F433069

General Info

Members Datasets Scaffolds Average Seq Length
394 190 788 140

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0135571|Ga0501084_0135571_1416_1886
Length 156
Sequence VGPAAARASPELIVSQDWREKLRGSGYRLTPQRELILDAVDSLGHATPDEVLAEVRKKSSALNVSTVYRTLEVLEELGLVRHAHLSDRAPTYHSVRDHEHFHLVCRNCHRVISVDPDVLEPLLARLREEFAFEADVGHLTVFGRCLDCQTETPGEA

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
83 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
101 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
102 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
103 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
104 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
105 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
106 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
107 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
108 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
109 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
110 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
113 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
114 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
115 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
116 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
177 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
182 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
183 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
186 2643221561 Nocardioides sp. Root151 Isolate Unclassified
187 2643221615 Nocardioides sp. Root224 Isolate Unclassified
188 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
189 2643221696 Nocardioides sp. Root140 Isolate Unclassified
190 2857481737 Nocardioides sp. R-74106 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 0
Isolates 1.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.11
Nodule 0
Rhizoplane 10.91
Rhizosphere 61.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_0135571 3300054114 Bacteria 2073
2 JGI24735J21928_10132753 3300002067 Bacteria 718
3 Ga0070683_100246114 3300005329 Bacteria 1701
4 Ga0070683_100540818 3300005329 Bacteria 1114
5 Ga0070683_100778360 3300005329 Bacteria 917
6 Ga0070683_100793047 3300005329 Bacteria 908
7 Ga0070683_101370313 3300005329 Bacteria 680
8 Ga0068868_101318188 3300005338 Bacteria 671
9 Ga0070660_100146791 3300005339 Bacteria 1895
10 Ga0070668_101698472 3300005347 Bacteria 580
11 Ga0070668_102153004 3300005347 Bacteria 515
12 Ga0070675_101768494 3300005354 Bacteria 570
13 Ga0070671_100327272 3300005355 Bacteria 1306
14 Ga0070659_100807869 3300005366 Bacteria 816
15 Ga0070667_100002932 3300005367 Bacteria 14665
16 Ga0070700_100335895 3300005441 Bacteria 1115
17 Ga0070678_101243112 3300005456 Bacteria 692
18 Ga0070681_11163512 3300005458 Bacteria 693
19 Ga0068867_100847390 3300005459 Bacteria 819
20 Ga0068867_100917802 3300005459 Bacteria 789
21 Ga0070679_100003906 3300005530 Bacteria 13709
22 Ga0070684_100394333 3300005535 Bacteria 1276
23 Ga0070684_100711243 3300005535 Bacteria 937
24 Ga0070686_100425600 3300005544 Bacteria 1015
25 Ga0070665_100000996 3300005548 Bacteria 35909
26 Ga0070665_100163840 3300005548 Bacteria 2226
27 Ga0068855_101628036 3300005563 Bacteria 660
28 Ga0070664_100298660 3300005564 Bacteria 1455
29 Ga0070664_100651586 3300005564 Bacteria 979
30 Ga0068857_100943272 3300005577 Bacteria 829
31 Ga0070702_101038708 3300005615 Bacteria 651
32 Ga0070702_101039082 3300005615 Bacteria 651
33 Ga0068870_10441301 3300005840 Bacteria 856
34 Ga0068870_10640184 3300005840 Bacteria 727
35 Ga0068863_102019377 3300005841 Bacteria 587
36 Ga0068860_100000592 3300005843 Bacteria 43291
37 Ga0068860_100437952 3300005843 Bacteria 1298
38 Ga0068860_100467350 3300005843 Bacteria 1256
39 Ga0075365_10012171 3300006038 Bacteria 5096
40 Ga0075365_10116020 3300006038 Bacteria 1844
41 Ga0075365_10174905 3300006038 Bacteria 1499
42 Ga0075365_10182198 3300006038 Bacteria 1469
43 Ga0075365_10186730 3300006038 Bacteria 1450
44 Ga0075365_10215188 3300006038 Bacteria 1347
45 Ga0075365_10218687 3300006038 Bacteria 1336
46 Ga0075365_10235661 3300006038 Bacteria 1285
47 Ga0075365_10278068 3300006038 Bacteria 1177
48 Ga0075365_10383645 3300006038 Bacteria 991
49 Ga0075365_10401141 3300006038 Bacteria 968
50 Ga0075365_10432290 3300006038 Bacteria 929
51 Ga0075365_10836568 3300006038 Bacteria 649
52 Ga0075368_10001653 3300006042 Bacteria 7154
53 Ga0075368_10003527 3300006042 Bacteria 5238
54 Ga0075368_10052221 3300006042 Bacteria 1626
55 Ga0075363_100000679 3300006048 Bacteria 11427
56 Ga0075363_100002871 3300006048 Bacteria 7175
57 Ga0075363_100129480 3300006048 Bacteria 1415
58 Ga0075363_100183752 3300006048 Bacteria 1190
59 Ga0075364_10034694 3300006051 Bacteria 3257
60 Ga0075364_10035966 3300006051 Bacteria 3201
61 Ga0075364_10063607 3300006051 Bacteria 2422
62 Ga0075364_10119284 3300006051 Bacteria 1765
63 Ga0075364_10273689 3300006051 Bacteria 1148
64 Ga0075364_10529472 3300006051 Bacteria 806
65 Ga0075364_10636342 3300006051 Bacteria 729
66 Ga0075364_10646067 3300006051 Bacteria 722
67 Ga0075364_10883135 3300006051 Bacteria 609
68 Ga0075362_10011847 3300006177 Bacteria 3445
69 Ga0075362_10303465 3300006177 Bacteria 792
70 Ga0075362_10596128 3300006177 Bacteria 571
71 Ga0075367_10050855 3300006178 Bacteria 2448
72 Ga0075367_10091416 3300006178 Bacteria 1851
73 Ga0075367_10262907 3300006178 Bacteria 1083
74 Ga0075370_10039877 3300006353 Bacteria 2647
75 Ga0075370_10114429 3300006353 Bacteria 1568
76 Ga0075370_10149753 3300006353 Bacteria 1367
77 Ga0075370_10219889 3300006353 Bacteria 1123
78 Ga0075370_10847886 3300006353 Bacteria 558
79 Ga0068865_100331521 3300006881 Bacteria 1227
80 Ga0068865_100796351 3300006881 Bacteria 815
81 Ga0111539_10928326 3300009094 Bacteria 1012
82 Ga0105245_10158695 3300009098 Bacteria 2145
83 Ga0105245_10164207 3300009098 Bacteria 2109
84 Ga0105245_10569951 3300009098 Bacteria 1156
85 Ga0105245_10933774 3300009098 Bacteria 910
86 Ga0105245_11101559 3300009098 Bacteria 840
87 Ga0105243_10024004 3300009148 Bacteria 4647
88 Ga0105243_10556284 3300009148 Bacteria 1097
89 Ga0105243_10626616 3300009148 Bacteria 1039
90 Ga0105248_10783703 3300009177 Bacteria 1076
91 Ga0105237_10697439 3300009545 Bacteria 1022
92 Ga0105238_10667547 3300009551 Bacteria 1050
93 Ga0105249_10275971 3300009553 Bacteria 1676
94 Ga0105249_10496553 3300009553 Bacteria 1265
95 Ga0105239_10549584 3300010375 Bacteria 1315
96 Ga0105246_10284028 3300011119 Bacteria 1329
97 Ga0105246_12359672 3300011119 Bacteria 521
98 Ga0157347_1072495 3300012502 Bacteria 511
99 Ga0157371_10576142 3300013102 Bacteria 836
100 Ga0157369_10907372 3300013105 Bacteria 903
101 Ga0157374_12213973 3300013296 Bacteria 577
102 Ga0157378_10200538 3300013297 Bacteria 1887
103 Ga0163162_12417549 3300013306 Bacteria 604
104 Ga0157372_10376456 3300013307 Bacteria 1654
105 Ga0157372_10688444 3300013307 Bacteria 1190
106 Ga0157375_10032789 3300013308 Bacteria 4929
107 Ga0157375_10109287 3300013308 Bacteria 2861
108 Ga0157375_10180173 3300013308 Bacteria 2264
109 Ga0157375_10754726 3300013308 Bacteria 1124
110 Ga0163163_10168013 3300014325 Bacteria 2240
111 Ga0163163_10496965 3300014325 Bacteria 1282
112 Ga0163163_11691348 3300014325 Bacteria 693
113 Ga0163163_12103437 3300014325 Bacteria 624
114 Ga0157380_11077332 3300014326 Bacteria 841
115 Ga0157377_10217197 3300014745 Bacteria 1222
116 Ga0157376_10625801 3300014969 Bacteria 1074
117 Ga0163161_10205296 3300017792 Bacteria 1520
118 Ga0163161_10556262 3300017792 Bacteria 941
119 Ga0163161_10596950 3300017792 Bacteria 910
120 Ga0207647_10593771 3300025904 Bacteria 611
121 Ga0207705_10065137 3300025909 Bacteria 2634
122 Ga0207707_10852123 3300025912 Bacteria 756
123 Ga0207660_10044701 3300025917 Bacteria 3117
124 Ga0207657_10675240 3300025919 Bacteria 803
125 Ga0207650_11415567 3300025925 Bacteria 591
126 Ga0207687_10153277 3300025927 Bacteria 1761
127 Ga0207687_10386057 3300025927 Bacteria 1148
128 Ga0207687_10756010 3300025927 Bacteria 827
129 Ga0207644_10636674 3300025931 Bacteria 887
130 Ga0207690_10722802 3300025932 Bacteria 820
131 Ga0207709_10017596 3300025935 Bacteria 3990
132 Ga0207669_10198357 3300025937 Bacteria 1455
133 Ga0207669_11135110 3300025937 Bacteria 661
134 Ga0207704_10532970 3300025938 Bacteria 952
135 Ga0207704_10973439 3300025938 Bacteria 716
136 Ga0207691_10236339 3300025940 Bacteria 1581
137 Ga0207711_10736333 3300025941 Bacteria 919
138 Ga0207661_10006039 3300025944 Bacteria 8555
139 Ga0207661_10099313 3300025944 Bacteria 2441
140 Ga0207661_10144807 3300025944 Bacteria 2049
141 Ga0207661_10592535 3300025944 Bacteria 1017
142 Ga0207661_10828339 3300025944 Bacteria 852
143 Ga0207712_10585662 3300025961 Bacteria 963
144 Ga0207658_10013310 3300025986 Bacteria 5618
145 Ga0207639_10366755 3300026041 Bacteria 1290
146 Ga0207678_10121487 3300026067 Bacteria 2229
147 Ga0207708_10364536 3300026075 Bacteria 1188
148 Ga0207702_10592636 3300026078 Bacteria 1087
149 Ga0207648_10822394 3300026089 Bacteria 865
150 Ga0207674_11396587 3300026116 Bacteria 670
151 Ga0207675_102120969 3300026118 Bacteria 578
152 Ga0207683_10335837 3300026121 Bacteria 1385
153 Ga0207683_10776520 3300026121 Bacteria 889
154 Ga0207698_10570965 3300026142 Bacteria 1111
155 Ga0209813_10004807 3300027866 Bacteria 3245
156 Ga0209813_10014067 3300027866 Bacteria 2148
157 Ga0209813_10104722 3300027866 Bacteria 967
158 Ga0209974_10281649 3300027876 Bacteria 632
159 Ga0268266_10059970 3300028379 Bacteria 3278
160 Ga0268266_10781158 3300028379 Bacteria 922
161 Ga0268266_10966988 3300028379 Bacteria 824
162 Ga0268264_10000280 3300028381 Bacteria 86361
163 Ga0268264_10446478 3300028381 Bacteria 1252
164 Ga0268264_10542199 3300028381 Bacteria 1140
165 Ga0316176_1073539 3300030732 Bacteria 590
166 Ga0307408_100879386 3300031548 Bacteria 819
167 Ga0307405_10346749 3300031731 Bacteria 1144
168 Ga0307413_10272161 3300031824 Bacteria 1269
169 Ga0307410_10216048 3300031852 Bacteria 1472
170 Ga0307410_10389657 3300031852 Bacteria 1123
171 Ga0307407_10203718 3300031903 Bacteria 1328
172 Ga0307412_10366152 3300031911 Bacteria 1162
173 Ga0307409_100082385 3300031995 Bacteria 2604
174 Ga0307409_100321018 3300031995 Bacteria 1449
175 Ga0307409_100499420 3300031995 Bacteria 1184
176 Ga0307409_101023113 3300031995 Bacteria 845
177 Ga0307409_101226364 3300031995 Bacteria 774
178 Ga0307409_101563369 3300031995 Bacteria 687
179 Ga0307416_100393135 3300032002 Bacteria 1421
180 Ga0307416_101104153 3300032002 Bacteria 898
181 Ga0307415_100132235 3300032126 Bacteria 1891
182 Ga0307415_100475381 3300032126 Bacteria 1087
183 Ga0373944_0077175 3300035089 Bacteria 1095
184 Ga0395900_1377918 3300037418 Bacteria 618
185 Ga0395898_0325525 3300037466 Bacteria 1466
186 Ga0395901_1482741 3300038443 Bacteria 635
187 Ga0439438_064478 3300041405 Bacteria 913
188 Ga0439447_021659 3300041407 Bacteria 1691
189 Ga0439461_0032952 3300041410 Bacteria 1088
190 Ga0439465_0129380 3300041413 Bacteria 890
191 Ga0451787_221817 3300041441 Bacteria 704
192 Ga0451789_1197046 3300041443 Bacteria 756
193 Ga0451791_0873625 3300041451 Bacteria 1053
194 Ga0451791_1818709 3300041451 Bacteria 553
195 Ga0451793_0770677 3300041452 Bacteria 1435
196 Ga0451797_1369760 3300041453 Bacteria 534
197 Ga0451807_1595745 3300041486 Bacteria 519
198 Ga0451841_0723127 3300041498 Bacteria 668
199 Ga0451853_0006820 3300041512 Bacteria 569
200 Ga0451853_0070923 3300041512 Bacteria 1122
201 Ga0451853_2249977 3300041512 Bacteria 576
202 Ga0451853_2577911 3300041512 Bacteria 1345
203 Ga0451853_2596379 3300041512 Bacteria 696
204 Ga0451853_3567168 3300041512 Bacteria 1002
205 Ga0439431_0041731 3300041997 Bacteria 1170
206 Ga0439442_014989 3300042002 Bacteria 1597
207 Ga0439457_015158 3300042014 Bacteria 1723
208 Ga0439434_0002469 3300042435 Bacteria 5379
209 Ga0466965_0054269 3300044683 Bacteria 1992
210 Ga0466966_0070053 3300044684 Bacteria 2199
211 Ga0466961_0167935 3300044693 Bacteria 1365
212 Ga0466961_0254299 3300044693 Bacteria 1078
213 Ga0466963_0105319 3300044694 Bacteria 1933
214 Ga0466963_0211225 3300044694 Bacteria 1358
215 Ga0466963_0242920 3300044694 Bacteria 1263
216 Ga0466963_0506583 3300044694 Bacteria 852
217 Ga0466963_0743029 3300044694 Bacteria 692
218 Ga0466964_0013119 3300044706 Bacteria 3142
219 Ga0466964_0023920 3300044706 Bacteria 2378
220 Ga0466964_0154446 3300044706 Bacteria 1067
221 Ga0466964_0300308 3300044706 Bacteria 809
222 Ga0466968_0209795 3300044735 Bacteria 915
223 Ga0466970_0038819 3300044765 Bacteria 2527
224 Ga0466957_0175211 3300044842 Bacteria 1399
225 Ga0466960_0001089 3300044901 Bacteria 9759
226 Ga0466960_0065779 3300044901 Bacteria 1791
227 Ga0466960_0108314 3300044901 Bacteria 1440
228 Ga0466959_0428332 3300045049 Bacteria 898
229 Ga0466967_0007822 3300045976 Bacteria 7766
230 Ga0466967_0079549 3300045976 Bacteria 2955
231 Ga0466967_0092980 3300045976 Bacteria 2743
232 Ga0466967_0113580 3300045976 Bacteria 2492
233 Ga0466967_0500970 3300045976 Bacteria 1192
234 Ga0466967_0531138 3300045976 Bacteria 1157
235 Ga0466967_1833990 3300045976 Bacteria 603
236 Ga0466967_2126471 3300045976 Bacteria 557
237 Ga0495629_0898013 3300046459 Bacteria 581
238 Ga0495641_0361275 3300046461 Bacteria 657
239 Ga0495641_0396214 3300046461 Bacteria 626
240 Ga0495582_0602531 3300046473 Bacteria 636
241 Ga0495608_0632139 3300046511 Bacteria 641
242 Ga0495657_0167170 3300046675 Bacteria 1357
243 Ga0495679_076163 3300047446 Bacteria 959
244 Ga0496100_0106997 3300048903 Bacteria 1937
245 Ga0496100_1127413 3300048903 Bacteria 618
246 Ga0496101_0049891 3300048904 Bacteria 3011
247 Ga0496101_0069499 3300048904 Bacteria 2577
248 Ga0496101_0215044 3300048904 Bacteria 1490
249 Ga0496102_0018801 3300048905 Bacteria 6077
250 Ga0496102_0106988 3300048905 Bacteria 2604
251 Ga0496102_0343737 3300048905 Bacteria 1405
252 Ga0496102_1922605 3300048905 Bacteria 508
253 Ga0496103_0155294 3300048906 Bacteria 1466
254 Ga0496103_0256938 3300048906 Bacteria 1124
255 Ga0496104_0009218 3300048907 Bacteria 8773
256 Ga0496104_0172019 3300048907 Bacteria 2077
257 Ga0496105_0003877 3300048908 Bacteria 11176
258 Ga0496107_0017255 3300048910 Bacteria 5076
259 Ga0496108_0086970 3300048911 Bacteria 2654
260 Ga0496108_0108465 3300048911 Bacteria 2372
261 Ga0496108_0262962 3300048911 Bacteria 1502
262 Ga0496108_0317660 3300048911 Bacteria 1358
263 Ga0496108_0799819 3300048911 Bacteria 814
264 Ga0496109_0064648 3300048912 Bacteria 3348
265 Ga0496109_0100833 3300048912 Bacteria 2679
266 Ga0496109_0423109 3300048912 Bacteria 1258
267 Ga0496109_0679088 3300048912 Bacteria 967
268 Ga0496109_0879081 3300048912 Bacteria 834
269 Ga0496109_1443837 3300048912 Bacteria 623
270 Ga0496110_0099828 3300048913 Bacteria 2602
271 Ga0496110_0147402 3300048913 Bacteria 2130
272 Ga0496110_0381136 3300048913 Bacteria 1285
273 Ga0496110_0832119 3300048913 Bacteria 828
274 Ga0496111_0306219 3300048914 Bacteria 1178
275 Ga0496113_0055576 3300048916 Bacteria 2968
276 Ga0496113_0503783 3300048916 Bacteria 972
277 Ga0496114_0018051 3300048917 Bacteria 5699
278 Ga0496114_0070919 3300048917 Bacteria 2927
279 Ga0496115_0057985 3300048918 Bacteria 3115
280 Ga0501032_0130219 3300049569 Bacteria 1660
281 Ga0501037_0447677 3300049573 Bacteria 881
282 Ga0501038_0634399 3300049574 Bacteria 806
283 Ga0501039_0543466 3300049575 Bacteria 912
284 Ga0501042_0611583 3300049578 Bacteria 792
285 Ga0501042_0967079 3300049578 Bacteria 620
286 Ga0501047_0078622 3300049581 Bacteria 3172
287 Ga0501048_0213682 3300049582 Bacteria 1368
288 Ga0501067_0002444 3300049583 Bacteria 10269
289 Ga0501067_0695978 3300049583 Bacteria 571
290 Ga0501068_0056850 3300049584 Bacteria 2372
291 Ga0501068_0057238 3300049584 Bacteria 2363
292 Ga0501068_0064252 3300049584 Bacteria 2234
293 Ga0501069_0021192 3300049585 Bacteria 3526
294 Ga0501069_0125115 3300049585 Bacteria 1470
295 Ga0501069_0256084 3300049585 Bacteria 1021
296 Ga0501069_0264766 3300049585 Bacteria 1004
297 Ga0501069_0350926 3300049585 Bacteria 869
298 Ga0501069_0532429 3300049585 Bacteria 702
299 Ga0501070_0003040 3300049586 Bacteria 14605
300 Ga0501070_0019281 3300049586 Bacteria 5720
301 Ga0501070_0287174 3300049586 Bacteria 1341
302 Ga0501070_0827710 3300049586 Bacteria 725
303 Ga0501070_1123170 3300049586 Bacteria 605
304 Ga0501071_0108465 3300049587 Bacteria 2051
305 Ga0501071_0543003 3300049587 Bacteria 893
306 Ga0501072_0113462 3300049588 Bacteria 2158
307 Ga0501072_0433023 3300049588 Bacteria 1042
308 Ga0501073_0014759 3300049589 Bacteria 5673
309 Ga0501073_0443721 3300049589 Bacteria 897
310 Ga0501074_0000883 3300049590 Bacteria 19144
311 Ga0501074_0008171 3300049590 Bacteria 7586
312 Ga0501074_0431821 3300049590 Bacteria 934
313 Ga0501075_0387083 3300049591 Bacteria 1066
314 Ga0501076_0249982 3300049592 Bacteria 1451
315 Ga0501077_0443195 3300049593 Bacteria 831
316 Ga0501079_0011349 3300049741 Bacteria 6797
317 Ga0501079_0057566 3300049741 Bacteria 2999
318 Ga0501079_0996019 3300049741 Bacteria 660
319 Ga0501080_0005932 3300049742 Bacteria 10948
320 Ga0501080_0013584 3300049742 Bacteria 7497
321 Ga0501080_0502753 3300049742 Bacteria 1083
322 Ga0501083_0009982 3300049744 Bacteria 6697
323 Ga0501083_0227538 3300049744 Bacteria 1215
324 Ga0501035_0408901 3300049822 Bacteria 1128
325 Ga0501044_0801895 3300049823 Bacteria 821
326 Ga0501045_0205538 3300049824 Bacteria 1467
327 nmdc:mga03683_112352_c1 3300050489 Bacteria 1205
328 nmdc:mga03683_138616_c1 3300050489 Bacteria 1092
329 nmdc:mga03683_56898_c1 3300050489 Bacteria 1645
330 nmdc:mga03n38_181888_c1 3300050490 Bacteria 1078
331 nmdc:mga03n38_517152_c1 3300050490 Bacteria 672
332 nmdc:mga00v17_122791_c1 3300050491 Bacteria 1655
333 nmdc:mga00v17_142222_c1 3300050491 Bacteria 1539
334 nmdc:mga00v17_177738_c1 3300050491 Bacteria 1373
335 nmdc:mga00v17_179813_c1 3300050491 Bacteria 1365
336 nmdc:mga00v17_184368_c1 3300050491 Bacteria 1347
337 nmdc:mga00v17_24889_c1 3300050491 Bacteria 3475
338 nmdc:mga00v17_288497_c1 3300050491 Bacteria 1065
339 nmdc:mga00v17_555768_c1 3300050491 Bacteria 742
340 nmdc:mga00v17_78660_c1 3300050491 Bacteria 2055
341 nmdc:mga00v17_804483_c1 3300050491 Bacteria 599
342 nmdc:mga00v17_8889_c1 3300050491 Bacteria 5418
343 nmdc:mga0yw44_11422_c1 3300050492 Bacteria 4584
344 nmdc:mga0yw44_116903_c1 3300050492 Bacteria 1714
345 nmdc:mga0yw44_127728_c1 3300050492 Bacteria 1643
346 nmdc:mga0yw44_13248_c1 3300050492 Bacteria 4334
347 nmdc:mga0yw44_142673_c1 3300050492 Bacteria 1557
348 nmdc:mga0yw44_187635_c1 3300050492 Bacteria 1363
349 nmdc:mga0yw44_20418_c1 3300050492 Bacteria 3676
350 nmdc:mga0yw44_28843_c1 3300050492 Bacteria 3197
351 nmdc:mga0yw44_424815_c1 3300050492 Bacteria 900
352 nmdc:mga0yw44_438133_c1 3300050492 Bacteria 885
353 nmdc:mga0yw44_459397_c1 3300050492 Bacteria 863
354 nmdc:mga0yw44_530322_c1 3300050492 Bacteria 799
355 nmdc:mga0yw44_62197_c1 3300050492 Bacteria 2292
356 nmdc:mga0yw44_63038_c1 3300050492 Bacteria 2278
357 nmdc:mga0yw44_666604_c1 3300050492 Bacteria 707
358 nmdc:mga0yw44_69897_c1 3300050492 Bacteria 2176
359 nmdc:mga0yw44_733734_c1 3300050492 Bacteria 671
360 nmdc:mga0yw44_92151_c1 3300050492 Bacteria 1917
361 nmdc:mga06z11_13868_c1 3300050494 Bacteria 3553
362 nmdc:mga06z11_185604_c1 3300050494 Bacteria 1201
363 nmdc:mga06z11_189085_c1 3300050494 Bacteria 1191
364 nmdc:mga06z11_248034_c1 3300050494 Bacteria 1048
365 nmdc:mga06z11_304409_c1 3300050494 Bacteria 948
366 nmdc:mga06z11_499338_c1 3300050494 Bacteria 737
367 nmdc:mga06z11_52689_c1 3300050494 Bacteria 2089
368 nmdc:mga04h51_13095_c1 3300050495 Bacteria 2343
369 nmdc:mga04h51_3049_c1 3300050495 Bacteria 4037
370 nmdc:mga04h51_32696_c1 3300050495 Bacteria 1651
371 nmdc:mga07m45_186617_c1 3300050496 Bacteria 1206
372 nmdc:mga07m45_496959_c1 3300050496 Bacteria 706
373 nmdc:mga07m45_53149_c1 3300050496 Bacteria 2289
374 nmdc:mga07m45_7746_c1 3300050496 Bacteria 5496
375 nmdc:mga07m45_82835_c1 3300050496 Bacteria 1832
376 nmdc:mga08y16_1902639_c1 3300050511 Bacteria 546
377 Ga0495595_0487639 3300053084 Bacteria 628
378 Ga0495619_0029442 3300053085 Bacteria 3547
379 Ga0500556_0000359 3300053104 Bacteria 33876
380 Ga0500593_000135 3300053117 Bacteria 29235
381 Ga0500573_0197614 3300053140 Bacteria 1070
382 Ga0501084_0080597 3300054114 Bacteria 2730
383 Ga0501084_0919867 3300054114 Bacteria 735
384 Ga0501084_1062114 3300054114 Bacteria 680
385 Ga0501082_0267753 3300060353 Bacteria 1487
386 Ga0501082_0822110 3300060353 Bacteria 813
387 Ga0501082_0987109 3300060353 Bacteria 736
388 Ga0530510_0323167 3300061734 Bacteria 1157
389 Ga0530510_0700284 3300061734 Bacteria 772
390 2643824671 2643221561 Bacteria 4984412
391 2644090851 2643221615 Bacteria 5487866
392 2644320654 2643221657 Bacteria 5490246
393 2644535923 2643221696 Bacteria 5431823
394 2857486151 2857481737 Bacteria 4761446
395 Ga0501084_0135571
396 JGI24735J21928_10132753
397 Ga0070683_100246114
398 Ga0070683_100540818
399 Ga0070683_100778360
400 Ga0070683_100793047
401 Ga0070683_101370313
402 Ga0068868_101318188
403 Ga0070660_100146791
404 Ga0070668_101698472
405 Ga0070668_102153004
406 Ga0070675_101768494
407 Ga0070671_100327272
408 Ga0070659_100807869
409 Ga0070667_100002932
410 Ga0070700_100335895
411 Ga0070678_101243112
412 Ga0070681_11163512
413 Ga0068867_100847390
414 Ga0068867_100917802
415 Ga0070679_100003906
416 Ga0070684_100394333
417 Ga0070684_100711243
418 Ga0070686_100425600
419 Ga0070665_100000996
420 Ga0070665_100163840
421 Ga0068855_101628036
422 Ga0070664_100298660
423 Ga0070664_100651586
424 Ga0068857_100943272
425 Ga0070702_101038708
426 Ga0070702_101039082
427 Ga0068870_10441301
428 Ga0068870_10640184
429 Ga0068863_102019377
430 Ga0068860_100000592
431 Ga0068860_100437952
432 Ga0068860_100467350
433 Ga0075365_10012171
434 Ga0075365_10116020
435 Ga0075365_10174905
436 Ga0075365_10182198
437 Ga0075365_10186730
438 Ga0075365_10215188
439 Ga0075365_10218687
440 Ga0075365_10235661
441 Ga0075365_10278068
442 Ga0075365_10383645
443 Ga0075365_10401141
444 Ga0075365_10432290
445 Ga0075365_10836568
446 Ga0075368_10001653
447 Ga0075368_10003527
448 Ga0075368_10052221
449 Ga0075363_100000679
450 Ga0075363_100002871
451 Ga0075363_100129480
452 Ga0075363_100183752
453 Ga0075364_10034694
454 Ga0075364_10035966
455 Ga0075364_10063607
456 Ga0075364_10119284
457 Ga0075364_10273689
458 Ga0075364_10529472
459 Ga0075364_10636342
460 Ga0075364_10646067
461 Ga0075364_10883135
462 Ga0075362_10011847
463 Ga0075362_10303465
464 Ga0075362_10596128
465 Ga0075367_10050855
466 Ga0075367_10091416
467 Ga0075367_10262907
468 Ga0075370_10039877
469 Ga0075370_10114429
470 Ga0075370_10149753
471 Ga0075370_10219889
472 Ga0075370_10847886
473 Ga0068865_100331521
474 Ga0068865_100796351
475 Ga0111539_10928326
476 Ga0105245_10158695
477 Ga0105245_10164207
478 Ga0105245_10569951
479 Ga0105245_10933774
480 Ga0105245_11101559
481 Ga0105243_10024004
482 Ga0105243_10556284
483 Ga0105243_10626616
484 Ga0105248_10783703
485 Ga0105237_10697439
486 Ga0105238_10667547
487 Ga0105249_10275971
488 Ga0105249_10496553
489 Ga0105239_10549584
490 Ga0105246_10284028
491 Ga0105246_12359672
492 Ga0157347_1072495
493 Ga0157371_10576142
494 Ga0157369_10907372
495 Ga0157374_12213973
496 Ga0157378_10200538
497 Ga0163162_12417549
498 Ga0157372_10376456
499 Ga0157372_10688444
500 Ga0157375_10032789
501 Ga0157375_10109287
502 Ga0157375_10180173
503 Ga0157375_10754726
504 Ga0163163_10168013
505 Ga0163163_10496965
506 Ga0163163_11691348
507 Ga0163163_12103437
508 Ga0157380_11077332
509 Ga0157377_10217197
510 Ga0157376_10625801
511 Ga0163161_10205296
512 Ga0163161_10556262
513 Ga0163161_10596950
514 Ga0207647_10593771
515 Ga0207705_10065137
516 Ga0207707_10852123
517 Ga0207660_10044701
518 Ga0207657_10675240
519 Ga0207650_11415567
520 Ga0207687_10153277
521 Ga0207687_10386057
522 Ga0207687_10756010
523 Ga0207644_10636674
524 Ga0207690_10722802
525 Ga0207709_10017596
526 Ga0207669_10198357
527 Ga0207669_11135110
528 Ga0207704_10532970
529 Ga0207704_10973439
530 Ga0207691_10236339
531 Ga0207711_10736333
532 Ga0207661_10006039
533 Ga0207661_10099313
534 Ga0207661_10144807
535 Ga0207661_10592535
536 Ga0207661_10828339
537 Ga0207712_10585662
538 Ga0207658_10013310
539 Ga0207639_10366755
540 Ga0207678_10121487
541 Ga0207708_10364536
542 Ga0207702_10592636
543 Ga0207648_10822394
544 Ga0207674_11396587
545 Ga0207675_102120969
546 Ga0207683_10335837
547 Ga0207683_10776520
548 Ga0207698_10570965
549 Ga0209813_10004807
550 Ga0209813_10014067
551 Ga0209813_10104722
552 Ga0209974_10281649
553 Ga0268266_10059970
554 Ga0268266_10781158
555 Ga0268266_10966988
556 Ga0268264_10000280
557 Ga0268264_10446478
558 Ga0268264_10542199
559 Ga0316176_1073539
560 Ga0307408_100879386
561 Ga0307405_10346749
562 Ga0307413_10272161
563 Ga0307410_10216048
564 Ga0307410_10389657
565 Ga0307407_10203718
566 Ga0307412_10366152
567 Ga0307409_100082385
568 Ga0307409_100321018
569 Ga0307409_100499420
570 Ga0307409_101023113
571 Ga0307409_101226364
572 Ga0307409_101563369
573 Ga0307416_100393135
574 Ga0307416_101104153
575 Ga0307415_100132235
576 Ga0307415_100475381
577 Ga0373944_0077175
578 Ga0395900_1377918
579 Ga0395898_0325525
580 Ga0395901_1482741
581 Ga0439438_064478
582 Ga0439447_021659
583 Ga0439461_0032952
584 Ga0439465_0129380
585 Ga0451787_221817
586 Ga0451789_1197046
587 Ga0451791_0873625
588 Ga0451791_1818709
589 Ga0451793_0770677
590 Ga0451797_1369760
591 Ga0451807_1595745
592 Ga0451841_0723127
593 Ga0451853_0006820
594 Ga0451853_0070923
595 Ga0451853_2249977
596 Ga0451853_2577911
597 Ga0451853_2596379
598 Ga0451853_3567168
599 Ga0439431_0041731
600 Ga0439442_014989
601 Ga0439457_015158
602 Ga0439434_0002469
603 Ga0466965_0054269
604 Ga0466966_0070053
605 Ga0466961_0167935
606 Ga0466961_0254299
607 Ga0466963_0105319
608 Ga0466963_0211225
609 Ga0466963_0242920
610 Ga0466963_0506583
611 Ga0466963_0743029
612 Ga0466964_0013119
613 Ga0466964_0023920
614 Ga0466964_0154446
615 Ga0466964_0300308
616 Ga0466968_0209795
617 Ga0466970_0038819
618 Ga0466957_0175211
619 Ga0466960_0001089
620 Ga0466960_0065779
621 Ga0466960_0108314
622 Ga0466959_0428332
623 Ga0466967_0007822
624 Ga0466967_0079549
625 Ga0466967_0092980
626 Ga0466967_0113580
627 Ga0466967_0500970
628 Ga0466967_0531138
629 Ga0466967_1833990
630 Ga0466967_2126471
631 Ga0495629_0898013
632 Ga0495641_0361275
633 Ga0495641_0396214
634 Ga0495582_0602531
635 Ga0495608_0632139
636 Ga0495657_0167170
637 Ga0495679_076163
638 Ga0496100_0106997
639 Ga0496100_1127413
640 Ga0496101_0049891
641 Ga0496101_0069499
642 Ga0496101_0215044
643 Ga0496102_0018801
644 Ga0496102_0106988
645 Ga0496102_0343737
646 Ga0496102_1922605
647 Ga0496103_0155294
648 Ga0496103_0256938
649 Ga0496104_0009218
650 Ga0496104_0172019
651 Ga0496105_0003877
652 Ga0496107_0017255
653 Ga0496108_0086970
654 Ga0496108_0108465
655 Ga0496108_0262962
656 Ga0496108_0317660
657 Ga0496108_0799819
658 Ga0496109_0064648
659 Ga0496109_0100833
660 Ga0496109_0423109
661 Ga0496109_0679088
662 Ga0496109_0879081
663 Ga0496109_1443837
664 Ga0496110_0099828
665 Ga0496110_0147402
666 Ga0496110_0381136
667 Ga0496110_0832119
668 Ga0496111_0306219
669 Ga0496113_0055576
670 Ga0496113_0503783
671 Ga0496114_0018051
672 Ga0496114_0070919
673 Ga0496115_0057985
674 Ga0501032_0130219
675 Ga0501037_0447677
676 Ga0501038_0634399
677 Ga0501039_0543466
678 Ga0501042_0611583
679 Ga0501042_0967079
680 Ga0501047_0078622
681 Ga0501048_0213682
682 Ga0501067_0002444
683 Ga0501067_0695978
684 Ga0501068_0056850
685 Ga0501068_0057238
686 Ga0501068_0064252
687 Ga0501069_0021192
688 Ga0501069_0125115
689 Ga0501069_0256084
690 Ga0501069_0264766
691 Ga0501069_0350926
692 Ga0501069_0532429
693 Ga0501070_0003040
694 Ga0501070_0019281
695 Ga0501070_0287174
696 Ga0501070_0827710
697 Ga0501070_1123170
698 Ga0501071_0108465
699 Ga0501071_0543003
700 Ga0501072_0113462
701 Ga0501072_0433023
702 Ga0501073_0014759
703 Ga0501073_0443721
704 Ga0501074_0000883
705 Ga0501074_0008171
706 Ga0501074_0431821
707 Ga0501075_0387083
708 Ga0501076_0249982
709 Ga0501077_0443195
710 Ga0501079_0011349
711 Ga0501079_0057566
712 Ga0501079_0996019
713 Ga0501080_0005932
714 Ga0501080_0013584
715 Ga0501080_0502753
716 Ga0501083_0009982
717 Ga0501083_0227538
718 Ga0501035_0408901
719 Ga0501044_0801895
720 Ga0501045_0205538
721 nmdc:mga03683_112352_c1
722 nmdc:mga03683_138616_c1
723 nmdc:mga03683_56898_c1
724 nmdc:mga03n38_181888_c1
725 nmdc:mga03n38_517152_c1
726 nmdc:mga00v17_122791_c1
727 nmdc:mga00v17_142222_c1
728 nmdc:mga00v17_177738_c1
729 nmdc:mga00v17_179813_c1
730 nmdc:mga00v17_184368_c1
731 nmdc:mga00v17_24889_c1
732 nmdc:mga00v17_288497_c1
733 nmdc:mga00v17_555768_c1
734 nmdc:mga00v17_78660_c1
735 nmdc:mga00v17_804483_c1
736 nmdc:mga00v17_8889_c1
737 nmdc:mga0yw44_11422_c1
738 nmdc:mga0yw44_116903_c1
739 nmdc:mga0yw44_127728_c1
740 nmdc:mga0yw44_13248_c1
741 nmdc:mga0yw44_142673_c1
742 nmdc:mga0yw44_187635_c1
743 nmdc:mga0yw44_20418_c1
744 nmdc:mga0yw44_28843_c1
745 nmdc:mga0yw44_424815_c1
746 nmdc:mga0yw44_438133_c1
747 nmdc:mga0yw44_459397_c1
748 nmdc:mga0yw44_530322_c1
749 nmdc:mga0yw44_62197_c1
750 nmdc:mga0yw44_63038_c1
751 nmdc:mga0yw44_666604_c1
752 nmdc:mga0yw44_69897_c1
753 nmdc:mga0yw44_733734_c1
754 nmdc:mga0yw44_92151_c1
755 nmdc:mga06z11_13868_c1
756 nmdc:mga06z11_185604_c1
757 nmdc:mga06z11_189085_c1
758 nmdc:mga06z11_248034_c1
759 nmdc:mga06z11_304409_c1
760 nmdc:mga06z11_499338_c1
761 nmdc:mga06z11_52689_c1
762 nmdc:mga04h51_13095_c1
763 nmdc:mga04h51_3049_c1
764 nmdc:mga04h51_32696_c1
765 nmdc:mga07m45_186617_c1
766 nmdc:mga07m45_496959_c1
767 nmdc:mga07m45_53149_c1
768 nmdc:mga07m45_7746_c1
769 nmdc:mga07m45_82835_c1
770 nmdc:mga08y16_1902639_c1
771 Ga0495595_0487639
772 Ga0495619_0029442
773 Ga0500556_0000359
774 Ga0500593_000135
775 Ga0500573_0197614
776 Ga0501084_0080597
777 Ga0501084_0919867
778 Ga0501084_1062114
779 Ga0501082_0267753
780 Ga0501082_0822110
781 Ga0501082_0987109
782 Ga0530510_0323167
783 Ga0530510_0700284
784 2643824671
785 2644090851
786 2644320654
787 2644535923
788 2857486151

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01475

FUR

Ferric uptake regulator family

24

142

0.91

PF03965

Penicillinase_R

Penicillinase repressor

29

115

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9273 23 85
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9092 24 84
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9053 23 84
4yif-assembly2.cif.gz_D crystal structure of rv0880 0.9017 17 85
3cuo-assembly2.cif.gz_C crystal structure of the predicted dna-binding transcriptional regulator from e. coli 0.8986 20 85
ID Description Score Start End Superfamily
3eyyB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9539 6 84 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9273 23 85 1.10.10.10
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9197 20 84 1.10.10.10
3eyyB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9094 6 84 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9092 24 84 1.10.10.10
ID Description Score Start End GO Terms
AF-E3J5T1-F1-model_v4 Ferric uptake regulator, Fur family 0.9186 4 137 GO:0000976
GO:0003700
GO:0008270
GO:0045892
GO:1900376
AF-A0A838G951-F1-model_v4 Transcriptional repressor 0.907 6 139 GO:0000976
GO:0003700
GO:0008270
GO:0045892
GO:1900376
AF-A0A542S464-F1-model_v4 Fur family ferric uptake transcriptional regulator 0.907 5 138 GO:0000976
GO:0003700
GO:0008270
GO:0045892
GO:1900376
AF-A0A1F8MT07-F1-model_v4 Transcriptional repressor 0.9042 19 138 GO:0000976
GO:0003700
GO:0008270
GO:0045892
GO:1900376
AF-A0A0Q8HXB4-F1-model_v4 Fur family transcriptional regulator 0.8998 7 137 GO:0000976
GO:0003700
GO:0008270
GO:0045892
GO:1900376

Map