F433103

General Info

Members Datasets Scaffolds Average Seq Length
395 201 790 126

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10188592|rootH2_101885922
Length 139
Sequence MNGAAHRDGAAYIGGAAEAPAPGRQYSGHNRISTQALTSLAKAAAAEALGIHAHDVRADWADDDGLLALSLVAPIRIPSLPAVLRDPGRVQALGGSIWERTVHARADILTKVTELSGARLSRVDIRISGTHVTEGGRVQ

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
24 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
25 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
26 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
81 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
82 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
83 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
84 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
85 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
86 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
87 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
88 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
89 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
90 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
91 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
92 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
93 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
94 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
95 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
96 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
103 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
106 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
110 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
113 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
114 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
117 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
134 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
135 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
174 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
176 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
177 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
178 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
179 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
180 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
181 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
182 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
183 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
184 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
185 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
186 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
187 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
188 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
189 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
190 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
191 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
192 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
193 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
194 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
195 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
196 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
197 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
198 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
199 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
200 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
201 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.13
Metatranscriptomes 3.04
Isolates 6.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 6.84
Rhizosphere 87.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10188592 3300003320 Bacteria 1341
2 JGI24035J26624_1028601 3300002126 Bacteria 603
3 JGI24033J26618_1036906 3300002155 Bacteria 672
4 JGI24751J29686_10093024 3300002459 Bacteria 628
5 rootL2_10373202 3300003322 Bacteria 1530
6 Ga0006562J51391_1019055 3300003578 Bacteria 1753
7 Ga0006562J51391_1080180 3300003578 Bacteria 770
8 Ga0055542_1008611 3300003762 Bacteria 1984
9 Ga0065714_10069622 3300005288 Bacteria 4153
10 Ga0070676_10071931 3300005328 Bacteria 2078
11 Ga0070676_10627170 3300005328 Bacteria 778
12 Ga0070676_11118059 3300005328 Bacteria 596
13 Ga0070676_11263728 3300005328 Bacteria 563
14 Ga0070670_100054834 3300005331 Bacteria 3422
15 Ga0070670_100136544 3300005331 Bacteria 2119
16 Ga0070677_10011090 3300005333 Bacteria 3098
17 Ga0070677_10075589 3300005333 Bacteria 1428
18 Ga0070668_100015329 3300005347 Bacteria 5727
19 Ga0070675_100039713 3300005354 Bacteria 3841
20 Ga0070675_100749728 3300005354 Bacteria 891
21 Ga0070674_100027206 3300005356 Bacteria 3745
22 Ga0070667_100088539 3300005367 Bacteria 2658
23 Ga0070678_100735988 3300005456 Bacteria 891
24 Ga0070699_100839927 3300005518 Bacteria 841
25 Ga0070697_101334364 3300005536 Bacteria 640
26 Ga0070672_100404564 3300005543 Bacteria 1170
27 Ga0070696_100934192 3300005546 Bacteria 721
28 Ga0070665_101425280 3300005548 Bacteria 702
29 Ga0068863_100617497 3300005841 Bacteria 1074
30 Ga0075432_10003310 3300006058 Bacteria 5446
31 Ga0075432_10170953 3300006058 Bacteria 845
32 Ga0068865_100841049 3300006881 Bacteria 794
33 Ga0105251_10042362 3300009011 Bacteria 2211
34 Ga0105244_10028914 3300009036 Bacteria 2969
35 Ga0105244_10056924 3300009036 Bacteria 1977
36 Ga0105244_10061991 3300009036 Bacteria 1880
37 Ga0105245_10034394 3300009098 Bacteria 4495
38 Ga0105247_10021321 3300009101 Bacteria 3899
39 Ga0105243_10043166 3300009148 Bacteria 3533
40 Ga0105243_10278711 3300009148 Bacteria 1505
41 Ga0105241_10514089 3300009174 Bacteria 1070
42 Ga0105242_10480720 3300009176 Bacteria 1177
43 Ga0105242_10640447 3300009176 Bacteria 1032
44 Ga0105248_10031532 3300009177 Bacteria 5923
45 Ga0105249_10245049 3300009553 Bacteria 1774
46 Ga0105246_10002805 3300011119 Bacteria 10547
47 Ga0105246_10026481 3300011119 Bacteria 3789
48 Ga0105246_10065742 3300011119 Bacteria 2536
49 Ga0105246_10128600 3300011119 Bacteria 1888
50 Ga0105246_10177149 3300011119 Bacteria 1638
51 Ga0105246_10429932 3300011119 Bacteria 1104
52 Ga0157373_10092824 3300013100 Bacteria 2126
53 Ga0157369_10025840 3300013105 Bacteria 6514
54 Ga0157369_10039571 3300013105 Bacteria 5152
55 Ga0157369_10096845 3300013105 Bacteria 3147
56 Ga0157369_10211257 3300013105 Bacteria 2034
57 Ga0157369_11483726 3300013105 Bacteria 690
58 Ga0157372_10621856 3300013307 Bacteria 1258
59 Ga0163161_10016778 3300017792 Bacteria 5119
60 Ga0209148_1005139 3300025254 Bacteria 3058
61 Ga0207697_10006735 3300025315 Bacteria 5170
62 Ga0207697_10027126 3300025315 Bacteria 2342
63 Ga0207655_1007883 3300025728 Bacteria 6841
64 Ga0207655_1067653 3300025728 Bacteria 1344
65 Ga0207713_1049031 3300025735 Bacteria 1696
66 Ga0207682_10017980 3300025893 Bacteria 2760
67 Ga0207682_10043727 3300025893 Bacteria 1834
68 Ga0207710_10523518 3300025900 Bacteria 616
69 Ga0207688_10314830 3300025901 Bacteria 959
70 Ga0207680_10146115 3300025903 Bacteria 1572
71 Ga0207645_10001044 3300025907 Bacteria 22915
72 Ga0207645_10213197 3300025907 Bacteria 1272
73 Ga0207643_10402741 3300025908 Bacteria 865
74 Ga0207694_10790850 3300025924 Bacteria 801
75 Ga0207687_10215728 3300025927 Bacteria 1508
76 Ga0207644_10047457 3300025931 Bacteria 3065
77 Ga0207709_10028980 3300025935 Bacteria 3205
78 Ga0207709_10080690 3300025935 Bacteria 2096
79 Ga0207669_10236488 3300025937 Bacteria 1351
80 Ga0207711_10298101 3300025941 Bacteria 1486
81 Ga0207651_10822979 3300025960 Bacteria 824
82 Ga0207712_10244646 3300025961 Bacteria 1447
83 Ga0207668_10079700 3300025972 Bacteria 2370
84 Ga0207658_10366604 3300025986 Bacteria 1258
85 Ga0207641_10560864 3300026088 Bacteria 1115
86 Ga0207683_10034132 3300026121 Bacteria 4421
87 Ga0207428_10002227 3300027907 Bacteria 19465
88 Ga0268266_12299448 3300028379 Bacteria 510
89 Ga0307408_100006735 3300031548 Bacteria 7616
90 Ga0307408_100021823 3300031548 Bacteria 4339
91 Ga0307408_100031014 3300031548 Bacteria 3718
92 Ga0307408_100038072 3300031548 Bacteria 3391
93 Ga0307408_100058593 3300031548 Bacteria 2800
94 Ga0307408_100070842 3300031548 Bacteria 2575
95 Ga0307408_100119066 3300031548 Bacteria 2042
96 Ga0307408_100211162 3300031548 Bacteria 1577
97 Ga0307408_100449452 3300031548 Bacteria 1117
98 Ga0307408_100532772 3300031548 Bacteria 1033
99 Ga0307408_100839948 3300031548 Bacteria 836
100 Ga0307408_101179335 3300031548 Bacteria 713
101 Ga0307408_101316353 3300031548 Bacteria 678
102 Ga0307405_10022163 3300031731 Bacteria 3586
103 Ga0307405_10032197 3300031731 Bacteria 3097
104 Ga0307405_10080074 3300031731 Bacteria 2131
105 Ga0307405_10098652 3300031731 Bacteria 1953
106 Ga0307405_10209957 3300031731 Bacteria 1420
107 Ga0307405_10416900 3300031731 Bacteria 1055
108 Ga0307405_10424681 3300031731 Bacteria 1047
109 Ga0307405_10442251 3300031731 Bacteria 1028
110 Ga0307405_11114959 3300031731 Bacteria 679
111 Ga0307405_11172073 3300031731 Bacteria 663
112 Ga0307405_11424868 3300031731 Bacteria 606
113 Ga0307405_11813630 3300031731 Bacteria 542
114 Ga0307413_10061103 3300031824 Bacteria 2323
115 Ga0307413_10099881 3300031824 Bacteria 1914
116 Ga0307413_10178210 3300031824 Bacteria 1512
117 Ga0307413_10319461 3300031824 Bacteria 1185
118 Ga0307413_10329734 3300031824 Bacteria 1169
119 Ga0307413_10500737 3300031824 Bacteria 975
120 Ga0307413_10544671 3300031824 Bacteria 940
121 Ga0307413_10600630 3300031824 Bacteria 900
122 Ga0307413_10662667 3300031824 Bacteria 862
123 Ga0307413_11090850 3300031824 Bacteria 689
124 Ga0307413_11498014 3300031824 Bacteria 596
125 Ga0307410_10010168 3300031852 Bacteria 5319
126 Ga0307410_10025034 3300031852 Bacteria 3737
127 Ga0307410_10052798 3300031852 Bacteria 2747
128 Ga0307410_10054481 3300031852 Bacteria 2712
129 Ga0307410_10108740 3300031852 Bacteria 2002
130 Ga0307410_10111026 3300031852 Bacteria 1984
131 Ga0307410_10162069 3300031852 Bacteria 1677
132 Ga0307410_10224216 3300031852 Bacteria 1447
133 Ga0307410_10596853 3300031852 Bacteria 921
134 Ga0307410_10700829 3300031852 Bacteria 853
135 Ga0307410_10879612 3300031852 Bacteria 766
136 Ga0307410_11846908 3300031852 Bacteria 537
137 Ga0307406_10072699 3300031901 Bacteria 2258
138 Ga0307406_10127707 3300031901 Bacteria 1779
139 Ga0307406_10215698 3300031901 Bacteria 1423
140 Ga0307406_10255423 3300031901 Bacteria 1323
141 Ga0307406_10316396 3300031901 Bacteria 1205
142 Ga0307406_10498191 3300031901 Bacteria 987
143 Ga0307407_10015885 3300031903 Bacteria 3735
144 Ga0307407_10021043 3300031903 Bacteria 3355
145 Ga0307407_10023524 3300031903 Bacteria 3216
146 Ga0307407_10155307 3300031903 Bacteria 1491
147 Ga0307407_10188937 3300031903 Bacteria 1371
148 Ga0307407_10196171 3300031903 Bacteria 1349
149 Ga0307407_10361902 3300031903 Bacteria 1030
150 Ga0307412_10004079 3300031911 Bacteria 8135
151 Ga0307412_10014806 3300031911 Bacteria 4609
152 Ga0307412_10016961 3300031911 Bacteria 4351
153 Ga0307412_10019078 3300031911 Bacteria 4142
154 Ga0307412_10062261 3300031911 Bacteria 2511
155 Ga0307412_10101436 3300031911 Bacteria 2036
156 Ga0307412_10127921 3300031911 Bacteria 1840
157 Ga0307412_10218081 3300031911 Bacteria 1460
158 Ga0307412_10256951 3300031911 Bacteria 1359
159 Ga0307412_11305048 3300031911 Bacteria 653
160 Ga0307409_100099466 3300031995 Bacteria 2408
161 Ga0307409_100116501 3300031995 Bacteria 2252
162 Ga0307409_100118096 3300031995 Bacteria 2239
163 Ga0307409_100130387 3300031995 Bacteria 2147
164 Ga0307409_100136836 3300031995 Bacteria 2104
165 Ga0307409_100399320 3300031995 Bacteria 1312
166 Ga0307409_100910707 3300031995 Bacteria 893
167 Ga0307409_101244112 3300031995 Bacteria 768
168 Ga0307409_101692944 3300031995 Bacteria 661
169 Ga0307416_100017118 3300032002 Bacteria 5059
170 Ga0307416_100026458 3300032002 Bacteria 4275
171 Ga0307416_100032976 3300032002 Bacteria 3920
172 Ga0307416_100065198 3300032002 Bacteria 2992
173 Ga0307416_100101020 3300032002 Bacteria 2510
174 Ga0307416_100108129 3300032002 Bacteria 2442
175 Ga0307416_100119024 3300032002 Bacteria 2348
176 Ga0307416_100139806 3300032002 Bacteria 2198
177 Ga0307416_100447511 3300032002 Bacteria 1343
178 Ga0307416_100494239 3300032002 Bacteria 1286
179 Ga0307416_100660408 3300032002 Bacteria 1131
180 Ga0307416_101008662 3300032002 Bacteria 936
181 Ga0307416_101741592 3300032002 Bacteria 727
182 Ga0307416_101849165 3300032002 Bacteria 707
183 Ga0307414_10043371 3300032004 Bacteria 3064
184 Ga0307414_10104000 3300032004 Bacteria 2144
185 Ga0307414_10171502 3300032004 Bacteria 1735
186 Ga0307414_10232320 3300032004 Bacteria 1521
187 Ga0307414_10318708 3300032004 Bacteria 1322
188 Ga0307414_10341143 3300032004 Bacteria 1283
189 Ga0307414_10490679 3300032004 Bacteria 1085
190 Ga0307414_10538021 3300032004 Bacteria 1039
191 Ga0307414_10726724 3300032004 Bacteria 901
192 Ga0307414_10769366 3300032004 Bacteria 876
193 Ga0307414_10860905 3300032004 Bacteria 829
194 Ga0307411_10078260 3300032005 Bacteria 2266
195 Ga0307411_10112544 3300032005 Bacteria 1951
196 Ga0307411_10284862 3300032005 Bacteria 1317
197 Ga0307411_10361623 3300032005 Bacteria 1187
198 Ga0307415_100005330 3300032126 Bacteria 6813
199 Ga0307415_100041059 3300032126 Bacteria 3069
200 Ga0307415_100290465 3300032126 Bacteria 1349
201 Ga0307415_100490235 3300032126 Bacteria 1072
202 Ga0307415_100856295 3300032126 Bacteria 834
203 Ga0395899_0006118 3300037312 Bacteria 9325
204 Ga0395899_0092664 3300037312 Bacteria 2188
205 Ga0395899_0108266 3300037312 Bacteria 2000
206 Ga0395899_0247832 3300037312 Bacteria 1223
207 Ga0395900_0066192 3300037418 Bacteria 3713
208 Ga0395900_0167897 3300037418 Bacteria 2235
209 Ga0395900_0421008 3300037418 Bacteria 1296
210 Ga0395898_0173736 3300037466 Bacteria 2059
211 Ga0395898_0264484 3300037466 Bacteria 1640
212 Ga0395905_0894198 3300037471 Bacteria 791
213 Ga0395901_0050834 3300038443 Bacteria 4306
214 Ga0395901_0216983 3300038443 Bacteria 2000
215 Ga0395901_0897928 3300038443 Bacteria 868
216 Ga0439436_0000555 3300041404 Bacteria 9831
217 Ga0439438_064307 3300041405 Bacteria 915
218 Ga0439438_083429 3300041405 Bacteria 783
219 Ga0439447_112563 3300041407 Bacteria 624
220 Ga0439447_113064 3300041407 Bacteria 623
221 Ga0439461_0003845 3300041410 Bacteria 2486
222 Ga0439466_0009906 3300041411 Bacteria 3547
223 Ga0439466_0034515 3300041411 Bacteria 1715
224 Ga0439465_0228255 3300041413 Bacteria 684
225 Ga0439431_0022897 3300041997 Bacteria 1509
226 Ga0439433_0000118 3300041999 Bacteria 11441
227 Ga0439442_000026 3300042002 Bacteria 35791
228 Ga0439442_000036 3300042002 Bacteria 30155
229 Ga0439442_000998 3300042002 Bacteria 5716
230 Ga0439442_002353 3300042002 Bacteria 3710
231 Ga0439442_003636 3300042002 Bacteria 3052
232 Ga0439442_015109 3300042002 Bacteria 1590
233 Ga0439449_0000634 3300042007 Bacteria 13197
234 Ga0439449_0000848 3300042007 Bacteria 11868
235 Ga0439449_0006196 3300042007 Bacteria 4573
236 Ga0439449_0042422 3300042007 Bacteria 1690
237 Ga0439452_030745 3300042010 Bacteria 1322
238 Ga0439452_031643 3300042010 Bacteria 1297
239 Ga0439452_132008 3300042010 Bacteria 529
240 Ga0439457_001839 3300042014 Bacteria 6253
241 Ga0439457_011338 3300042014 Bacteria 2030
242 Ga0439462_0010745 3300042015 Bacteria 2322
243 Ga0439462_0040593 3300042015 Bacteria 1241
244 Ga0450920_000035 3300042122 Bacteria 16140
245 Ga0450920_022995 3300042122 Bacteria 1208
246 Ga0450907_000119 3300042146 Bacteria 30100
247 Ga0439434_0001103 3300042435 Bacteria 7816
248 Ga0439434_0001109 3300042435 Bacteria 7787
249 Ga0450918_001560 3300042531 Bacteria 4525
250 Ga0466970_0287293 3300044765 Bacteria 926
251 Ga0495629_0305468 3300046459 Bacteria 1089
252 Ga0495638_0235380 3300046460 Bacteria 1017
253 Ga0495653_0000808 3300046463 Bacteria 24075
254 Ga0495580_0567456 3300046472 Bacteria 752
255 Ga0495582_0028251 3300046473 Bacteria 3078
256 Ga0495582_0591313 3300046473 Bacteria 642
257 Ga0495639_0027196 3300046475 Bacteria 2531
258 Ga0495662_0032708 3300046476 Bacteria 2513
259 Ga0495664_0046593 3300046477 Bacteria 2572
260 Ga0495594_0157516 3300046499 Bacteria 1290
261 Ga0495594_0405121 3300046499 Bacteria 776
262 Ga0495583_0400033 3300046506 Bacteria 540
263 Ga0495606_0586605 3300046507 Bacteria 549
264 Ga0495663_0171291 3300046525 Bacteria 749
265 Ga0495642_0011901 3300046528 Bacteria 3351
266 Ga0495652_0822489 3300046529 Bacteria 617
267 Ga0495665_0103934 3300046531 Bacteria 1490
268 Ga0495586_0004268 3300046535 Bacteria 7641
269 Ga0495586_0140949 3300046535 Bacteria 1353
270 Ga0495587_0002080 3300046536 Bacteria 13364
271 Ga0495645_0008233 3300046543 Bacteria 7272
272 Ga0495622_0123248 3300046557 Bacteria 1183
273 Ga0495633_0203945 3300046558 Bacteria 907
274 Ga0495633_0273543 3300046558 Bacteria 769
275 Ga0495633_0351885 3300046558 Bacteria 667
276 Ga0495667_0000752 3300046559 Bacteria 20843
277 Ga0495656_0041867 3300046615 Bacteria 1916
278 Ga0495656_0106446 3300046615 Bacteria 1305
279 Ga0495656_0191874 3300046615 Bacteria 1009
280 Ga0495668_0042948 3300046616 Bacteria 2515
281 Ga0495635_0107789 3300046663 Bacteria 1903
282 Ga0495659_0081761 3300046664 Bacteria 1227
283 Ga0495588_0001140 3300046674 Bacteria 11431
284 Ga0495588_0036987 3300046674 Bacteria 2479
285 Ga0495657_0798336 3300046675 Bacteria 539
286 Ga0495623_0009352 3300046679 Bacteria 6366
287 Ga0495613_0119209 3300046689 Bacteria 1896
288 Ga0495670_0023694 3300046691 Bacteria 3030
289 Ga0495670_0036601 3300046691 Bacteria 2445
290 Ga0495670_0046806 3300046691 Bacteria 2161
291 Ga0495670_0226777 3300046691 Bacteria 993
292 Ga0495600_0002761 3300046809 Bacteria 10170
293 Ga0495581_0001305 3300047315 Bacteria 13758
294 Ga0495581_0007200 3300047315 Bacteria 6439
295 Ga0495581_0053568 3300047315 Bacteria 2330
296 Ga0495581_0107619 3300047315 Bacteria 1621
297 Ga0495636_0146885 3300047318 Bacteria 1056
298 Ga0495680_0006689 3300047322 Bacteria 10673
299 Ga0495675_0026687 3300047444 Bacteria 3682
300 Ga0495677_0066490 3300047445 Bacteria 1341
301 Ga0495685_122574 3300047447 Bacteria 853
302 Ga0495681_0099125 3300047470 Bacteria 1276
303 Ga0495684_0073743 3300047471 Bacteria 2593
304 Ga0495593_0184892 3300047673 Bacteria 1049
305 Ga0496100_0049210 3300048903 Bacteria 2724
306 Ga0496100_0572077 3300048903 Bacteria 875
307 Ga0496101_0070516 3300048904 Bacteria 2559
308 Ga0496101_0494068 3300048904 Bacteria 967
309 Ga0496102_0056358 3300048905 Bacteria 3585
310 Ga0496102_0095346 3300048905 Bacteria 2757
311 Ga0496102_0122583 3300048905 Bacteria 2428
312 Ga0496102_0147147 3300048905 Bacteria 2211
313 Ga0496103_0076803 3300048906 Bacteria 2096
314 Ga0496103_0096210 3300048906 Bacteria 1871
315 Ga0496103_0448566 3300048906 Bacteria 827
316 Ga0496104_0039807 3300048907 Bacteria 4402
317 Ga0496105_0399878 3300048908 Bacteria 1090
318 Ga0496105_0854322 3300048908 Bacteria 688
319 Ga0496106_0188918 3300048909 Bacteria 1637
320 Ga0496106_0231724 3300048909 Bacteria 1474
321 Ga0496107_0056350 3300048910 Bacteria 2839
322 Ga0496108_0054346 3300048911 Bacteria 3360
323 Ga0496109_0101626 3300048912 Bacteria 2668
324 Ga0496111_0295664 3300048914 Bacteria 1200
325 Ga0496112_0224932 3300048915 Bacteria 1832
326 Ga0496112_0337902 3300048915 Bacteria 1450
327 Ga0496112_0514552 3300048915 Bacteria 1132
328 Ga0496112_1182573 3300048915 Bacteria 682
329 Ga0496113_0718898 3300048916 Bacteria 796
330 Ga0496113_0754059 3300048916 Bacteria 775
331 Ga0496113_1013583 3300048916 Bacteria 653
332 Ga0496119_0064885 3300048922 Bacteria 2166
333 Ga0496119_0254598 3300048922 Bacteria 884
334 Ga0496124_0140643 3300048927 Bacteria 1905
335 Ga0496125_0237912 3300048928 Bacteria 1159
336 Ga0496126_0349954 3300048929 Bacteria 1209
337 Ga0501306_002787 3300049127 Bacteria 1824
338 Ga0501306_060686 3300049127 Bacteria 623
339 Ga0501310_043004 3300049130 Bacteria 634
340 Ga0501317_024445 3300049533 Bacteria 841
341 Ga0501317_034600 3300049533 Bacteria 749
342 Ga0501318_046007 3300049534 Bacteria 637
343 Ga0501321_012879 3300049537 Bacteria 953
344 Ga0501323_018511 3300049539 Bacteria 902
345 Ga0501330_012201 3300049546 Bacteria 627
346 Ga0501032_0001520 3300049569 Bacteria 18495
347 Ga0501032_0005264 3300049569 Bacteria 9625
348 Ga0501034_0002817 3300049571 Bacteria 20325
349 Ga0501036_0096539 3300049572 Bacteria 2499
350 Ga0501037_0048601 3300049573 Bacteria 3107
351 Ga0501037_0072207 3300049573 Bacteria 2510
352 Ga0501037_0688173 3300049573 Bacteria 681
353 Ga0501037_0874937 3300049573 Bacteria 590
354 Ga0501038_0046846 3300049574 Bacteria 3747
355 Ga0501038_0141877 3300049574 Bacteria 1965
356 Ga0501038_0182788 3300049574 Bacteria 1691
357 Ga0501039_0029125 3300049575 Bacteria 4252
358 Ga0501039_0147075 3300049575 Bacteria 1851
359 Ga0501039_0772217 3300049575 Bacteria 750
360 Ga0501043_0006608 3300049579 Bacteria 9288
361 Ga0501043_0138378 3300049579 Bacteria 1907
362 Ga0501070_0136906 3300049586 Bacteria 2022
363 Ga0501079_1303160 3300049741 Bacteria 572
364 Ga0501279_014139 3300049775 Bacteria 1097
365 Ga0501279_105949 3300049775 Bacteria 511
366 Ga0501044_0715534 3300049823 Bacteria 886
367 Ga0501212_074844 3300049851 Bacteria 605
368 Ga0587072_003702 3300059643 Bacteria 2169
369 2691512499 2690315906 Bacteria 4517044
370 2775657734 2775506735 Bacteria 4556596
371 2808829749 2808606357 Bacteria 4466944
372 2808850929 2808606360 Bacteria 4404006
373 2808876561 2808606366 Bacteria 4415912
374 2808894003 2808606370 Bacteria 4942454
375 2808898057 2808606371 Bacteria 4251511
376 2812318549 2811994871 Bacteria 4497550
377 2857744282 2857740372 Bacteria 4782044
378 2904497531 2904497146 Bacteria 4731781
379 2919038942 2919034639 Bacteria 4763403
380 2919391896 2919391150 Bacteria 4884741
381 2919539832 2919538618 Bacteria 4677069
382 2932428682 2932426870 Bacteria 4547726
383 2933421479 2933418574 Bacteria 4476724
384 2939600850 2939598168 Bacteria 4687164
385 2939647586 2939647034 Bacteria 4681660
386 2939676364 2939674588 Bacteria 4844420
387 2945916309 2945916053 Bacteria 4555517
388 2945923551 2945920336 Bacteria 4501603
389 2945944781 2945941187 Bacteria 4682474
390 2945956990 2945956166 Bacteria 5110334
391 2946040723 2946037020 Bacteria 4900426
392 2946060103 2946059875 Bacteria 4386623
393 2954001964 2953998280 Bacteria 4812144
394 2974304259 2974302888 Bacteria 4369871
395 8054109177 8054107350 Bacteria 5022511
396 rootH2_10188592
397 JGI24035J26624_1028601
398 JGI24033J26618_1036906
399 JGI24751J29686_10093024
400 rootL2_10373202
401 Ga0006562J51391_1019055
402 Ga0006562J51391_1080180
403 Ga0055542_1008611
404 Ga0065714_10069622
405 Ga0070676_10071931
406 Ga0070676_10627170
407 Ga0070676_11118059
408 Ga0070676_11263728
409 Ga0070670_100054834
410 Ga0070670_100136544
411 Ga0070677_10011090
412 Ga0070677_10075589
413 Ga0070668_100015329
414 Ga0070675_100039713
415 Ga0070675_100749728
416 Ga0070674_100027206
417 Ga0070667_100088539
418 Ga0070678_100735988
419 Ga0070699_100839927
420 Ga0070697_101334364
421 Ga0070672_100404564
422 Ga0070696_100934192
423 Ga0070665_101425280
424 Ga0068863_100617497
425 Ga0075432_10003310
426 Ga0075432_10170953
427 Ga0068865_100841049
428 Ga0105251_10042362
429 Ga0105244_10028914
430 Ga0105244_10056924
431 Ga0105244_10061991
432 Ga0105245_10034394
433 Ga0105247_10021321
434 Ga0105243_10043166
435 Ga0105243_10278711
436 Ga0105241_10514089
437 Ga0105242_10480720
438 Ga0105242_10640447
439 Ga0105248_10031532
440 Ga0105249_10245049
441 Ga0105246_10002805
442 Ga0105246_10026481
443 Ga0105246_10065742
444 Ga0105246_10128600
445 Ga0105246_10177149
446 Ga0105246_10429932
447 Ga0157373_10092824
448 Ga0157369_10025840
449 Ga0157369_10039571
450 Ga0157369_10096845
451 Ga0157369_10211257
452 Ga0157369_11483726
453 Ga0157372_10621856
454 Ga0163161_10016778
455 Ga0209148_1005139
456 Ga0207697_10006735
457 Ga0207697_10027126
458 Ga0207655_1007883
459 Ga0207655_1067653
460 Ga0207713_1049031
461 Ga0207682_10017980
462 Ga0207682_10043727
463 Ga0207710_10523518
464 Ga0207688_10314830
465 Ga0207680_10146115
466 Ga0207645_10001044
467 Ga0207645_10213197
468 Ga0207643_10402741
469 Ga0207694_10790850
470 Ga0207687_10215728
471 Ga0207644_10047457
472 Ga0207709_10028980
473 Ga0207709_10080690
474 Ga0207669_10236488
475 Ga0207711_10298101
476 Ga0207651_10822979
477 Ga0207712_10244646
478 Ga0207668_10079700
479 Ga0207658_10366604
480 Ga0207641_10560864
481 Ga0207683_10034132
482 Ga0207428_10002227
483 Ga0268266_12299448
484 Ga0307408_100006735
485 Ga0307408_100021823
486 Ga0307408_100031014
487 Ga0307408_100038072
488 Ga0307408_100058593
489 Ga0307408_100070842
490 Ga0307408_100119066
491 Ga0307408_100211162
492 Ga0307408_100449452
493 Ga0307408_100532772
494 Ga0307408_100839948
495 Ga0307408_101179335
496 Ga0307408_101316353
497 Ga0307405_10022163
498 Ga0307405_10032197
499 Ga0307405_10080074
500 Ga0307405_10098652
501 Ga0307405_10209957
502 Ga0307405_10416900
503 Ga0307405_10424681
504 Ga0307405_10442251
505 Ga0307405_11114959
506 Ga0307405_11172073
507 Ga0307405_11424868
508 Ga0307405_11813630
509 Ga0307413_10061103
510 Ga0307413_10099881
511 Ga0307413_10178210
512 Ga0307413_10319461
513 Ga0307413_10329734
514 Ga0307413_10500737
515 Ga0307413_10544671
516 Ga0307413_10600630
517 Ga0307413_10662667
518 Ga0307413_11090850
519 Ga0307413_11498014
520 Ga0307410_10010168
521 Ga0307410_10025034
522 Ga0307410_10052798
523 Ga0307410_10054481
524 Ga0307410_10108740
525 Ga0307410_10111026
526 Ga0307410_10162069
527 Ga0307410_10224216
528 Ga0307410_10596853
529 Ga0307410_10700829
530 Ga0307410_10879612
531 Ga0307410_11846908
532 Ga0307406_10072699
533 Ga0307406_10127707
534 Ga0307406_10215698
535 Ga0307406_10255423
536 Ga0307406_10316396
537 Ga0307406_10498191
538 Ga0307407_10015885
539 Ga0307407_10021043
540 Ga0307407_10023524
541 Ga0307407_10155307
542 Ga0307407_10188937
543 Ga0307407_10196171
544 Ga0307407_10361902
545 Ga0307412_10004079
546 Ga0307412_10014806
547 Ga0307412_10016961
548 Ga0307412_10019078
549 Ga0307412_10062261
550 Ga0307412_10101436
551 Ga0307412_10127921
552 Ga0307412_10218081
553 Ga0307412_10256951
554 Ga0307412_11305048
555 Ga0307409_100099466
556 Ga0307409_100116501
557 Ga0307409_100118096
558 Ga0307409_100130387
559 Ga0307409_100136836
560 Ga0307409_100399320
561 Ga0307409_100910707
562 Ga0307409_101244112
563 Ga0307409_101692944
564 Ga0307416_100017118
565 Ga0307416_100026458
566 Ga0307416_100032976
567 Ga0307416_100065198
568 Ga0307416_100101020
569 Ga0307416_100108129
570 Ga0307416_100119024
571 Ga0307416_100139806
572 Ga0307416_100447511
573 Ga0307416_100494239
574 Ga0307416_100660408
575 Ga0307416_101008662
576 Ga0307416_101741592
577 Ga0307416_101849165
578 Ga0307414_10043371
579 Ga0307414_10104000
580 Ga0307414_10171502
581 Ga0307414_10232320
582 Ga0307414_10318708
583 Ga0307414_10341143
584 Ga0307414_10490679
585 Ga0307414_10538021
586 Ga0307414_10726724
587 Ga0307414_10769366
588 Ga0307414_10860905
589 Ga0307411_10078260
590 Ga0307411_10112544
591 Ga0307411_10284862
592 Ga0307411_10361623
593 Ga0307415_100005330
594 Ga0307415_100041059
595 Ga0307415_100290465
596 Ga0307415_100490235
597 Ga0307415_100856295
598 Ga0395899_0006118
599 Ga0395899_0092664
600 Ga0395899_0108266
601 Ga0395899_0247832
602 Ga0395900_0066192
603 Ga0395900_0167897
604 Ga0395900_0421008
605 Ga0395898_0173736
606 Ga0395898_0264484
607 Ga0395905_0894198
608 Ga0395901_0050834
609 Ga0395901_0216983
610 Ga0395901_0897928
611 Ga0439436_0000555
612 Ga0439438_064307
613 Ga0439438_083429
614 Ga0439447_112563
615 Ga0439447_113064
616 Ga0439461_0003845
617 Ga0439466_0009906
618 Ga0439466_0034515
619 Ga0439465_0228255
620 Ga0439431_0022897
621 Ga0439433_0000118
622 Ga0439442_000026
623 Ga0439442_000036
624 Ga0439442_000998
625 Ga0439442_002353
626 Ga0439442_003636
627 Ga0439442_015109
628 Ga0439449_0000634
629 Ga0439449_0000848
630 Ga0439449_0006196
631 Ga0439449_0042422
632 Ga0439452_030745
633 Ga0439452_031643
634 Ga0439452_132008
635 Ga0439457_001839
636 Ga0439457_011338
637 Ga0439462_0010745
638 Ga0439462_0040593
639 Ga0450920_000035
640 Ga0450920_022995
641 Ga0450907_000119
642 Ga0439434_0001103
643 Ga0439434_0001109
644 Ga0450918_001560
645 Ga0466970_0287293
646 Ga0495629_0305468
647 Ga0495638_0235380
648 Ga0495653_0000808
649 Ga0495580_0567456
650 Ga0495582_0028251
651 Ga0495582_0591313
652 Ga0495639_0027196
653 Ga0495662_0032708
654 Ga0495664_0046593
655 Ga0495594_0157516
656 Ga0495594_0405121
657 Ga0495583_0400033
658 Ga0495606_0586605
659 Ga0495663_0171291
660 Ga0495642_0011901
661 Ga0495652_0822489
662 Ga0495665_0103934
663 Ga0495586_0004268
664 Ga0495586_0140949
665 Ga0495587_0002080
666 Ga0495645_0008233
667 Ga0495622_0123248
668 Ga0495633_0203945
669 Ga0495633_0273543
670 Ga0495633_0351885
671 Ga0495667_0000752
672 Ga0495656_0041867
673 Ga0495656_0106446
674 Ga0495656_0191874
675 Ga0495668_0042948
676 Ga0495635_0107789
677 Ga0495659_0081761
678 Ga0495588_0001140
679 Ga0495588_0036987
680 Ga0495657_0798336
681 Ga0495623_0009352
682 Ga0495613_0119209
683 Ga0495670_0023694
684 Ga0495670_0036601
685 Ga0495670_0046806
686 Ga0495670_0226777
687 Ga0495600_0002761
688 Ga0495581_0001305
689 Ga0495581_0007200
690 Ga0495581_0053568
691 Ga0495581_0107619
692 Ga0495636_0146885
693 Ga0495680_0006689
694 Ga0495675_0026687
695 Ga0495677_0066490
696 Ga0495685_122574
697 Ga0495681_0099125
698 Ga0495684_0073743
699 Ga0495593_0184892
700 Ga0496100_0049210
701 Ga0496100_0572077
702 Ga0496101_0070516
703 Ga0496101_0494068
704 Ga0496102_0056358
705 Ga0496102_0095346
706 Ga0496102_0122583
707 Ga0496102_0147147
708 Ga0496103_0076803
709 Ga0496103_0096210
710 Ga0496103_0448566
711 Ga0496104_0039807
712 Ga0496105_0399878
713 Ga0496105_0854322
714 Ga0496106_0188918
715 Ga0496106_0231724
716 Ga0496107_0056350
717 Ga0496108_0054346
718 Ga0496109_0101626
719 Ga0496111_0295664
720 Ga0496112_0224932
721 Ga0496112_0337902
722 Ga0496112_0514552
723 Ga0496112_1182573
724 Ga0496113_0718898
725 Ga0496113_0754059
726 Ga0496113_1013583
727 Ga0496119_0064885
728 Ga0496119_0254598
729 Ga0496124_0140643
730 Ga0496125_0237912
731 Ga0496126_0349954
732 Ga0501306_002787
733 Ga0501306_060686
734 Ga0501310_043004
735 Ga0501317_024445
736 Ga0501317_034600
737 Ga0501318_046007
738 Ga0501321_012879
739 Ga0501323_018511
740 Ga0501330_012201
741 Ga0501032_0001520
742 Ga0501032_0005264
743 Ga0501034_0002817
744 Ga0501036_0096539
745 Ga0501037_0048601
746 Ga0501037_0072207
747 Ga0501037_0688173
748 Ga0501037_0874937
749 Ga0501038_0046846
750 Ga0501038_0141877
751 Ga0501038_0182788
752 Ga0501039_0029125
753 Ga0501039_0147075
754 Ga0501039_0772217
755 Ga0501043_0006608
756 Ga0501043_0138378
757 Ga0501070_0136906
758 Ga0501079_1303160
759 Ga0501279_014139
760 Ga0501279_105949
761 Ga0501044_0715534
762 Ga0501212_074844
763 Ga0587072_003702
764 2691512499
765 2775657734
766 2808829749
767 2808850929
768 2808876561
769 2808894003
770 2808898057
771 2812318549
772 2857744282
773 2904497531
774 2919038942
775 2919391896
776 2919539832
777 2932428682
778 2933421479
779 2939600850
780 2939647586
781 2939676364
782 2945916309
783 2945923551
784 2945944781
785 2945956990
786 2946040723
787 2946060103
788 2954001964
789 2974304259
790 8054109177

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7by8-assembly1.cif.gz_C malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) 0.9132 24 47
7x1l-assembly1.cif.gz_F malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) delta e311 mutant complexed with nicotinamide adenine dinucleotide (nad+) 0.9115 24 47
7by9-assembly1.cif.gz_B malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) complexed with oxaloacetic acid (oaa) and nicotinamide adenine dinucleotide (nad) 0.8989 24 47
1ldn-assembly1.cif.gz_C structure of a ternary complex of an allosteric lactate dehydrogenase from bacillus stearothermophilus at 2.5 angstroms resolution 0.8912 24 47
3gzc-assembly1.cif.gz_B structure of human selenocysteine lyase 0.8772 22 45
ID Description Score Start End Superfamily
4isyB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8746 22 45 3.40.640.10
af_Q9JLI6_18_428_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8736 22 45 3.40.640.10
af_Q2M7M3_25_99_3.30.1450.10 Alpha Beta;2-Layer Sandwich;Beta-lactamase Inhibitory Protein; Chain:B, domain 1; 0.8722 24 60 3.30.1450.10
3lvjA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8322 22 46 3.40.640.10
af_A4I9I2_166_339_3.90.110.10 Alpha Beta;Alpha-Beta Complex;L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2;Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 0.7863 24 47 3.90.110.10
ID Description Score Start End GO Terms
AF-A0A4P8RD82-F1-model_v4 Asp23/Gls24 family envelope stress response protein 0.9274 19 120
AF-A0A6D1VA01-F1-model_v4 deleted 0.9242 20 126
AF-A0A4R8ZAB1-F1-model_v4 Asp23/Gls24 family envelope stress response protein 0.9124 15 126
AF-A0A653U2B0-F1-model_v4 Aldehyde dehydrogenase domain-containing protein 0.912 14 126 GO:0004491
GO:0006210
GO:0006574
AF-A0A6D1VA01-F1-model_v4 deleted 0.9078 20 126

Map