F433103
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 395 | 201 | 790 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300003320|rootH2_10188592|rootH2_101885922 |
| Length | 139 |
| Sequence | MNGAAHRDGAAYIGGAAEAPAPGRQYSGHNRISTQALTSLAKAAAAEALGIHAHDVRADWADDDGLLALSLVAPIRIPSLPAVLRDPGRVQALGGSIWERTVHARADILTKVTELSGARLSRVDIRISGTHVTEGGRVQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 3 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 23 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 24 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 25 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 40 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 62 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 64 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 65 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 66 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 67 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 68 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 69 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 70 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 71 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 72 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 73 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 74 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 75 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 76 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 77 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 78 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 79 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 80 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 81 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 82 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 83 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 84 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 85 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 86 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 87 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 88 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 89 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 90 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 91 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 92 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 93 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 94 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 95 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 96 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 97 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 98 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 141 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 142 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 143 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 144 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 145 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 146 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 149 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 150 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 151 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 152 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 153 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 154 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 155 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 156 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 157 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 158 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 172 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 174 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 176 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 177 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 178 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 179 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 180 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 181 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 182 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 183 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 184 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 185 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 186 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 187 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 188 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 189 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 190 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 191 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 192 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 193 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 194 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 195 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 196 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 197 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 198 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 199 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 200 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 201 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.13 |
| Metatranscriptomes | 3.04 |
| Isolates | 6.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.51 |
| Nodule | 0 |
| Rhizoplane | 6.84 |
| Rhizosphere | 87.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10188592 | 3300003320 | Bacteria | 1341 |
| 2 | JGI24035J26624_1028601 | 3300002126 | Bacteria | 603 |
| 3 | JGI24033J26618_1036906 | 3300002155 | Bacteria | 672 |
| 4 | JGI24751J29686_10093024 | 3300002459 | Bacteria | 628 |
| 5 | rootL2_10373202 | 3300003322 | Bacteria | 1530 |
| 6 | Ga0006562J51391_1019055 | 3300003578 | Bacteria | 1753 |
| 7 | Ga0006562J51391_1080180 | 3300003578 | Bacteria | 770 |
| 8 | Ga0055542_1008611 | 3300003762 | Bacteria | 1984 |
| 9 | Ga0065714_10069622 | 3300005288 | Bacteria | 4153 |
| 10 | Ga0070676_10071931 | 3300005328 | Bacteria | 2078 |
| 11 | Ga0070676_10627170 | 3300005328 | Bacteria | 778 |
| 12 | Ga0070676_11118059 | 3300005328 | Bacteria | 596 |
| 13 | Ga0070676_11263728 | 3300005328 | Bacteria | 563 |
| 14 | Ga0070670_100054834 | 3300005331 | Bacteria | 3422 |
| 15 | Ga0070670_100136544 | 3300005331 | Bacteria | 2119 |
| 16 | Ga0070677_10011090 | 3300005333 | Bacteria | 3098 |
| 17 | Ga0070677_10075589 | 3300005333 | Bacteria | 1428 |
| 18 | Ga0070668_100015329 | 3300005347 | Bacteria | 5727 |
| 19 | Ga0070675_100039713 | 3300005354 | Bacteria | 3841 |
| 20 | Ga0070675_100749728 | 3300005354 | Bacteria | 891 |
| 21 | Ga0070674_100027206 | 3300005356 | Bacteria | 3745 |
| 22 | Ga0070667_100088539 | 3300005367 | Bacteria | 2658 |
| 23 | Ga0070678_100735988 | 3300005456 | Bacteria | 891 |
| 24 | Ga0070699_100839927 | 3300005518 | Bacteria | 841 |
| 25 | Ga0070697_101334364 | 3300005536 | Bacteria | 640 |
| 26 | Ga0070672_100404564 | 3300005543 | Bacteria | 1170 |
| 27 | Ga0070696_100934192 | 3300005546 | Bacteria | 721 |
| 28 | Ga0070665_101425280 | 3300005548 | Bacteria | 702 |
| 29 | Ga0068863_100617497 | 3300005841 | Bacteria | 1074 |
| 30 | Ga0075432_10003310 | 3300006058 | Bacteria | 5446 |
| 31 | Ga0075432_10170953 | 3300006058 | Bacteria | 845 |
| 32 | Ga0068865_100841049 | 3300006881 | Bacteria | 794 |
| 33 | Ga0105251_10042362 | 3300009011 | Bacteria | 2211 |
| 34 | Ga0105244_10028914 | 3300009036 | Bacteria | 2969 |
| 35 | Ga0105244_10056924 | 3300009036 | Bacteria | 1977 |
| 36 | Ga0105244_10061991 | 3300009036 | Bacteria | 1880 |
| 37 | Ga0105245_10034394 | 3300009098 | Bacteria | 4495 |
| 38 | Ga0105247_10021321 | 3300009101 | Bacteria | 3899 |
| 39 | Ga0105243_10043166 | 3300009148 | Bacteria | 3533 |
| 40 | Ga0105243_10278711 | 3300009148 | Bacteria | 1505 |
| 41 | Ga0105241_10514089 | 3300009174 | Bacteria | 1070 |
| 42 | Ga0105242_10480720 | 3300009176 | Bacteria | 1177 |
| 43 | Ga0105242_10640447 | 3300009176 | Bacteria | 1032 |
| 44 | Ga0105248_10031532 | 3300009177 | Bacteria | 5923 |
| 45 | Ga0105249_10245049 | 3300009553 | Bacteria | 1774 |
| 46 | Ga0105246_10002805 | 3300011119 | Bacteria | 10547 |
| 47 | Ga0105246_10026481 | 3300011119 | Bacteria | 3789 |
| 48 | Ga0105246_10065742 | 3300011119 | Bacteria | 2536 |
| 49 | Ga0105246_10128600 | 3300011119 | Bacteria | 1888 |
| 50 | Ga0105246_10177149 | 3300011119 | Bacteria | 1638 |
| 51 | Ga0105246_10429932 | 3300011119 | Bacteria | 1104 |
| 52 | Ga0157373_10092824 | 3300013100 | Bacteria | 2126 |
| 53 | Ga0157369_10025840 | 3300013105 | Bacteria | 6514 |
| 54 | Ga0157369_10039571 | 3300013105 | Bacteria | 5152 |
| 55 | Ga0157369_10096845 | 3300013105 | Bacteria | 3147 |
| 56 | Ga0157369_10211257 | 3300013105 | Bacteria | 2034 |
| 57 | Ga0157369_11483726 | 3300013105 | Bacteria | 690 |
| 58 | Ga0157372_10621856 | 3300013307 | Bacteria | 1258 |
| 59 | Ga0163161_10016778 | 3300017792 | Bacteria | 5119 |
| 60 | Ga0209148_1005139 | 3300025254 | Bacteria | 3058 |
| 61 | Ga0207697_10006735 | 3300025315 | Bacteria | 5170 |
| 62 | Ga0207697_10027126 | 3300025315 | Bacteria | 2342 |
| 63 | Ga0207655_1007883 | 3300025728 | Bacteria | 6841 |
| 64 | Ga0207655_1067653 | 3300025728 | Bacteria | 1344 |
| 65 | Ga0207713_1049031 | 3300025735 | Bacteria | 1696 |
| 66 | Ga0207682_10017980 | 3300025893 | Bacteria | 2760 |
| 67 | Ga0207682_10043727 | 3300025893 | Bacteria | 1834 |
| 68 | Ga0207710_10523518 | 3300025900 | Bacteria | 616 |
| 69 | Ga0207688_10314830 | 3300025901 | Bacteria | 959 |
| 70 | Ga0207680_10146115 | 3300025903 | Bacteria | 1572 |
| 71 | Ga0207645_10001044 | 3300025907 | Bacteria | 22915 |
| 72 | Ga0207645_10213197 | 3300025907 | Bacteria | 1272 |
| 73 | Ga0207643_10402741 | 3300025908 | Bacteria | 865 |
| 74 | Ga0207694_10790850 | 3300025924 | Bacteria | 801 |
| 75 | Ga0207687_10215728 | 3300025927 | Bacteria | 1508 |
| 76 | Ga0207644_10047457 | 3300025931 | Bacteria | 3065 |
| 77 | Ga0207709_10028980 | 3300025935 | Bacteria | 3205 |
| 78 | Ga0207709_10080690 | 3300025935 | Bacteria | 2096 |
| 79 | Ga0207669_10236488 | 3300025937 | Bacteria | 1351 |
| 80 | Ga0207711_10298101 | 3300025941 | Bacteria | 1486 |
| 81 | Ga0207651_10822979 | 3300025960 | Bacteria | 824 |
| 82 | Ga0207712_10244646 | 3300025961 | Bacteria | 1447 |
| 83 | Ga0207668_10079700 | 3300025972 | Bacteria | 2370 |
| 84 | Ga0207658_10366604 | 3300025986 | Bacteria | 1258 |
| 85 | Ga0207641_10560864 | 3300026088 | Bacteria | 1115 |
| 86 | Ga0207683_10034132 | 3300026121 | Bacteria | 4421 |
| 87 | Ga0207428_10002227 | 3300027907 | Bacteria | 19465 |
| 88 | Ga0268266_12299448 | 3300028379 | Bacteria | 510 |
| 89 | Ga0307408_100006735 | 3300031548 | Bacteria | 7616 |
| 90 | Ga0307408_100021823 | 3300031548 | Bacteria | 4339 |
| 91 | Ga0307408_100031014 | 3300031548 | Bacteria | 3718 |
| 92 | Ga0307408_100038072 | 3300031548 | Bacteria | 3391 |
| 93 | Ga0307408_100058593 | 3300031548 | Bacteria | 2800 |
| 94 | Ga0307408_100070842 | 3300031548 | Bacteria | 2575 |
| 95 | Ga0307408_100119066 | 3300031548 | Bacteria | 2042 |
| 96 | Ga0307408_100211162 | 3300031548 | Bacteria | 1577 |
| 97 | Ga0307408_100449452 | 3300031548 | Bacteria | 1117 |
| 98 | Ga0307408_100532772 | 3300031548 | Bacteria | 1033 |
| 99 | Ga0307408_100839948 | 3300031548 | Bacteria | 836 |
| 100 | Ga0307408_101179335 | 3300031548 | Bacteria | 713 |
| 101 | Ga0307408_101316353 | 3300031548 | Bacteria | 678 |
| 102 | Ga0307405_10022163 | 3300031731 | Bacteria | 3586 |
| 103 | Ga0307405_10032197 | 3300031731 | Bacteria | 3097 |
| 104 | Ga0307405_10080074 | 3300031731 | Bacteria | 2131 |
| 105 | Ga0307405_10098652 | 3300031731 | Bacteria | 1953 |
| 106 | Ga0307405_10209957 | 3300031731 | Bacteria | 1420 |
| 107 | Ga0307405_10416900 | 3300031731 | Bacteria | 1055 |
| 108 | Ga0307405_10424681 | 3300031731 | Bacteria | 1047 |
| 109 | Ga0307405_10442251 | 3300031731 | Bacteria | 1028 |
| 110 | Ga0307405_11114959 | 3300031731 | Bacteria | 679 |
| 111 | Ga0307405_11172073 | 3300031731 | Bacteria | 663 |
| 112 | Ga0307405_11424868 | 3300031731 | Bacteria | 606 |
| 113 | Ga0307405_11813630 | 3300031731 | Bacteria | 542 |
| 114 | Ga0307413_10061103 | 3300031824 | Bacteria | 2323 |
| 115 | Ga0307413_10099881 | 3300031824 | Bacteria | 1914 |
| 116 | Ga0307413_10178210 | 3300031824 | Bacteria | 1512 |
| 117 | Ga0307413_10319461 | 3300031824 | Bacteria | 1185 |
| 118 | Ga0307413_10329734 | 3300031824 | Bacteria | 1169 |
| 119 | Ga0307413_10500737 | 3300031824 | Bacteria | 975 |
| 120 | Ga0307413_10544671 | 3300031824 | Bacteria | 940 |
| 121 | Ga0307413_10600630 | 3300031824 | Bacteria | 900 |
| 122 | Ga0307413_10662667 | 3300031824 | Bacteria | 862 |
| 123 | Ga0307413_11090850 | 3300031824 | Bacteria | 689 |
| 124 | Ga0307413_11498014 | 3300031824 | Bacteria | 596 |
| 125 | Ga0307410_10010168 | 3300031852 | Bacteria | 5319 |
| 126 | Ga0307410_10025034 | 3300031852 | Bacteria | 3737 |
| 127 | Ga0307410_10052798 | 3300031852 | Bacteria | 2747 |
| 128 | Ga0307410_10054481 | 3300031852 | Bacteria | 2712 |
| 129 | Ga0307410_10108740 | 3300031852 | Bacteria | 2002 |
| 130 | Ga0307410_10111026 | 3300031852 | Bacteria | 1984 |
| 131 | Ga0307410_10162069 | 3300031852 | Bacteria | 1677 |
| 132 | Ga0307410_10224216 | 3300031852 | Bacteria | 1447 |
| 133 | Ga0307410_10596853 | 3300031852 | Bacteria | 921 |
| 134 | Ga0307410_10700829 | 3300031852 | Bacteria | 853 |
| 135 | Ga0307410_10879612 | 3300031852 | Bacteria | 766 |
| 136 | Ga0307410_11846908 | 3300031852 | Bacteria | 537 |
| 137 | Ga0307406_10072699 | 3300031901 | Bacteria | 2258 |
| 138 | Ga0307406_10127707 | 3300031901 | Bacteria | 1779 |
| 139 | Ga0307406_10215698 | 3300031901 | Bacteria | 1423 |
| 140 | Ga0307406_10255423 | 3300031901 | Bacteria | 1323 |
| 141 | Ga0307406_10316396 | 3300031901 | Bacteria | 1205 |
| 142 | Ga0307406_10498191 | 3300031901 | Bacteria | 987 |
| 143 | Ga0307407_10015885 | 3300031903 | Bacteria | 3735 |
| 144 | Ga0307407_10021043 | 3300031903 | Bacteria | 3355 |
| 145 | Ga0307407_10023524 | 3300031903 | Bacteria | 3216 |
| 146 | Ga0307407_10155307 | 3300031903 | Bacteria | 1491 |
| 147 | Ga0307407_10188937 | 3300031903 | Bacteria | 1371 |
| 148 | Ga0307407_10196171 | 3300031903 | Bacteria | 1349 |
| 149 | Ga0307407_10361902 | 3300031903 | Bacteria | 1030 |
| 150 | Ga0307412_10004079 | 3300031911 | Bacteria | 8135 |
| 151 | Ga0307412_10014806 | 3300031911 | Bacteria | 4609 |
| 152 | Ga0307412_10016961 | 3300031911 | Bacteria | 4351 |
| 153 | Ga0307412_10019078 | 3300031911 | Bacteria | 4142 |
| 154 | Ga0307412_10062261 | 3300031911 | Bacteria | 2511 |
| 155 | Ga0307412_10101436 | 3300031911 | Bacteria | 2036 |
| 156 | Ga0307412_10127921 | 3300031911 | Bacteria | 1840 |
| 157 | Ga0307412_10218081 | 3300031911 | Bacteria | 1460 |
| 158 | Ga0307412_10256951 | 3300031911 | Bacteria | 1359 |
| 159 | Ga0307412_11305048 | 3300031911 | Bacteria | 653 |
| 160 | Ga0307409_100099466 | 3300031995 | Bacteria | 2408 |
| 161 | Ga0307409_100116501 | 3300031995 | Bacteria | 2252 |
| 162 | Ga0307409_100118096 | 3300031995 | Bacteria | 2239 |
| 163 | Ga0307409_100130387 | 3300031995 | Bacteria | 2147 |
| 164 | Ga0307409_100136836 | 3300031995 | Bacteria | 2104 |
| 165 | Ga0307409_100399320 | 3300031995 | Bacteria | 1312 |
| 166 | Ga0307409_100910707 | 3300031995 | Bacteria | 893 |
| 167 | Ga0307409_101244112 | 3300031995 | Bacteria | 768 |
| 168 | Ga0307409_101692944 | 3300031995 | Bacteria | 661 |
| 169 | Ga0307416_100017118 | 3300032002 | Bacteria | 5059 |
| 170 | Ga0307416_100026458 | 3300032002 | Bacteria | 4275 |
| 171 | Ga0307416_100032976 | 3300032002 | Bacteria | 3920 |
| 172 | Ga0307416_100065198 | 3300032002 | Bacteria | 2992 |
| 173 | Ga0307416_100101020 | 3300032002 | Bacteria | 2510 |
| 174 | Ga0307416_100108129 | 3300032002 | Bacteria | 2442 |
| 175 | Ga0307416_100119024 | 3300032002 | Bacteria | 2348 |
| 176 | Ga0307416_100139806 | 3300032002 | Bacteria | 2198 |
| 177 | Ga0307416_100447511 | 3300032002 | Bacteria | 1343 |
| 178 | Ga0307416_100494239 | 3300032002 | Bacteria | 1286 |
| 179 | Ga0307416_100660408 | 3300032002 | Bacteria | 1131 |
| 180 | Ga0307416_101008662 | 3300032002 | Bacteria | 936 |
| 181 | Ga0307416_101741592 | 3300032002 | Bacteria | 727 |
| 182 | Ga0307416_101849165 | 3300032002 | Bacteria | 707 |
| 183 | Ga0307414_10043371 | 3300032004 | Bacteria | 3064 |
| 184 | Ga0307414_10104000 | 3300032004 | Bacteria | 2144 |
| 185 | Ga0307414_10171502 | 3300032004 | Bacteria | 1735 |
| 186 | Ga0307414_10232320 | 3300032004 | Bacteria | 1521 |
| 187 | Ga0307414_10318708 | 3300032004 | Bacteria | 1322 |
| 188 | Ga0307414_10341143 | 3300032004 | Bacteria | 1283 |
| 189 | Ga0307414_10490679 | 3300032004 | Bacteria | 1085 |
| 190 | Ga0307414_10538021 | 3300032004 | Bacteria | 1039 |
| 191 | Ga0307414_10726724 | 3300032004 | Bacteria | 901 |
| 192 | Ga0307414_10769366 | 3300032004 | Bacteria | 876 |
| 193 | Ga0307414_10860905 | 3300032004 | Bacteria | 829 |
| 194 | Ga0307411_10078260 | 3300032005 | Bacteria | 2266 |
| 195 | Ga0307411_10112544 | 3300032005 | Bacteria | 1951 |
| 196 | Ga0307411_10284862 | 3300032005 | Bacteria | 1317 |
| 197 | Ga0307411_10361623 | 3300032005 | Bacteria | 1187 |
| 198 | Ga0307415_100005330 | 3300032126 | Bacteria | 6813 |
| 199 | Ga0307415_100041059 | 3300032126 | Bacteria | 3069 |
| 200 | Ga0307415_100290465 | 3300032126 | Bacteria | 1349 |
| 201 | Ga0307415_100490235 | 3300032126 | Bacteria | 1072 |
| 202 | Ga0307415_100856295 | 3300032126 | Bacteria | 834 |
| 203 | Ga0395899_0006118 | 3300037312 | Bacteria | 9325 |
| 204 | Ga0395899_0092664 | 3300037312 | Bacteria | 2188 |
| 205 | Ga0395899_0108266 | 3300037312 | Bacteria | 2000 |
| 206 | Ga0395899_0247832 | 3300037312 | Bacteria | 1223 |
| 207 | Ga0395900_0066192 | 3300037418 | Bacteria | 3713 |
| 208 | Ga0395900_0167897 | 3300037418 | Bacteria | 2235 |
| 209 | Ga0395900_0421008 | 3300037418 | Bacteria | 1296 |
| 210 | Ga0395898_0173736 | 3300037466 | Bacteria | 2059 |
| 211 | Ga0395898_0264484 | 3300037466 | Bacteria | 1640 |
| 212 | Ga0395905_0894198 | 3300037471 | Bacteria | 791 |
| 213 | Ga0395901_0050834 | 3300038443 | Bacteria | 4306 |
| 214 | Ga0395901_0216983 | 3300038443 | Bacteria | 2000 |
| 215 | Ga0395901_0897928 | 3300038443 | Bacteria | 868 |
| 216 | Ga0439436_0000555 | 3300041404 | Bacteria | 9831 |
| 217 | Ga0439438_064307 | 3300041405 | Bacteria | 915 |
| 218 | Ga0439438_083429 | 3300041405 | Bacteria | 783 |
| 219 | Ga0439447_112563 | 3300041407 | Bacteria | 624 |
| 220 | Ga0439447_113064 | 3300041407 | Bacteria | 623 |
| 221 | Ga0439461_0003845 | 3300041410 | Bacteria | 2486 |
| 222 | Ga0439466_0009906 | 3300041411 | Bacteria | 3547 |
| 223 | Ga0439466_0034515 | 3300041411 | Bacteria | 1715 |
| 224 | Ga0439465_0228255 | 3300041413 | Bacteria | 684 |
| 225 | Ga0439431_0022897 | 3300041997 | Bacteria | 1509 |
| 226 | Ga0439433_0000118 | 3300041999 | Bacteria | 11441 |
| 227 | Ga0439442_000026 | 3300042002 | Bacteria | 35791 |
| 228 | Ga0439442_000036 | 3300042002 | Bacteria | 30155 |
| 229 | Ga0439442_000998 | 3300042002 | Bacteria | 5716 |
| 230 | Ga0439442_002353 | 3300042002 | Bacteria | 3710 |
| 231 | Ga0439442_003636 | 3300042002 | Bacteria | 3052 |
| 232 | Ga0439442_015109 | 3300042002 | Bacteria | 1590 |
| 233 | Ga0439449_0000634 | 3300042007 | Bacteria | 13197 |
| 234 | Ga0439449_0000848 | 3300042007 | Bacteria | 11868 |
| 235 | Ga0439449_0006196 | 3300042007 | Bacteria | 4573 |
| 236 | Ga0439449_0042422 | 3300042007 | Bacteria | 1690 |
| 237 | Ga0439452_030745 | 3300042010 | Bacteria | 1322 |
| 238 | Ga0439452_031643 | 3300042010 | Bacteria | 1297 |
| 239 | Ga0439452_132008 | 3300042010 | Bacteria | 529 |
| 240 | Ga0439457_001839 | 3300042014 | Bacteria | 6253 |
| 241 | Ga0439457_011338 | 3300042014 | Bacteria | 2030 |
| 242 | Ga0439462_0010745 | 3300042015 | Bacteria | 2322 |
| 243 | Ga0439462_0040593 | 3300042015 | Bacteria | 1241 |
| 244 | Ga0450920_000035 | 3300042122 | Bacteria | 16140 |
| 245 | Ga0450920_022995 | 3300042122 | Bacteria | 1208 |
| 246 | Ga0450907_000119 | 3300042146 | Bacteria | 30100 |
| 247 | Ga0439434_0001103 | 3300042435 | Bacteria | 7816 |
| 248 | Ga0439434_0001109 | 3300042435 | Bacteria | 7787 |
| 249 | Ga0450918_001560 | 3300042531 | Bacteria | 4525 |
| 250 | Ga0466970_0287293 | 3300044765 | Bacteria | 926 |
| 251 | Ga0495629_0305468 | 3300046459 | Bacteria | 1089 |
| 252 | Ga0495638_0235380 | 3300046460 | Bacteria | 1017 |
| 253 | Ga0495653_0000808 | 3300046463 | Bacteria | 24075 |
| 254 | Ga0495580_0567456 | 3300046472 | Bacteria | 752 |
| 255 | Ga0495582_0028251 | 3300046473 | Bacteria | 3078 |
| 256 | Ga0495582_0591313 | 3300046473 | Bacteria | 642 |
| 257 | Ga0495639_0027196 | 3300046475 | Bacteria | 2531 |
| 258 | Ga0495662_0032708 | 3300046476 | Bacteria | 2513 |
| 259 | Ga0495664_0046593 | 3300046477 | Bacteria | 2572 |
| 260 | Ga0495594_0157516 | 3300046499 | Bacteria | 1290 |
| 261 | Ga0495594_0405121 | 3300046499 | Bacteria | 776 |
| 262 | Ga0495583_0400033 | 3300046506 | Bacteria | 540 |
| 263 | Ga0495606_0586605 | 3300046507 | Bacteria | 549 |
| 264 | Ga0495663_0171291 | 3300046525 | Bacteria | 749 |
| 265 | Ga0495642_0011901 | 3300046528 | Bacteria | 3351 |
| 266 | Ga0495652_0822489 | 3300046529 | Bacteria | 617 |
| 267 | Ga0495665_0103934 | 3300046531 | Bacteria | 1490 |
| 268 | Ga0495586_0004268 | 3300046535 | Bacteria | 7641 |
| 269 | Ga0495586_0140949 | 3300046535 | Bacteria | 1353 |
| 270 | Ga0495587_0002080 | 3300046536 | Bacteria | 13364 |
| 271 | Ga0495645_0008233 | 3300046543 | Bacteria | 7272 |
| 272 | Ga0495622_0123248 | 3300046557 | Bacteria | 1183 |
| 273 | Ga0495633_0203945 | 3300046558 | Bacteria | 907 |
| 274 | Ga0495633_0273543 | 3300046558 | Bacteria | 769 |
| 275 | Ga0495633_0351885 | 3300046558 | Bacteria | 667 |
| 276 | Ga0495667_0000752 | 3300046559 | Bacteria | 20843 |
| 277 | Ga0495656_0041867 | 3300046615 | Bacteria | 1916 |
| 278 | Ga0495656_0106446 | 3300046615 | Bacteria | 1305 |
| 279 | Ga0495656_0191874 | 3300046615 | Bacteria | 1009 |
| 280 | Ga0495668_0042948 | 3300046616 | Bacteria | 2515 |
| 281 | Ga0495635_0107789 | 3300046663 | Bacteria | 1903 |
| 282 | Ga0495659_0081761 | 3300046664 | Bacteria | 1227 |
| 283 | Ga0495588_0001140 | 3300046674 | Bacteria | 11431 |
| 284 | Ga0495588_0036987 | 3300046674 | Bacteria | 2479 |
| 285 | Ga0495657_0798336 | 3300046675 | Bacteria | 539 |
| 286 | Ga0495623_0009352 | 3300046679 | Bacteria | 6366 |
| 287 | Ga0495613_0119209 | 3300046689 | Bacteria | 1896 |
| 288 | Ga0495670_0023694 | 3300046691 | Bacteria | 3030 |
| 289 | Ga0495670_0036601 | 3300046691 | Bacteria | 2445 |
| 290 | Ga0495670_0046806 | 3300046691 | Bacteria | 2161 |
| 291 | Ga0495670_0226777 | 3300046691 | Bacteria | 993 |
| 292 | Ga0495600_0002761 | 3300046809 | Bacteria | 10170 |
| 293 | Ga0495581_0001305 | 3300047315 | Bacteria | 13758 |
| 294 | Ga0495581_0007200 | 3300047315 | Bacteria | 6439 |
| 295 | Ga0495581_0053568 | 3300047315 | Bacteria | 2330 |
| 296 | Ga0495581_0107619 | 3300047315 | Bacteria | 1621 |
| 297 | Ga0495636_0146885 | 3300047318 | Bacteria | 1056 |
| 298 | Ga0495680_0006689 | 3300047322 | Bacteria | 10673 |
| 299 | Ga0495675_0026687 | 3300047444 | Bacteria | 3682 |
| 300 | Ga0495677_0066490 | 3300047445 | Bacteria | 1341 |
| 301 | Ga0495685_122574 | 3300047447 | Bacteria | 853 |
| 302 | Ga0495681_0099125 | 3300047470 | Bacteria | 1276 |
| 303 | Ga0495684_0073743 | 3300047471 | Bacteria | 2593 |
| 304 | Ga0495593_0184892 | 3300047673 | Bacteria | 1049 |
| 305 | Ga0496100_0049210 | 3300048903 | Bacteria | 2724 |
| 306 | Ga0496100_0572077 | 3300048903 | Bacteria | 875 |
| 307 | Ga0496101_0070516 | 3300048904 | Bacteria | 2559 |
| 308 | Ga0496101_0494068 | 3300048904 | Bacteria | 967 |
| 309 | Ga0496102_0056358 | 3300048905 | Bacteria | 3585 |
| 310 | Ga0496102_0095346 | 3300048905 | Bacteria | 2757 |
| 311 | Ga0496102_0122583 | 3300048905 | Bacteria | 2428 |
| 312 | Ga0496102_0147147 | 3300048905 | Bacteria | 2211 |
| 313 | Ga0496103_0076803 | 3300048906 | Bacteria | 2096 |
| 314 | Ga0496103_0096210 | 3300048906 | Bacteria | 1871 |
| 315 | Ga0496103_0448566 | 3300048906 | Bacteria | 827 |
| 316 | Ga0496104_0039807 | 3300048907 | Bacteria | 4402 |
| 317 | Ga0496105_0399878 | 3300048908 | Bacteria | 1090 |
| 318 | Ga0496105_0854322 | 3300048908 | Bacteria | 688 |
| 319 | Ga0496106_0188918 | 3300048909 | Bacteria | 1637 |
| 320 | Ga0496106_0231724 | 3300048909 | Bacteria | 1474 |
| 321 | Ga0496107_0056350 | 3300048910 | Bacteria | 2839 |
| 322 | Ga0496108_0054346 | 3300048911 | Bacteria | 3360 |
| 323 | Ga0496109_0101626 | 3300048912 | Bacteria | 2668 |
| 324 | Ga0496111_0295664 | 3300048914 | Bacteria | 1200 |
| 325 | Ga0496112_0224932 | 3300048915 | Bacteria | 1832 |
| 326 | Ga0496112_0337902 | 3300048915 | Bacteria | 1450 |
| 327 | Ga0496112_0514552 | 3300048915 | Bacteria | 1132 |
| 328 | Ga0496112_1182573 | 3300048915 | Bacteria | 682 |
| 329 | Ga0496113_0718898 | 3300048916 | Bacteria | 796 |
| 330 | Ga0496113_0754059 | 3300048916 | Bacteria | 775 |
| 331 | Ga0496113_1013583 | 3300048916 | Bacteria | 653 |
| 332 | Ga0496119_0064885 | 3300048922 | Bacteria | 2166 |
| 333 | Ga0496119_0254598 | 3300048922 | Bacteria | 884 |
| 334 | Ga0496124_0140643 | 3300048927 | Bacteria | 1905 |
| 335 | Ga0496125_0237912 | 3300048928 | Bacteria | 1159 |
| 336 | Ga0496126_0349954 | 3300048929 | Bacteria | 1209 |
| 337 | Ga0501306_002787 | 3300049127 | Bacteria | 1824 |
| 338 | Ga0501306_060686 | 3300049127 | Bacteria | 623 |
| 339 | Ga0501310_043004 | 3300049130 | Bacteria | 634 |
| 340 | Ga0501317_024445 | 3300049533 | Bacteria | 841 |
| 341 | Ga0501317_034600 | 3300049533 | Bacteria | 749 |
| 342 | Ga0501318_046007 | 3300049534 | Bacteria | 637 |
| 343 | Ga0501321_012879 | 3300049537 | Bacteria | 953 |
| 344 | Ga0501323_018511 | 3300049539 | Bacteria | 902 |
| 345 | Ga0501330_012201 | 3300049546 | Bacteria | 627 |
| 346 | Ga0501032_0001520 | 3300049569 | Bacteria | 18495 |
| 347 | Ga0501032_0005264 | 3300049569 | Bacteria | 9625 |
| 348 | Ga0501034_0002817 | 3300049571 | Bacteria | 20325 |
| 349 | Ga0501036_0096539 | 3300049572 | Bacteria | 2499 |
| 350 | Ga0501037_0048601 | 3300049573 | Bacteria | 3107 |
| 351 | Ga0501037_0072207 | 3300049573 | Bacteria | 2510 |
| 352 | Ga0501037_0688173 | 3300049573 | Bacteria | 681 |
| 353 | Ga0501037_0874937 | 3300049573 | Bacteria | 590 |
| 354 | Ga0501038_0046846 | 3300049574 | Bacteria | 3747 |
| 355 | Ga0501038_0141877 | 3300049574 | Bacteria | 1965 |
| 356 | Ga0501038_0182788 | 3300049574 | Bacteria | 1691 |
| 357 | Ga0501039_0029125 | 3300049575 | Bacteria | 4252 |
| 358 | Ga0501039_0147075 | 3300049575 | Bacteria | 1851 |
| 359 | Ga0501039_0772217 | 3300049575 | Bacteria | 750 |
| 360 | Ga0501043_0006608 | 3300049579 | Bacteria | 9288 |
| 361 | Ga0501043_0138378 | 3300049579 | Bacteria | 1907 |
| 362 | Ga0501070_0136906 | 3300049586 | Bacteria | 2022 |
| 363 | Ga0501079_1303160 | 3300049741 | Bacteria | 572 |
| 364 | Ga0501279_014139 | 3300049775 | Bacteria | 1097 |
| 365 | Ga0501279_105949 | 3300049775 | Bacteria | 511 |
| 366 | Ga0501044_0715534 | 3300049823 | Bacteria | 886 |
| 367 | Ga0501212_074844 | 3300049851 | Bacteria | 605 |
| 368 | Ga0587072_003702 | 3300059643 | Bacteria | 2169 |
| 369 | 2691512499 | 2690315906 | Bacteria | 4517044 |
| 370 | 2775657734 | 2775506735 | Bacteria | 4556596 |
| 371 | 2808829749 | 2808606357 | Bacteria | 4466944 |
| 372 | 2808850929 | 2808606360 | Bacteria | 4404006 |
| 373 | 2808876561 | 2808606366 | Bacteria | 4415912 |
| 374 | 2808894003 | 2808606370 | Bacteria | 4942454 |
| 375 | 2808898057 | 2808606371 | Bacteria | 4251511 |
| 376 | 2812318549 | 2811994871 | Bacteria | 4497550 |
| 377 | 2857744282 | 2857740372 | Bacteria | 4782044 |
| 378 | 2904497531 | 2904497146 | Bacteria | 4731781 |
| 379 | 2919038942 | 2919034639 | Bacteria | 4763403 |
| 380 | 2919391896 | 2919391150 | Bacteria | 4884741 |
| 381 | 2919539832 | 2919538618 | Bacteria | 4677069 |
| 382 | 2932428682 | 2932426870 | Bacteria | 4547726 |
| 383 | 2933421479 | 2933418574 | Bacteria | 4476724 |
| 384 | 2939600850 | 2939598168 | Bacteria | 4687164 |
| 385 | 2939647586 | 2939647034 | Bacteria | 4681660 |
| 386 | 2939676364 | 2939674588 | Bacteria | 4844420 |
| 387 | 2945916309 | 2945916053 | Bacteria | 4555517 |
| 388 | 2945923551 | 2945920336 | Bacteria | 4501603 |
| 389 | 2945944781 | 2945941187 | Bacteria | 4682474 |
| 390 | 2945956990 | 2945956166 | Bacteria | 5110334 |
| 391 | 2946040723 | 2946037020 | Bacteria | 4900426 |
| 392 | 2946060103 | 2946059875 | Bacteria | 4386623 |
| 393 | 2954001964 | 2953998280 | Bacteria | 4812144 |
| 394 | 2974304259 | 2974302888 | Bacteria | 4369871 |
| 395 | 8054109177 | 8054107350 | Bacteria | 5022511 |
| 396 | rootH2_10188592 | |||
| 397 | JGI24035J26624_1028601 | |||
| 398 | JGI24033J26618_1036906 | |||
| 399 | JGI24751J29686_10093024 | |||
| 400 | rootL2_10373202 | |||
| 401 | Ga0006562J51391_1019055 | |||
| 402 | Ga0006562J51391_1080180 | |||
| 403 | Ga0055542_1008611 | |||
| 404 | Ga0065714_10069622 | |||
| 405 | Ga0070676_10071931 | |||
| 406 | Ga0070676_10627170 | |||
| 407 | Ga0070676_11118059 | |||
| 408 | Ga0070676_11263728 | |||
| 409 | Ga0070670_100054834 | |||
| 410 | Ga0070670_100136544 | |||
| 411 | Ga0070677_10011090 | |||
| 412 | Ga0070677_10075589 | |||
| 413 | Ga0070668_100015329 | |||
| 414 | Ga0070675_100039713 | |||
| 415 | Ga0070675_100749728 | |||
| 416 | Ga0070674_100027206 | |||
| 417 | Ga0070667_100088539 | |||
| 418 | Ga0070678_100735988 | |||
| 419 | Ga0070699_100839927 | |||
| 420 | Ga0070697_101334364 | |||
| 421 | Ga0070672_100404564 | |||
| 422 | Ga0070696_100934192 | |||
| 423 | Ga0070665_101425280 | |||
| 424 | Ga0068863_100617497 | |||
| 425 | Ga0075432_10003310 | |||
| 426 | Ga0075432_10170953 | |||
| 427 | Ga0068865_100841049 | |||
| 428 | Ga0105251_10042362 | |||
| 429 | Ga0105244_10028914 | |||
| 430 | Ga0105244_10056924 | |||
| 431 | Ga0105244_10061991 | |||
| 432 | Ga0105245_10034394 | |||
| 433 | Ga0105247_10021321 | |||
| 434 | Ga0105243_10043166 | |||
| 435 | Ga0105243_10278711 | |||
| 436 | Ga0105241_10514089 | |||
| 437 | Ga0105242_10480720 | |||
| 438 | Ga0105242_10640447 | |||
| 439 | Ga0105248_10031532 | |||
| 440 | Ga0105249_10245049 | |||
| 441 | Ga0105246_10002805 | |||
| 442 | Ga0105246_10026481 | |||
| 443 | Ga0105246_10065742 | |||
| 444 | Ga0105246_10128600 | |||
| 445 | Ga0105246_10177149 | |||
| 446 | Ga0105246_10429932 | |||
| 447 | Ga0157373_10092824 | |||
| 448 | Ga0157369_10025840 | |||
| 449 | Ga0157369_10039571 | |||
| 450 | Ga0157369_10096845 | |||
| 451 | Ga0157369_10211257 | |||
| 452 | Ga0157369_11483726 | |||
| 453 | Ga0157372_10621856 | |||
| 454 | Ga0163161_10016778 | |||
| 455 | Ga0209148_1005139 | |||
| 456 | Ga0207697_10006735 | |||
| 457 | Ga0207697_10027126 | |||
| 458 | Ga0207655_1007883 | |||
| 459 | Ga0207655_1067653 | |||
| 460 | Ga0207713_1049031 | |||
| 461 | Ga0207682_10017980 | |||
| 462 | Ga0207682_10043727 | |||
| 463 | Ga0207710_10523518 | |||
| 464 | Ga0207688_10314830 | |||
| 465 | Ga0207680_10146115 | |||
| 466 | Ga0207645_10001044 | |||
| 467 | Ga0207645_10213197 | |||
| 468 | Ga0207643_10402741 | |||
| 469 | Ga0207694_10790850 | |||
| 470 | Ga0207687_10215728 | |||
| 471 | Ga0207644_10047457 | |||
| 472 | Ga0207709_10028980 | |||
| 473 | Ga0207709_10080690 | |||
| 474 | Ga0207669_10236488 | |||
| 475 | Ga0207711_10298101 | |||
| 476 | Ga0207651_10822979 | |||
| 477 | Ga0207712_10244646 | |||
| 478 | Ga0207668_10079700 | |||
| 479 | Ga0207658_10366604 | |||
| 480 | Ga0207641_10560864 | |||
| 481 | Ga0207683_10034132 | |||
| 482 | Ga0207428_10002227 | |||
| 483 | Ga0268266_12299448 | |||
| 484 | Ga0307408_100006735 | |||
| 485 | Ga0307408_100021823 | |||
| 486 | Ga0307408_100031014 | |||
| 487 | Ga0307408_100038072 | |||
| 488 | Ga0307408_100058593 | |||
| 489 | Ga0307408_100070842 | |||
| 490 | Ga0307408_100119066 | |||
| 491 | Ga0307408_100211162 | |||
| 492 | Ga0307408_100449452 | |||
| 493 | Ga0307408_100532772 | |||
| 494 | Ga0307408_100839948 | |||
| 495 | Ga0307408_101179335 | |||
| 496 | Ga0307408_101316353 | |||
| 497 | Ga0307405_10022163 | |||
| 498 | Ga0307405_10032197 | |||
| 499 | Ga0307405_10080074 | |||
| 500 | Ga0307405_10098652 | |||
| 501 | Ga0307405_10209957 | |||
| 502 | Ga0307405_10416900 | |||
| 503 | Ga0307405_10424681 | |||
| 504 | Ga0307405_10442251 | |||
| 505 | Ga0307405_11114959 | |||
| 506 | Ga0307405_11172073 | |||
| 507 | Ga0307405_11424868 | |||
| 508 | Ga0307405_11813630 | |||
| 509 | Ga0307413_10061103 | |||
| 510 | Ga0307413_10099881 | |||
| 511 | Ga0307413_10178210 | |||
| 512 | Ga0307413_10319461 | |||
| 513 | Ga0307413_10329734 | |||
| 514 | Ga0307413_10500737 | |||
| 515 | Ga0307413_10544671 | |||
| 516 | Ga0307413_10600630 | |||
| 517 | Ga0307413_10662667 | |||
| 518 | Ga0307413_11090850 | |||
| 519 | Ga0307413_11498014 | |||
| 520 | Ga0307410_10010168 | |||
| 521 | Ga0307410_10025034 | |||
| 522 | Ga0307410_10052798 | |||
| 523 | Ga0307410_10054481 | |||
| 524 | Ga0307410_10108740 | |||
| 525 | Ga0307410_10111026 | |||
| 526 | Ga0307410_10162069 | |||
| 527 | Ga0307410_10224216 | |||
| 528 | Ga0307410_10596853 | |||
| 529 | Ga0307410_10700829 | |||
| 530 | Ga0307410_10879612 | |||
| 531 | Ga0307410_11846908 | |||
| 532 | Ga0307406_10072699 | |||
| 533 | Ga0307406_10127707 | |||
| 534 | Ga0307406_10215698 | |||
| 535 | Ga0307406_10255423 | |||
| 536 | Ga0307406_10316396 | |||
| 537 | Ga0307406_10498191 | |||
| 538 | Ga0307407_10015885 | |||
| 539 | Ga0307407_10021043 | |||
| 540 | Ga0307407_10023524 | |||
| 541 | Ga0307407_10155307 | |||
| 542 | Ga0307407_10188937 | |||
| 543 | Ga0307407_10196171 | |||
| 544 | Ga0307407_10361902 | |||
| 545 | Ga0307412_10004079 | |||
| 546 | Ga0307412_10014806 | |||
| 547 | Ga0307412_10016961 | |||
| 548 | Ga0307412_10019078 | |||
| 549 | Ga0307412_10062261 | |||
| 550 | Ga0307412_10101436 | |||
| 551 | Ga0307412_10127921 | |||
| 552 | Ga0307412_10218081 | |||
| 553 | Ga0307412_10256951 | |||
| 554 | Ga0307412_11305048 | |||
| 555 | Ga0307409_100099466 | |||
| 556 | Ga0307409_100116501 | |||
| 557 | Ga0307409_100118096 | |||
| 558 | Ga0307409_100130387 | |||
| 559 | Ga0307409_100136836 | |||
| 560 | Ga0307409_100399320 | |||
| 561 | Ga0307409_100910707 | |||
| 562 | Ga0307409_101244112 | |||
| 563 | Ga0307409_101692944 | |||
| 564 | Ga0307416_100017118 | |||
| 565 | Ga0307416_100026458 | |||
| 566 | Ga0307416_100032976 | |||
| 567 | Ga0307416_100065198 | |||
| 568 | Ga0307416_100101020 | |||
| 569 | Ga0307416_100108129 | |||
| 570 | Ga0307416_100119024 | |||
| 571 | Ga0307416_100139806 | |||
| 572 | Ga0307416_100447511 | |||
| 573 | Ga0307416_100494239 | |||
| 574 | Ga0307416_100660408 | |||
| 575 | Ga0307416_101008662 | |||
| 576 | Ga0307416_101741592 | |||
| 577 | Ga0307416_101849165 | |||
| 578 | Ga0307414_10043371 | |||
| 579 | Ga0307414_10104000 | |||
| 580 | Ga0307414_10171502 | |||
| 581 | Ga0307414_10232320 | |||
| 582 | Ga0307414_10318708 | |||
| 583 | Ga0307414_10341143 | |||
| 584 | Ga0307414_10490679 | |||
| 585 | Ga0307414_10538021 | |||
| 586 | Ga0307414_10726724 | |||
| 587 | Ga0307414_10769366 | |||
| 588 | Ga0307414_10860905 | |||
| 589 | Ga0307411_10078260 | |||
| 590 | Ga0307411_10112544 | |||
| 591 | Ga0307411_10284862 | |||
| 592 | Ga0307411_10361623 | |||
| 593 | Ga0307415_100005330 | |||
| 594 | Ga0307415_100041059 | |||
| 595 | Ga0307415_100290465 | |||
| 596 | Ga0307415_100490235 | |||
| 597 | Ga0307415_100856295 | |||
| 598 | Ga0395899_0006118 | |||
| 599 | Ga0395899_0092664 | |||
| 600 | Ga0395899_0108266 | |||
| 601 | Ga0395899_0247832 | |||
| 602 | Ga0395900_0066192 | |||
| 603 | Ga0395900_0167897 | |||
| 604 | Ga0395900_0421008 | |||
| 605 | Ga0395898_0173736 | |||
| 606 | Ga0395898_0264484 | |||
| 607 | Ga0395905_0894198 | |||
| 608 | Ga0395901_0050834 | |||
| 609 | Ga0395901_0216983 | |||
| 610 | Ga0395901_0897928 | |||
| 611 | Ga0439436_0000555 | |||
| 612 | Ga0439438_064307 | |||
| 613 | Ga0439438_083429 | |||
| 614 | Ga0439447_112563 | |||
| 615 | Ga0439447_113064 | |||
| 616 | Ga0439461_0003845 | |||
| 617 | Ga0439466_0009906 | |||
| 618 | Ga0439466_0034515 | |||
| 619 | Ga0439465_0228255 | |||
| 620 | Ga0439431_0022897 | |||
| 621 | Ga0439433_0000118 | |||
| 622 | Ga0439442_000026 | |||
| 623 | Ga0439442_000036 | |||
| 624 | Ga0439442_000998 | |||
| 625 | Ga0439442_002353 | |||
| 626 | Ga0439442_003636 | |||
| 627 | Ga0439442_015109 | |||
| 628 | Ga0439449_0000634 | |||
| 629 | Ga0439449_0000848 | |||
| 630 | Ga0439449_0006196 | |||
| 631 | Ga0439449_0042422 | |||
| 632 | Ga0439452_030745 | |||
| 633 | Ga0439452_031643 | |||
| 634 | Ga0439452_132008 | |||
| 635 | Ga0439457_001839 | |||
| 636 | Ga0439457_011338 | |||
| 637 | Ga0439462_0010745 | |||
| 638 | Ga0439462_0040593 | |||
| 639 | Ga0450920_000035 | |||
| 640 | Ga0450920_022995 | |||
| 641 | Ga0450907_000119 | |||
| 642 | Ga0439434_0001103 | |||
| 643 | Ga0439434_0001109 | |||
| 644 | Ga0450918_001560 | |||
| 645 | Ga0466970_0287293 | |||
| 646 | Ga0495629_0305468 | |||
| 647 | Ga0495638_0235380 | |||
| 648 | Ga0495653_0000808 | |||
| 649 | Ga0495580_0567456 | |||
| 650 | Ga0495582_0028251 | |||
| 651 | Ga0495582_0591313 | |||
| 652 | Ga0495639_0027196 | |||
| 653 | Ga0495662_0032708 | |||
| 654 | Ga0495664_0046593 | |||
| 655 | Ga0495594_0157516 | |||
| 656 | Ga0495594_0405121 | |||
| 657 | Ga0495583_0400033 | |||
| 658 | Ga0495606_0586605 | |||
| 659 | Ga0495663_0171291 | |||
| 660 | Ga0495642_0011901 | |||
| 661 | Ga0495652_0822489 | |||
| 662 | Ga0495665_0103934 | |||
| 663 | Ga0495586_0004268 | |||
| 664 | Ga0495586_0140949 | |||
| 665 | Ga0495587_0002080 | |||
| 666 | Ga0495645_0008233 | |||
| 667 | Ga0495622_0123248 | |||
| 668 | Ga0495633_0203945 | |||
| 669 | Ga0495633_0273543 | |||
| 670 | Ga0495633_0351885 | |||
| 671 | Ga0495667_0000752 | |||
| 672 | Ga0495656_0041867 | |||
| 673 | Ga0495656_0106446 | |||
| 674 | Ga0495656_0191874 | |||
| 675 | Ga0495668_0042948 | |||
| 676 | Ga0495635_0107789 | |||
| 677 | Ga0495659_0081761 | |||
| 678 | Ga0495588_0001140 | |||
| 679 | Ga0495588_0036987 | |||
| 680 | Ga0495657_0798336 | |||
| 681 | Ga0495623_0009352 | |||
| 682 | Ga0495613_0119209 | |||
| 683 | Ga0495670_0023694 | |||
| 684 | Ga0495670_0036601 | |||
| 685 | Ga0495670_0046806 | |||
| 686 | Ga0495670_0226777 | |||
| 687 | Ga0495600_0002761 | |||
| 688 | Ga0495581_0001305 | |||
| 689 | Ga0495581_0007200 | |||
| 690 | Ga0495581_0053568 | |||
| 691 | Ga0495581_0107619 | |||
| 692 | Ga0495636_0146885 | |||
| 693 | Ga0495680_0006689 | |||
| 694 | Ga0495675_0026687 | |||
| 695 | Ga0495677_0066490 | |||
| 696 | Ga0495685_122574 | |||
| 697 | Ga0495681_0099125 | |||
| 698 | Ga0495684_0073743 | |||
| 699 | Ga0495593_0184892 | |||
| 700 | Ga0496100_0049210 | |||
| 701 | Ga0496100_0572077 | |||
| 702 | Ga0496101_0070516 | |||
| 703 | Ga0496101_0494068 | |||
| 704 | Ga0496102_0056358 | |||
| 705 | Ga0496102_0095346 | |||
| 706 | Ga0496102_0122583 | |||
| 707 | Ga0496102_0147147 | |||
| 708 | Ga0496103_0076803 | |||
| 709 | Ga0496103_0096210 | |||
| 710 | Ga0496103_0448566 | |||
| 711 | Ga0496104_0039807 | |||
| 712 | Ga0496105_0399878 | |||
| 713 | Ga0496105_0854322 | |||
| 714 | Ga0496106_0188918 | |||
| 715 | Ga0496106_0231724 | |||
| 716 | Ga0496107_0056350 | |||
| 717 | Ga0496108_0054346 | |||
| 718 | Ga0496109_0101626 | |||
| 719 | Ga0496111_0295664 | |||
| 720 | Ga0496112_0224932 | |||
| 721 | Ga0496112_0337902 | |||
| 722 | Ga0496112_0514552 | |||
| 723 | Ga0496112_1182573 | |||
| 724 | Ga0496113_0718898 | |||
| 725 | Ga0496113_0754059 | |||
| 726 | Ga0496113_1013583 | |||
| 727 | Ga0496119_0064885 | |||
| 728 | Ga0496119_0254598 | |||
| 729 | Ga0496124_0140643 | |||
| 730 | Ga0496125_0237912 | |||
| 731 | Ga0496126_0349954 | |||
| 732 | Ga0501306_002787 | |||
| 733 | Ga0501306_060686 | |||
| 734 | Ga0501310_043004 | |||
| 735 | Ga0501317_024445 | |||
| 736 | Ga0501317_034600 | |||
| 737 | Ga0501318_046007 | |||
| 738 | Ga0501321_012879 | |||
| 739 | Ga0501323_018511 | |||
| 740 | Ga0501330_012201 | |||
| 741 | Ga0501032_0001520 | |||
| 742 | Ga0501032_0005264 | |||
| 743 | Ga0501034_0002817 | |||
| 744 | Ga0501036_0096539 | |||
| 745 | Ga0501037_0048601 | |||
| 746 | Ga0501037_0072207 | |||
| 747 | Ga0501037_0688173 | |||
| 748 | Ga0501037_0874937 | |||
| 749 | Ga0501038_0046846 | |||
| 750 | Ga0501038_0141877 | |||
| 751 | Ga0501038_0182788 | |||
| 752 | Ga0501039_0029125 | |||
| 753 | Ga0501039_0147075 | |||
| 754 | Ga0501039_0772217 | |||
| 755 | Ga0501043_0006608 | |||
| 756 | Ga0501043_0138378 | |||
| 757 | Ga0501070_0136906 | |||
| 758 | Ga0501079_1303160 | |||
| 759 | Ga0501279_014139 | |||
| 760 | Ga0501279_105949 | |||
| 761 | Ga0501044_0715534 | |||
| 762 | Ga0501212_074844 | |||
| 763 | Ga0587072_003702 | |||
| 764 | 2691512499 | |||
| 765 | 2775657734 | |||
| 766 | 2808829749 | |||
| 767 | 2808850929 | |||
| 768 | 2808876561 | |||
| 769 | 2808894003 | |||
| 770 | 2808898057 | |||
| 771 | 2812318549 | |||
| 772 | 2857744282 | |||
| 773 | 2904497531 | |||
| 774 | 2919038942 | |||
| 775 | 2919391896 | |||
| 776 | 2919539832 | |||
| 777 | 2932428682 | |||
| 778 | 2933421479 | |||
| 779 | 2939600850 | |||
| 780 | 2939647586 | |||
| 781 | 2939676364 | |||
| 782 | 2945916309 | |||
| 783 | 2945923551 | |||
| 784 | 2945944781 | |||
| 785 | 2945956990 | |||
| 786 | 2946040723 | |||
| 787 | 2946060103 | |||
| 788 | 2954001964 | |||
| 789 | 2974304259 | |||
| 790 | 8054109177 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7by8-assembly1.cif.gz_C | malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) | 0.9132 | 24 | 47 |
| 7x1l-assembly1.cif.gz_F | malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) delta e311 mutant complexed with nicotinamide adenine dinucleotide (nad+) | 0.9115 | 24 | 47 |
| 7by9-assembly1.cif.gz_B | malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) complexed with oxaloacetic acid (oaa) and nicotinamide adenine dinucleotide (nad) | 0.8989 | 24 | 47 |
| 1ldn-assembly1.cif.gz_C | structure of a ternary complex of an allosteric lactate dehydrogenase from bacillus stearothermophilus at 2.5 angstroms resolution | 0.8912 | 24 | 47 |
| 3gzc-assembly1.cif.gz_B | structure of human selenocysteine lyase | 0.8772 | 22 | 45 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4isyB02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.8746 | 22 | 45 | 3.40.640.10 |
| af_Q9JLI6_18_428_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.8736 | 22 | 45 | 3.40.640.10 |
| af_Q2M7M3_25_99_3.30.1450.10 | Alpha Beta;2-Layer Sandwich;Beta-lactamase Inhibitory Protein; Chain:B, domain 1; | 0.8722 | 24 | 60 | 3.30.1450.10 |
| 3lvjA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.8322 | 22 | 46 | 3.40.640.10 |
| af_A4I9I2_166_339_3.90.110.10 | Alpha Beta;Alpha-Beta Complex;L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2;Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal | 0.7863 | 24 | 47 | 3.90.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P8RD82-F1-model_v4 | Asp23/Gls24 family envelope stress response protein | 0.9274 | 19 | 120 |
|
| AF-A0A6D1VA01-F1-model_v4 | deleted | 0.9242 | 20 | 126 |
|
| AF-A0A4R8ZAB1-F1-model_v4 | Asp23/Gls24 family envelope stress response protein | 0.9124 | 15 | 126 |
|
| AF-A0A653U2B0-F1-model_v4 | Aldehyde dehydrogenase domain-containing protein | 0.912 | 14 | 126 |
GO:0004491
GO:0006210 GO:0006574 |
| AF-A0A6D1VA01-F1-model_v4 | deleted | 0.9078 | 20 | 126 |
|