Ga0501037_0023314
648 Ga0501037_0138052
649 Ga0501038_0000230
650 Ga0501038_0001135
651 Ga0501038_0038820
652 Ga0501039_0000406
653 Ga0501039_0002079
654 Ga0501039_0062447
655 Ga0501039_0107921
656 Ga0501040_0000459
657 Ga0501040_0001248
658 Ga0501040_0025681
659 Ga0501040_0074155
660 Ga0501040_0141492
661 Ga0501040_0446796
662 Ga0501040_0470183
663 Ga0501041_0000974
664 Ga0501041_0006239
665 Ga0501041_0023671
666 Ga0501041_0065846
667 Ga0501041_0401244
668 Ga0501042_0001764
669 Ga0501042_0008558
670 Ga0501042_0008849
671 Ga0501042_0028978
672 Ga0501042_0143397
673 Ga0501042_0442230
674 Ga0501042_0477993
675 Ga0501042_0637717
676 Ga0501043_0007648
677 Ga0501043_0018021
678 Ga0501043_0140747
679 Ga0501046_0001469
680 Ga0501046_0003094
681 Ga0501046_0029322
682 Ga0501046_0071802
683 Ga0501046_0105313
684 Ga0501046_0693180
685 Ga0501047_0004776
686 Ga0501047_0133616
687 Ga0501047_0748893
688 Ga0501048_0001500
689 Ga0501048_0019237
690 Ga0501048_0076458
691 Ga0501048_0234055
692 Ga0501067_0005976
693 Ga0501067_0105778
694 Ga0501068_0000011
695 Ga0501068_0002246
696 Ga0501069_0006431
697 Ga0501069_0071869
698 Ga0501069_0202513
699 Ga0501070_0004007
700 Ga0501070_0009816
701 Ga0501070_0124273
702 Ga0501070_0368203
703 Ga0501071_0000668
704 Ga0501071_0002651
705 Ga0501071_0004512
706 Ga0501071_0009372
707 Ga0501071_0214077
708 Ga0501071_0598571
709 Ga0501071_0640541
710 Ga0501072_0000799
711 Ga0501072_0004408
712 Ga0501072_0610621
713 Ga0501073_0001745
714 Ga0501073_0010364
715 Ga0501073_0340655
716 Ga0501073_0532528
717 Ga0501073_0550550
718 Ga0501074_0003678
719 Ga0501074_0007172
720 Ga0501074_0024204
721 Ga0501074_0087479
722 Ga0501074_0320279
723 Ga0501074_0508324
724 Ga0501075_0005261
725 Ga0501075_0031132
726 Ga0501075_0056892
727 Ga0501075_0083377
728 Ga0501075_0104962
729 Ga0501075_0164274
730 Ga0501075_0413473
731 Ga0501076_0000089
732 Ga0501076_0014704
733 Ga0501076_0077518
734 Ga0501076_0453056
735 Ga0501077_0000172
736 Ga0501077_0080007
737 Ga0501077_0326966
738 Ga0501079_0000460
739 Ga0501079_0011809
740 Ga0501079_0019611
741 Ga0501079_0050588
742 Ga0501079_0860483
743 Ga0501079_1012071
744 Ga0501080_0000142
745 Ga0501080_0001087
746 Ga0501080_0148657
747 Ga0501081_0000711
748 Ga0501081_0003638
749 Ga0501081_0056961
750 Ga0501081_0101800
751 Ga0501081_0106140
752 Ga0501081_0300912
753 Ga0501083_0002491
754 Ga0501083_0003697
755 Ga0501035_0012752
756 Ga0501035_0048037
757 Ga0501035_0221185
758 Ga0501044_0259190
759 Ga0501044_0932134
760 Ga0501045_0000550
761 Ga0501045_0008736
762 Ga0501045_0057972
763 Ga0501045_0219094
764 Ga0501045_0593346
765 nmdc:mga00v17_68607_c1
766 nmdc:mga05p37_417201_c1
767 nmdc:mga05p37_560394_c1
768 nmdc:mga08y16_369221_c1
769 nmdc:mga08y16_89676_c1
770 nmdc:mga0n895_818098_c1
771 nmdc:mga0rr50_24793_c1
772 nmdc:mga08x19_565246_c1
773 Ga0495601_0055273
774 Ga0495601_0614443
775 Ga0495655_0001222
776 Ga0501084_0000344
777 Ga0501084_0000896
778 Ga0501084_0032400
779 Ga0501084_0269145
780 Ga0501082_0000730
781 Ga0501082_0022682
782 Ga0501082_0102156
783 Ga0501082_0107588
784 Ga0501082_0882630
785 Ga0501082_0916400
786 Ga0530510_0000762
787 Ga0530510_0003700
788 Ga0530510_0095791
789 Ga0530510_0375759
790 Ga0530510_0515801

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02834

LigT_PEase

LigT like Phosphoesterase

13

86

0.86

PF13563

2_5_RNA_ligase2

2'-5' RNA ligase superfamily

15

163

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n9j-assembly1.cif.gz_A x-ray structure of a secreted c11 cysteine protease from bacteroides thetaiotaomicron in complex with an irreversible peptide inhibitor 0.8548 157 181
5ldo-assembly2.cif.gz_B crystal structure of e.coli ligt complexed with 3'-amp 0.853 11 183
1iuh-assembly1.cif.gz_A crystal structure of tt0787 of thermus thermophilus hb8 0.8518 13 181
5ldj-assembly3.cif.gz_C crystal structure of e.coli ligt complexed with phosphate 0.8504 10 183
5ldo-assembly2.cif.gz_B crystal structure of e.coli ligt complexed with 3'-amp 0.8484 11 183
ID Description Score Start End Superfamily
af_Q58963_1_173_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8306 13 179 3.90.1140.10
5h7fA00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8274 7 181 3.90.1140.10
1vgjA00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8268 14 183 3.90.1140.10
5ldmB00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8202 10 181 3.90.1140.10
5ldmB00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8071 10 181 3.90.1140.10
ID Description Score Start End GO Terms
AF-A0A538CKF0-F1-model_v4 Phosphoesterase HXTX domain-containing protein 0.9947 19 183 GO:0004113
GO:0008664
AF-A0A538CKF0-F1-model_v4 Phosphoesterase HXTX domain-containing protein 0.9887 19 183 GO:0004113
GO:0008664
AF-A0A1Q7WJP5-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9841 13 183 GO:0004113
GO:0008664
GO:0016874
AF-A0A538DBD0-F1-model_v4 Phosphoesterase HXTX domain-containing protein 0.9807 7 150 GO:0004113
GO:0008664
AF-A0A7W0SQG7-F1-model_v4 2'-5' RNA ligase family protein 0.969 32 183 GO:0004113
GO:0008664
GO:0016874

Map