F432985

General Info

Members Datasets Scaffolds Average Seq Length
394 266 354 186

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0581691|Ga0453684_0581691_377_967
Length 196
Sequence MTSAPAQGLVAHGLEAPSAWVQRWSHLVRPGGTVLDVACGHGRHMQWFAARGHPVTGVDRSPEAIAAVASLGEAVQADIENGPWPLMQDGQPRQFDAVVVTNYLWRALLPVIRQSLAPGGVLLYETFTLGNETVGKPSRPDFLLQPGELLREFADLRVVAYEDGFIAQPARFVQRIAAVRQGTPLSTDKALARYML

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
9 2643221652 Acidovorax sp. Root402 Isolate Unclassified
10 2643221658 Variovorax sp. Root411 Isolate Unclassified
11 2643221672 Variovorax sp. Root434 Isolate Unclassified
12 2643221683 Variovorax sp. Root473 Isolate Unclassified
13 2643221717 Acidovorax sp. Root267 Isolate Unclassified
14 2738541277 Variovorax sp. GV051 Isolate Unclassified
15 2738541307 Variovorax sp. GV008 Isolate Unclassified
16 2738543012 Acidovorax sp. CF301 Isolate Unclassified
17 2738543019 Variovorax sp. GV040 Isolate Unclassified
18 2818991446 Variovorax sp. 1180 Isolate Unclassified
19 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
20 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
21 2842677519 Variovorax sp. R-72495 Isolate Unclassified
22 2842733646 Variovorax sp. R-72446 Isolate Unclassified
23 2885198086 Variovorax sp. 679 Isolate Unclassified
24 2885211737 Variovorax sp. 553 Isolate Unclassified
25 2899924645 Variovorax sp. 369 Isolate Unclassified
26 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
27 2904456579 Variovorax sp. 2002 Isolate Unclassified
28 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
29 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
30 2928037797 Variovorax sp. 1126 Isolate Unclassified
31 2928044640 Variovorax sp. 1128 Isolate Unclassified
32 2928051484 Variovorax sp. 1133 Isolate Unclassified
33 2928070936 Variovorax gossypii 1167 Isolate Unclassified
34 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
35 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
36 2929520902 Variovorax beijingensis 502 Isolate Unclassified
37 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
38 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
39 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
40 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
41 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
42 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
43 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
44 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
45 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
46 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
47 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
48 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
49 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
50 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
51 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
52 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
53 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
54 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
55 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
56 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
106 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
147 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
148 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
149 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
150 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
151 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
162 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
163 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
164 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
165 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
166 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
167 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
168 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
169 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
170 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
171 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
172 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
173 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
174 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
175 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
176 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
177 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
178 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
179 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
180 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
181 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
182 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
183 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
196 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
197 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
198 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
199 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
202 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
215 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
227 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
230 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
237 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
238 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
245 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
246 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
247 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
248 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
249 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
250 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
251 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
252 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
253 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
254 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
255 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
256 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
257 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
258 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
259 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
264 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
265 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
266 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.85
Metatranscriptomes 0
Isolates 10.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.71
Nodule 0.76
Rhizoplane 5.08
Rhizosphere 51.27
Stem 0
Stem Tuber 0
Unclassified 12.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10037077 3300001989 Bacteria 1644
2 JGI25152J39213_1008871 3300002773 Bacteria 2448
3 JGI25150J39212_1005975 3300002774 Bacteria 2556
4 JGI25159J45721_1012833 3300002987 Bacteria 1974
5 JGI25151J46595_10001314 3300003187 Bacteria 17394
6 JGI25151J46595_10007994 3300003187 Bacteria 5128
7 JGI25151J46595_10019471 3300003187 Bacteria 2883
8 JGI25153J46596_10037898 3300003215 Bacteria 1527
9 rootH1_10006805 3300003316 Bacteria 3738
10 rootH2_10044759 3300003320 Bacteria 1046
11 JGI25160J50197_1028397 3300003354 Bacteria 1503
12 Ga0055535_1002162 3300003761 Bacteria 7614
13 Ga0055542_1000087 3300003762 Bacteria 123666
14 Ga0055536_1003127 3300003781 Bacteria 8989
15 Ga0055536_1010072 3300003781 Bacteria 3808
16 Ga0055536_1043225 3300003781 Bacteria 1048
17 Ga0055530_10000492 3300003791 Bacteria 34175
18 Ga0055540_1003253 3300003792 Bacteria 7961
19 Ga0055540_1007552 3300003792 Bacteria 4073
20 Ga0055540_1013970 3300003792 Bacteria 2421
21 Ga0055531_10001855 3300003794 Bacteria 14853
22 Ga0055531_10037310 3300003794 Bacteria 1480
23 Ga0055531_10072334 3300003794 Bacteria 790
24 Ga0070658_10096585 3300005327 Bacteria 2440
25 Ga0068869_100020707 3300005334 Bacteria 4514
26 Ga0068868_100325409 3300005338 Bacteria 1310
27 Ga0068868_100694687 3300005338 Bacteria 910
28 Ga0070673_100652098 3300005364 Bacteria 964
29 Ga0070667_100085849 3300005367 Bacteria 2700
30 Ga0070667_100252780 3300005367 Bacteria 1576
31 Ga0070678_100610945 3300005456 Bacteria 974
32 Ga0070662_100015528 3300005457 Bacteria 5103
33 Ga0068867_100584520 3300005459 Bacteria 972
34 Ga0068853_100005208 3300005539 Bacteria 10169
35 Ga0070672_100185747 3300005543 Bacteria 1734
36 Ga0070665_100326143 3300005548 Bacteria 1539
37 Ga0068855_100297279 3300005563 Bacteria 1789
38 Ga0068857_101172972 3300005577 Bacteria 743
39 Ga0068854_100208943 3300005578 Bacteria 1539
40 Ga0068854_100611008 3300005578 Bacteria 932
41 Ga0068852_100138477 3300005616 Bacteria 2250
42 Ga0068852_100331327 3300005616 Bacteria 1481
43 Ga0068852_100433322 3300005616 Bacteria 1299
44 Ga0068851_10061028 3300005834 Bacteria 1932
45 Ga0068863_100983334 3300005841 Bacteria 846
46 Ga0068860_100907705 3300005843 Bacteria 897
47 Ga0068862_100070359 3300005844 Bacteria 3021
48 Ga0075365_10038179 3300006038 Bacteria 3120
49 Ga0075363_100034165 3300006048 Bacteria 2653
50 Ga0075363_100121305 3300006048 Bacteria 1460
51 Ga0075363_100372844 3300006048 Bacteria 836
52 Ga0075364_10229246 3300006051 Bacteria 1261
53 Ga0075432_10093771 3300006058 Bacteria 1101
54 Ga0075362_10001536 3300006177 Bacteria 7443
55 Ga0075362_10029707 3300006177 Bacteria 2357
56 Ga0075362_10048826 3300006177 Bacteria 1889
57 Ga0075362_10184216 3300006177 Bacteria 1012
58 Ga0075367_10363776 3300006178 Bacteria 913
59 Ga0075366_10010971 3300006195 Bacteria 5100
60 Ga0075366_10047092 3300006195 Bacteria 2556
61 Ga0075366_10257249 3300006195 Bacteria 1065
62 Ga0075366_10266250 3300006195 Bacteria 1046
63 Ga0075366_10471815 3300006195 Bacteria 775
64 Ga0097621_100552643 3300006237 Bacteria 1048
65 Ga0075370_10008542 3300006353 Bacteria 5276
66 Ga0075370_10046427 3300006353 Bacteria 2458
67 Ga0075370_10176867 3300006353 Bacteria 1255
68 Ga0075370_10274532 3300006353 Bacteria 1001
69 Ga0068871_100053786 3300006358 Bacteria 3264
70 Ga0099826_10163178 3300006948 Bacteria 1260
71 Ga0099826_10348996 3300006948 Bacteria 737
72 Ga0105244_10004693 3300009036 Bacteria 9311
73 Ga0105245_10749167 3300009098 Bacteria 1013
74 Ga0105243_10009710 3300009148 Bacteria 7328
75 Ga0105243_10020150 3300009148 Bacteria 5055
76 Ga0105242_10562537 3300009176 Bacteria 1095
77 Ga0105237_10257893 3300009545 Bacteria 1746
78 Ga0105238_10915651 3300009551 Bacteria 896
79 Ga0105239_10383288 3300010375 Bacteria 1589
80 Ga0105246_10088977 3300011119 Bacteria 2220
81 Ga0105246_10285122 3300011119 Bacteria 1327
82 Ga0157347_1019401 3300012502 Bacteria 785
83 Ga0157373_10027789 3300013100 Bacteria 4081
84 Ga0157373_10257096 3300013100 Bacteria 1236
85 Ga0157373_10326485 3300013100 Bacteria 1092
86 Ga0157370_10037489 3300013104 Bacteria 4699
87 Ga0157370_10436312 3300013104 Bacteria 1204
88 Ga0157370_11130318 3300013104 Bacteria 707
89 Ga0157370_11134255 3300013104 Bacteria 706
90 Ga0157369_10013458 3300013105 Bacteria 9246
91 Ga0163162_10024877 3300013306 Bacteria 5914
92 Ga0182008_10011535 3300014497 Bacteria 4693
93 Ga0182008_10021365 3300014497 Bacteria 3323
94 Ga0157376_10742295 3300014969 Bacteria 990
95 Ga0182006_1002216 3300015261 Bacteria 10773
96 Ga0182006_1042687 3300015261 Bacteria 1775
97 Ga0182006_1097797 3300015261 Bacteria 1046
98 Ga0182006_1104774 3300015261 Bacteria 999
99 Ga0182007_10000601 3300015262 Bacteria 21082
100 Ga0182007_10000825 3300015262 Bacteria 17267
101 Ga0182005_1014672 3300015265 Bacteria 2191
102 Ga0163161_10011479 3300017792 Bacteria 6147
103 Ga0163161_10035549 3300017792 Bacteria 3567
104 Ga0163161_10046138 3300017792 Bacteria 3143
105 Ga0163161_10092071 3300017792 Bacteria 2244
106 Ga0163161_10164250 3300017792 Bacteria 1694
107 Ga0209436_107649 3300025208 Bacteria 2233
108 Ga0209672_101515 3300025228 Bacteria 8079
109 Ga0209258_100199 3300025242 Bacteria 123718
110 Ga0207425_1004716 3300025245 Bacteria 4023
111 Ga0209148_1000179 3300025254 Bacteria 126083
112 Ga0209129_1000071 3300025258 Bacteria 210729
113 Ga0209129_1001902 3300025258 Bacteria 11014
114 Ga0209565_1002195 3300025263 Bacteria 7317
115 Ga0209673_1001906 3300025273 Bacteria 16707
116 Ga0209673_1020278 3300025273 Bacteria 2359
117 Ga0209130_1000773 3300025284 Bacteria 27625
118 Ga0209130_1036330 3300025284 Bacteria 979
119 Ga0209675_1006924 3300025291 Bacteria 4447
120 Ga0209676_1000005 3300025292 Bacteria 1076001
121 Ga0209676_1001007 3300025292 Bacteria 33026
122 Ga0209676_1003004 3300025292 Bacteria 10965
123 Ga0209025_1000544 3300025294 Bacteria 70638
124 Ga0209025_1004201 3300025294 Bacteria 12707
125 Ga0209564_1000239 3300025295 Bacteria 119761
126 Ga0209758_1000027 3300025297 Bacteria 549650
127 Ga0209758_1003037 3300025297 Bacteria 15990
128 Ga0209050_1000007 3300025298 Bacteria 1187891
129 Ga0209050_1001089 3300025298 Bacteria 33034
130 Ga0209050_1044987 3300025298 Bacteria 1175
131 Ga0209256_1000081 3300025299 Bacteria 222908
132 Ga0207426_1000027 3300025302 Bacteria 513176
133 Ga0207426_1000614 3300025302 Bacteria 45951
134 Ga0209051_1000009 3300025303 Bacteria 706778
135 Ga0209051_1000347 3300025303 Bacteria 68841
136 Ga0209051_1000373 3300025303 Bacteria 64348
137 Ga0209051_1000553 3300025303 Bacteria 45537
138 Ga0209051_1002578 3300025303 Bacteria 12758
139 Ga0209257_1000011 3300025304 Bacteria 1112630
140 Ga0209257_1000449 3300025304 Bacteria 77522
141 Ga0209257_1007816 3300025304 Bacteria 6334
142 Ga0207655_1001731 3300025728 Bacteria 19151
143 Ga0207681_10082163 3300025923 Bacteria 2277
144 Ga0207694_10112687 3300025924 Bacteria 2165
145 Ga0207687_10088804 3300025927 Bacteria 2249
146 Ga0207687_10652041 3300025927 Bacteria 890
147 Ga0207706_10006469 3300025933 Bacteria 10879
148 Ga0207706_10025344 3300025933 Bacteria 5314
149 Ga0207686_10490696 3300025934 Bacteria 951
150 Ga0207709_10001584 3300025935 Bacteria 15523
151 Ga0207709_10010549 3300025935 Bacteria 5088
152 Ga0207709_10048245 3300025935 Bacteria 2594
153 Ga0207669_11099157 3300025937 Bacteria 671
154 Ga0207691_10179608 3300025940 Bacteria 1850
155 Ga0207667_10212548 3300025949 Bacteria 1982
156 Ga0207668_10232282 3300025972 Bacteria 1488
157 Ga0207640_10543384 3300025981 Bacteria 975
158 Ga0207640_10617161 3300025981 Bacteria 920
159 Ga0207658_10083045 3300025986 Bacteria 2461
160 Ga0207677_10085588 3300026023 Bacteria 2276
161 Ga0207677_10111890 3300026023 Bacteria 2035
162 Ga0207702_10469942 3300026078 Bacteria 1223
163 Ga0207648_10075188 3300026089 Bacteria 2945
164 Ga0207648_10463095 3300026089 Bacteria 1156
165 Ga0207674_10364952 3300026116 Bacteria 1396
166 Ga0207683_10176934 3300026121 Bacteria 1934
167 Ga0207698_10095965 3300026142 Bacteria 2442
168 Ga0207698_10103117 3300026142 Bacteria 2370
169 Ga0207698_10671579 3300026142 Bacteria 1028
170 Ga0268266_10013638 3300028379 Bacteria 6999
171 Ga0268266_10648663 3300028379 Bacteria 1016
172 Ga0268264_10493490 3300028381 Bacteria 1193
173 Ga0307515_10000110 3300028794 Bacteria 195560
174 Ga0307515_10355143 3300028794 Bacteria 1110
175 Ga0316177_1127556 3300030731 Bacteria 4449
176 Ga0316176_1066153 3300030732 Bacteria 6972
177 Ga0316178_1094039 3300030735 Bacteria 3328
178 Ga0316183_1057193 3300030742 Bacteria 2250
179 Ga0316181_1035278 3300030744 Bacteria 8135
180 Ga0316182_1266332 3300030745 Bacteria 1068
181 Ga0307408_100142697 3300031548 Bacteria 1881
182 Ga0307408_100245714 3300031548 Bacteria 1473
183 Ga0307408_100614523 3300031548 Bacteria 967
184 Ga0307408_100875682 3300031548 Bacteria 820
185 Ga0307514_10085169 3300031649 Bacteria 2324
186 Ga0307514_10088797 3300031649 Bacteria 2261
187 Ga0307405_10001308 3300031731 Bacteria 10408
188 Ga0307405_10045486 3300031731 Bacteria 2690
189 Ga0307405_10057533 3300031731 Bacteria 2443
190 Ga0307405_10333016 3300031731 Bacteria 1164
191 Ga0307405_10388662 3300031731 Bacteria 1088
192 Ga0307405_10470981 3300031731 Bacteria 1000
193 Ga0307406_10000749 3300031901 Bacteria 18227
194 Ga0307407_10183238 3300031903 Bacteria 1389
195 Ga0307412_10035707 3300031911 Bacteria 3178
196 Ga0307412_10046967 3300031911 Bacteria 2832
197 Ga0307412_10081245 3300031911 Bacteria 2241
198 Ga0307412_10748151 3300031911 Bacteria 843
199 Ga0307412_10992161 3300031911 Bacteria 741
200 Ga0307416_100081998 3300032002 Bacteria 2730
201 Ga0307414_10149296 3300032004 Bacteria 1841
202 Ga0307414_10249816 3300032004 Bacteria 1474
203 Ga0307414_10298732 3300032004 Bacteria 1361
204 Ga0307411_10104682 3300032005 Bacteria 2010
205 Ga0307411_10121137 3300032005 Bacteria 1893
206 Ga0307411_10251357 3300032005 Bacteria 1390
207 Ga0439436_0029802 3300041404 Bacteria 1587
208 Ga0439439_0011043 3300041406 Bacteria 2167
209 Ga0439447_026594 3300041407 Bacteria 1482
210 Ga0439461_0013940 3300041410 Bacteria 1522
211 Ga0439466_0021845 3300041411 Bacteria 2263
212 Ga0439465_0060292 3300041413 Bacteria 1256
213 Ga0451791_0130579 3300041451 Bacteria 1489
214 Ga0451802_2037073 3300041460 Bacteria 685
215 Ga0439442_000506 3300042002 Bacteria 8767
216 Ga0439442_010780 3300042002 Bacteria 1856
217 Ga0439445_0066995 3300042004 Bacteria 989
218 Ga0439432_034809 3300042006 Bacteria 1615
219 Ga0439449_0009675 3300042007 Bacteria 3648
220 Ga0439462_0007278 3300042015 Bacteria 2766
221 Ga0450920_021113 3300042122 Bacteria 1258
222 Ga0450897_003278 3300042128 Bacteria 1289
223 Ga0450898_004980 3300042134 Bacteria 1988
224 Ga0450898_006727 3300042134 Bacteria 1774
225 Ga0450889_006506 3300042144 Bacteria 1173
226 Ga0450906_001292 3300042145 Bacteria 5495
227 Ga0450906_003902 3300042145 Bacteria 3160
228 Ga0450906_013541 3300042145 Bacteria 1502
229 Ga0450907_009867 3300042146 Bacteria 1583
230 Ga0450907_023367 3300042146 Bacteria 1043
231 Ga0450910_010794 3300042147 Bacteria 1305
232 Ga0450910_020797 3300042147 Bacteria 991
233 Ga0450908_008568 3300042184 Bacteria 1915
234 Ga0450908_012096 3300042184 Bacteria 1569
235 Ga0439434_0009598 3300042435 Bacteria 2847
236 Ga0450918_000592 3300042531 Bacteria 7761
237 Ga0451577_0003831 3300042876 Bacteria 16362
238 Ga0451577_0104369 3300042876 Bacteria 2533
239 Ga0466965_0152194 3300044683 Bacteria 1209
240 Ga0453684_0581691 3300044712 Bacteria 1230
241 Ga0451576_0321355 3300045051 Bacteria 1620
242 Ga0495627_117680 3300046453 Bacteria 751
243 Ga0495629_0132534 3300046459 Bacteria 1736
244 Ga0495638_0137192 3300046460 Bacteria 1431
245 Ga0495651_0139228 3300046462 Bacteria 1762
246 Ga0495639_0045101 3300046475 Bacteria 1994
247 Ga0495664_0119847 3300046477 Bacteria 1592
248 Ga0495606_0108377 3300046507 Bacteria 1679
249 Ga0495616_0002637 3300046513 Bacteria 11790
250 Ga0495616_0285794 3300046513 Bacteria 700
251 Ga0495620_0024367 3300046515 Bacteria 2878
252 Ga0495631_0002010 3300046518 Bacteria 11851
253 Ga0495637_0097271 3300046520 Bacteria 1154
254 Ga0495643_0070781 3300046522 Bacteria 1831
255 Ga0495642_0170568 3300046528 Bacteria 945
256 Ga0495642_0215278 3300046528 Bacteria 838
257 Ga0495654_0022343 3300046530 Bacteria 3286
258 Ga0495654_0165699 3300046530 Bacteria 967
259 Ga0495622_0143950 3300046557 Bacteria 1081
260 Ga0495656_0000202 3300046615 Bacteria 21338
261 Ga0495668_0105529 3300046616 Bacteria 1541
262 Ga0495625_0119424 3300046660 Bacteria 1795
263 Ga0495625_0144819 3300046660 Bacteria 1600
264 Ga0495588_0017568 3300046674 Bacteria 3477
265 Ga0495588_0029275 3300046674 Bacteria 2762
266 Ga0495588_0397442 3300046674 Bacteria 723
267 Ga0495657_0057838 3300046675 Bacteria 2577
268 Ga0495658_0011936 3300046683 Bacteria 4384
269 Ga0495581_0087068 3300047315 Bacteria 1811
270 Ga0495676_0041433 3300047321 Bacteria 3790
271 Ga0495677_0252076 3300047445 Bacteria 690
272 Ga0495593_0034289 3300047673 Bacteria 2761
273 Ga0495602_0706371 3300048088 Bacteria 684
274 Ga0495614_0019254 3300048089 Bacteria 2954
275 Ga0495615_0029041 3300048090 Bacteria 1309
276 Ga0496101_0001014 3300048904 Bacteria 16554
277 Ga0496101_0044216 3300048904 Bacteria 3186
278 Ga0496102_0476316 3300048905 Bacteria 1169
279 Ga0496104_0140458 3300048907 Bacteria 2320
280 Ga0496105_0020999 3300048908 Bacteria 5281
281 Ga0496106_0060061 3300048909 Bacteria 2881
282 Ga0496107_0132292 3300048910 Bacteria 1842
283 Ga0496108_0172751 3300048911 Bacteria 1870
284 Ga0496110_0101400 3300048913 Bacteria 2580
285 Ga0496110_0152690 3300048913 Bacteria 2091
286 Ga0496110_0374943 3300048913 Bacteria 1297
287 Ga0496111_0196524 3300048914 Bacteria 1499
288 Ga0496111_0331413 3300048914 Bacteria 1127
289 Ga0496114_0059887 3300048917 Bacteria 3181
290 Ga0496114_0478729 3300048917 Bacteria 1101
291 Ga0496117_0040746 3300048920 Bacteria 3411
292 Ga0496117_0043935 3300048920 Bacteria 3241
293 Ga0496117_0186879 3300048920 Bacteria 1185
294 Ga0496118_0015239 3300048921 Bacteria 7130
295 Ga0496118_0026715 3300048921 Bacteria 4908
296 Ga0496121_0039089 3300048924 Bacteria 4188
297 Ga0496122_0445520 3300048925 Bacteria 644
298 Ga0496123_0000261 3300048926 Bacteria 106547
299 Ga0496123_0018667 3300048926 Bacteria 5500
300 Ga0496123_0245115 3300048926 Bacteria 887
301 Ga0496124_0084452 3300048927 Bacteria 2603
302 Ga0496124_0352344 3300048927 Bacteria 1041
303 Ga0496125_0085355 3300048928 Bacteria 2392
304 Ga0496125_0115002 3300048928 Bacteria 1936
305 Ga0496126_0269192 3300048929 Bacteria 1414
306 Ga0501046_0205699 3300049580 Bacteria 1463
307 Ga0501073_0052079 3300049589 Bacteria 2867
308 Ga0501249_016872 3300049679 Bacteria 1571
309 nmdc:mga03683_182873_c1 3300050489 Bacteria 957
310 nmdc:mga03683_19859_c1 3300050489 Bacteria 2570
311 nmdc:mga03n38_163967_c1 3300050490 Bacteria 1127
312 nmdc:mga03n38_234848_c1 3300050490 Bacteria 963
313 nmdc:mga03n38_330712_c1 3300050490 Bacteria 825
314 nmdc:mga03n38_8334_c1 3300050490 Bacteria 3716
315 nmdc:mga00v17_188764_c1 3300050491 Bacteria 1331
316 nmdc:mga0yw44_230705_c1 3300050492 Bacteria 1229
317 nmdc:mga0yw44_371606_c1 3300050492 Bacteria 965
318 nmdc:mga0k408_136321_c1 3300050493 Bacteria 1458
319 nmdc:mga0k408_342079_c1 3300050493 Bacteria 892
320 nmdc:mga0k408_46207_c1 3300050493 Bacteria 2514
321 nmdc:mga0k408_84168_c1 3300050493 Bacteria 1866
322 nmdc:mga06z11_39292_c1 3300050494 Bacteria 2354
323 nmdc:mga07m45_1912_c1 3300050496 Bacteria 9618
324 nmdc:mga07m45_255924_c1 3300050496 Bacteria 1018
325 nmdc:mga07m45_28493_c1 3300050496 Bacteria 3083
326 nmdc:mga07m45_34770_c1 3300050496 Bacteria 2802
327 nmdc:mga0sz30_75035_c1 3300050516 Bacteria 1459
328 Ga0500610_0046780 3300053079 Bacteria 2247
329 Ga0500610_0054170 3300053079 Bacteria 2091
330 Ga0500643_011857 3300053087 Bacteria 3154
331 Ga0500651_0000029 3300053093 Bacteria 113528
332 Ga0500566_0055952 3300053094 Bacteria 2245
333 Ga0500571_001234 3300053110 Bacteria 11738
334 Ga0500572_130890 3300053111 Bacteria 815
335 Ga0500592_027967 3300053116 Bacteria 909
336 Ga0500593_022053 3300053117 Bacteria 2810
337 Ga0500607_004123 3300053121 Bacteria 10147
338 Ga0500607_270342 3300053121 Bacteria 657
339 Ga0500608_051670 3300053122 Bacteria 1974
340 Ga0500608_107851 3300053122 Bacteria 1280
341 Ga0500626_226966 3300053128 Bacteria 714
342 Ga0500655_000253 3300053133 Bacteria 12573
343 Ga0500658_0000243 3300053134 Bacteria 25613
344 Ga0500658_0000358 3300053134 Bacteria 20187
345 Ga0500559_0006765 3300053136 Bacteria 5145
346 Ga0500559_0070332 3300053136 Bacteria 1574
347 Ga0500564_020611 3300053138 Bacteria 3016
348 Ga0500568_0014882 3300053139 Bacteria 3497
349 Ga0500573_0255209 3300053140 Bacteria 901
350 Ga0500616_0065438 3300053153 Bacteria 1869
351 Ga0500627_0001256 3300053158 Bacteria 7015
352 Ga0500634_0018405 3300053161 Bacteria 3751
353 Ga0500638_022850 3300053162 Bacteria 2967
354 Ga0500636_0105889 3300053177 Bacteria 1594

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028379 Ga0268266_10013638 Ga0268266_100136383 160
2 3300025986 Ga0207658_10083045 Ga0207658_100830452 168
3 3300005841 Ga0068863_100983334 Ga0068863_1009833341 169
4 3300006177 Ga0075362_10001536 Ga0075362_100015363 169
5 3300006195 Ga0075366_10010971 Ga0075366_100109713 169
6 3300014969 Ga0157376_10742295 Ga0157376_107422952 169
7 3300042134 Ga0450898_006727 Ga0450898_006727_26_538 169
8 3300042144 Ga0450889_006506 Ga0450889_006506_366_878 169
9 3300042146 Ga0450907_023367 Ga0450907_023367_264_776 169
10 3300050496 nmdc:mga07m45_28493_c1 nmdc:mga07m45_28493_c1_220_732 169
11 3300003316 rootH1_10006805 rootH1_100068054 172
12 3300005367 Ga0070667_100085849 Ga0070667_1000858493 172
13 3300032005 Ga0307411_10121137 Ga0307411_101211372 172
14 3300048926 Ga0496123_0000261 Ga0496123_0000261_29489_30019 172
15 3300053136 Ga0500559_0006765 Ga0500559_0006765_1025_1555 172
16 iso_pu_bacteria 2842733646 2842735980 176
17 3300005334 Ga0068869_100020707 Ga0068869_1000207073 178
18 3300005616 Ga0068852_100331327 Ga0068852_1003313272 178
19 3300026142 Ga0207698_10671579 Ga0207698_106715792 178
20 3300032004 Ga0307414_10149296 Ga0307414_101492962 178
21 3300042876 Ga0451577_0104369 Ga0451577_0104369_738_1274 178
22 iso_pu_bacteria 2547132374 2548500124 178
23 iso_pu_bacteria 2643221570 2643864836 178
24 iso_pu_bacteria 2643221652 2644293928 178
25 iso_pu_bacteria 2643221717 2644644556 178
26 iso_pu_bacteria 2738543012 2739241429 178
27 3300005367 Ga0070667_100252780 Ga0070667_1002527803 179
28 3300005843 Ga0068860_100907705 Ga0068860_1009077052 179
29 3300013306 Ga0163162_10024877 Ga0163162_100248774 179
30 3300017792 Ga0163161_10092071 Ga0163161_100920712 179
31 3300028379 Ga0268266_10648663 Ga0268266_106486633 179
32 3300028381 Ga0268264_10493490 Ga0268264_104934902 179
33 3300031731 Ga0307405_10045486 Ga0307405_100454863 179
34 3300031911 Ga0307412_10046967 Ga0307412_100469674 179
35 3300032002 Ga0307416_100081998 Ga0307416_1000819983 179
36 3300032004 Ga0307414_10249816 Ga0307414_102498163 179
37 3300032005 Ga0307411_10251357 Ga0307411_102513571 179
38 3300041404 Ga0439436_0029802 Ga0439436_0029802_685_1230 179
39 3300041406 Ga0439439_0011043 Ga0439439_0011043_687_1232 179
40 3300041407 Ga0439447_026594 Ga0439447_026594_82_627 179
41 3300041410 Ga0439461_0013940 Ga0439461_0013940_797_1342 179
42 3300041411 Ga0439466_0021845 Ga0439466_0021845_578_1123 179
43 3300042002 Ga0439442_010780 Ga0439442_010780_1096_1641 179
44 3300042004 Ga0439445_0066995 Ga0439445_0066995_283_828 179
45 3300042006 Ga0439432_034809 Ga0439432_034809_593_1138 179
46 3300042007 Ga0439449_0009675 Ga0439449_0009675_2591_3136 179
47 3300042015 Ga0439462_0007278 Ga0439462_0007278_466_1011 179
48 3300042128 Ga0450897_003278 Ga0450897_003278_438_983 179
49 3300042145 Ga0450906_003902 Ga0450906_003902_860_1405 179
50 3300042147 Ga0450910_020797 Ga0450910_020797_28_573 179
51 3300042184 Ga0450908_008568 Ga0450908_008568_866_1411 179
52 3300042876 Ga0451577_0003831 Ga0451577_0003831_12786_13343 179
53 3300046459 Ga0495629_0132534 Ga0495629_0132534_341_883 179
54 3300046475 Ga0495639_0045101 Ga0495639_0045101_480_1022 179
55 3300046477 Ga0495664_0119847 Ga0495664_0119847_363_905 179
56 3300046557 Ga0495622_0143950 Ga0495622_0143950_342_884 179
57 3300046674 Ga0495588_0017568 Ga0495588_0017568_2312_2854 179
58 3300046675 Ga0495657_0057838 Ga0495657_0057838_493_1035 179
59 3300047315 Ga0495581_0087068 Ga0495581_0087068_499_1041 179
60 3300048904 Ga0496101_0001014 Ga0496101_0001014_13232_13774 179
61 3300048905 Ga0496102_0476316 Ga0496102_0476316_66_608 179
62 3300048907 Ga0496104_0140458 Ga0496104_0140458_225_767 179
63 3300048908 Ga0496105_0020999 Ga0496105_0020999_2812_3354 179
64 3300048909 Ga0496106_0060061 Ga0496106_0060061_1685_2227 179
65 3300048910 Ga0496107_0132292 Ga0496107_0132292_66_608 179
66 3300048911 Ga0496108_0172751 Ga0496108_0172751_1049_1591 179
67 3300048913 Ga0496110_0152690 Ga0496110_0152690_512_1054 179
68 3300048914 Ga0496111_0196524 Ga0496111_0196524_252_794 179
69 3300048917 Ga0496114_0059887 Ga0496114_0059887_203_745 179
70 iso_pu_bacteria 2513020051 2513230263 179
71 iso_pu_bacteria 2599185214 2599624004 179
72 iso_pu_bacteria 2599185226 2599672015 179
73 iso_pu_bacteria 2599185227 2599681903 179
74 iso_pu_bacteria 2599185229 2599693916 179
75 iso_pu_bacteria 2643221683 2644469205 179
76 iso_pu_bacteria 2919704043 2919705199 179
77 3300045051 Ga0451576_0321355 Ga0451576_0321355_56_601 180
78 3300046453 Ga0495627_117680 Ga0495627_117680_177_728 180
79 3300005338 Ga0068868_100325409 Ga0068868_1003254092 181
80 3300006038 Ga0075365_10038179 Ga0075365_100381795 181
81 3300006353 Ga0075370_10274532 Ga0075370_102745322 181
82 3300026023 Ga0207677_10111890 Ga0207677_101118902 181
83 3300026089 Ga0207648_10463095 Ga0207648_104630952 181
84 3300050490 nmdc:mga03n38_163967_c1 nmdc:mga03n38_163967_c1_58_609 181
85 3300050492 nmdc:mga0yw44_230705_c1 nmdc:mga0yw44_230705_c1_577_1128 181
86 3300050493 nmdc:mga0k408_136321_c1 nmdc:mga0k408_136321_c1_798_1349 181
87 3300050494 nmdc:mga06z11_39292_c1 nmdc:mga06z11_39292_c1_206_763 181
88 iso_pu_bacteria 2990710928 2990711720 181
89 3300005456 Ga0070678_100610945 Ga0070678_1006109452 182
90 3300009176 Ga0105242_10562537 Ga0105242_105625373 182
91 3300014497 Ga0182008_10011535 Ga0182008_100115353 182
92 3300015261 Ga0182006_1042687 Ga0182006_10426873 182
93 3300015262 Ga0182007_10000601 Ga0182007_1000060110 182
94 3300015265 Ga0182005_1014672 Ga0182005_10146721 182
95 3300026121 Ga0207683_10176934 Ga0207683_101769342 182
96 3300028794 Ga0307515_10000110 Ga0307515_1000011067 182
97 3300031548 Ga0307408_100245714 Ga0307408_1002457142 182
98 3300044683 Ga0466965_0152194 Ga0466965_0152194_372_929 182
99 3300046528 Ga0495642_0215278 Ga0495642_0215278_69_620 182
100 3300048913 Ga0496110_0101400 Ga0496110_0101400_463_1014 182
101 3300048914 Ga0496111_0331413 Ga0496111_0331413_285_836 182
102 3300049580 Ga0501046_0205699 Ga0501046_0205699_492_1052 182
103 3300049589 Ga0501073_0052079 Ga0501073_0052079_2077_2637 182
104 3300005364 Ga0070673_100652098 Ga0070673_1006520983 183
105 3300005543 Ga0070672_100185747 Ga0070672_1001857473 183
106 3300017792 Ga0163161_10035549 Ga0163161_100355494 183
107 3300025934 Ga0207686_10490696 Ga0207686_104906962 183
108 3300025937 Ga0207669_11099157 Ga0207669_110991572 183
109 3300025940 Ga0207691_10179608 Ga0207691_101796083 183
110 3300025972 Ga0207668_10232282 Ga0207668_102322822 183
111 3300031731 Ga0307405_10001308 Ga0307405_100013089 183
112 3300046460 Ga0495638_0137192 Ga0495638_0137192_440_991 183
113 3300046462 Ga0495651_0139228 Ga0495651_0139228_930_1484 183
114 3300046513 Ga0495616_0002637 Ga0495616_0002637_2870_3421 183
115 3300046513 Ga0495616_0285794 Ga0495616_0285794_97_651 183
116 3300046518 Ga0495631_0002010 Ga0495631_0002010_9100_9651 183
117 3300046520 Ga0495637_0097271 Ga0495637_0097271_480_1031 183
118 3300046528 Ga0495642_0170568 Ga0495642_0170568_129_683 183
119 3300046530 Ga0495654_0022343 Ga0495654_0022343_2122_2673 183
120 3300046615 Ga0495656_0000202 Ga0495656_0000202_2702_3256 183
121 3300046660 Ga0495625_0119424 Ga0495625_0119424_990_1541 183
122 3300046674 Ga0495588_0029275 Ga0495588_0029275_2196_2747 183
123 3300046674 Ga0495588_0397442 Ga0495588_0397442_94_645 183
124 3300046683 Ga0495658_0011936 Ga0495658_0011936_754_1305 183
125 3300047321 Ga0495676_0041433 Ga0495676_0041433_73_624 183
126 3300047445 Ga0495677_0252076 Ga0495677_0252076_110_661 183
127 3300047673 Ga0495593_0034289 Ga0495593_0034289_74_625 183
128 3300048088 Ga0495602_0706371 Ga0495602_0706371_16_567 183
129 3300048089 Ga0495614_0019254 Ga0495614_0019254_56_607 183
130 3300048090 Ga0495615_0029041 Ga0495615_0029041_306_860 183
131 3300048913 Ga0496110_0374943 Ga0496110_0374943_621_1175 183
132 3300048917 Ga0496114_0478729 Ga0496114_0478729_284_838 183
133 3300048920 Ga0496117_0040746 Ga0496117_0040746_1747_2298 183
134 3300048921 Ga0496118_0026715 Ga0496118_0026715_2642_3193 183
135 3300048924 Ga0496121_0039089 Ga0496121_0039089_2304_2855 183
136 3300048928 Ga0496125_0115002 Ga0496125_0115002_1002_1553 183
137 3300053087 Ga0500643_011857 Ga0500643_011857_1618_2169 183
138 3300053093 Ga0500651_0000029 Ga0500651_0000029_72162_72713 183
139 3300053094 Ga0500566_0055952 Ga0500566_0055952_1313_1864 183
140 3300053110 Ga0500571_001234 Ga0500571_001234_2236_2787 183
141 3300053116 Ga0500592_027967 Ga0500592_027967_70_621 183
142 3300053122 Ga0500608_051670 Ga0500608_051670_788_1339 183
143 3300053133 Ga0500655_000253 Ga0500655_000253_3055_3606 183
144 3300053134 Ga0500658_0000243 Ga0500658_0000243_24220_24771 183
145 3300053134 Ga0500658_0000358 Ga0500658_0000358_18794_19345 183
146 3300053138 Ga0500564_020611 Ga0500564_020611_748_1299 183
147 3300053139 Ga0500568_0014882 Ga0500568_0014882_152_703 183
148 3300053140 Ga0500573_0255209 Ga0500573_0255209_300_851 183
149 3300053153 Ga0500616_0065438 Ga0500616_0065438_506_1057 183
150 3300053162 Ga0500638_022850 Ga0500638_022850_1817_2368 183
151 3300053177 Ga0500636_0105889 Ga0500636_0105889_551_1102 183
152 3300005327 Ga0070658_10096585 Ga0070658_100965853 184
153 3300005338 Ga0068868_100694687 Ga0068868_1006946871 184
154 3300005548 Ga0070665_100326143 Ga0070665_1003261432 184
155 3300025927 Ga0207687_10088804 Ga0207687_100888042 184
156 3300026023 Ga0207677_10085588 Ga0207677_100855881 184
157 3300026078 Ga0207702_10469942 Ga0207702_104699423 184
158 3300046522 Ga0495643_0070781 Ga0495643_0070781_364_942 184
159 3300006048 Ga0075363_100372844 Ga0075363_1003728442 185
160 3300006177 Ga0075362_10048826 Ga0075362_100488263 185
161 3300006195 Ga0075366_10047092 Ga0075366_100470923 185
162 3300006353 Ga0075370_10008542 Ga0075370_100085424 185
163 3300031731 Ga0307405_10333016 Ga0307405_103330162 185
164 3300031911 Ga0307412_10081245 Ga0307412_100812453 185
165 3300041451 Ga0451791_0130579 Ga0451791_0130579_85_663 185
166 3300044712 Ga0453684_0581691 Ga0453684_0581691_377_967 185
167 3300050490 nmdc:mga03n38_330712_c1 nmdc:mga03n38_330712_c1_96_665 185
168 3300050493 nmdc:mga0k408_84168_c1 nmdc:mga0k408_84168_c1_443_1012 185
169 3300050496 nmdc:mga07m45_34770_c1 nmdc:mga07m45_34770_c1_969_1538 185
170 iso_pu_bacteria 2643221628 2644162816 185
171 iso_pu_bacteria 2643221658 2644328765 185
172 iso_pu_bacteria 2643221672 2644398091 185
173 iso_pu_bacteria 2738541307 2738881489 185
174 iso_pu_bacteria 2818991446 2819596456 185
175 iso_pu_bacteria 2831265667 2831270213 185
176 iso_pu_bacteria 2838054893 2838059982 185
177 iso_pu_bacteria 2842677519 2842682386 185
178 iso_pu_bacteria 2885198086 2885199590 185
179 iso_pu_bacteria 2885211737 2885213137 185
180 iso_pu_bacteria 2899924645 2899931169 185
181 iso_pu_bacteria 2904449895 2904454828 185
182 iso_pu_bacteria 2904456579 2904462599 185
183 iso_pu_bacteria 2904541872 2904546810 185
184 iso_pu_bacteria 2928037797 2928038054 185
185 iso_pu_bacteria 2928044640 2928046340 185
186 iso_pu_bacteria 2928051484 2928054032 185
187 iso_pu_bacteria 2928070936 2928077892 185
188 iso_pu_bacteria 2928084124 2928088674 185
189 iso_pu_bacteria 2929160207 2929164283 185
190 iso_pu_bacteria 2929520902 2929523863 185
191 iso_pu_bacteria 2945909444 2945913045 185
192 iso_pu_bacteria 2945984333 2945984671 185
193 3300025923 Ga0207681_10082163 Ga0207681_100821633 186
194 3300048927 Ga0496124_0084452 Ga0496124_0084452_286_870 186
195 3300048929 Ga0496126_0269192 Ga0496126_0269192_280_864 186
196 3300050493 nmdc:mga0k408_46207_c1 nmdc:mga0k408_46207_c1_1600_2166 186
197 iso_pu_bacteria 2945972063 2945976569 187
198 3300053122 Ga0500608_107851 Ga0500608_107851_526_1092 188
199 iso_pu_bacteria 2738541277 2738719988 188
200 iso_pu_bacteria 2738543019 2739279187 188
201 3300001989 JGI24739J22299_10037077 JGI24739J22299_100370771 189
202 3300002773 JGI25152J39213_1008871 JGI25152J39213_10088715 189
203 3300002774 JGI25150J39212_1005975 JGI25150J39212_10059753 189
204 3300002987 JGI25159J45721_1012833 JGI25159J45721_10128333 189
205 3300003187 JGI25151J46595_10001314 JGI25151J46595_100013141 189
206 3300003187 JGI25151J46595_10007994 JGI25151J46595_100079944 189
207 3300003187 JGI25151J46595_10019471 JGI25151J46595_100194712 189
208 3300003215 JGI25153J46596_10037898 JGI25153J46596_100378983 189
209 3300003320 rootH2_10044759 rootH2_100447592 189
210 3300003354 JGI25160J50197_1028397 JGI25160J50197_10283973 189
211 3300003761 Ga0055535_1002162 Ga0055535_10021628 189
212 3300003762 Ga0055542_1000087 Ga0055542_1000087100 189
213 3300003781 Ga0055536_1003127 Ga0055536_10031272 189
214 3300003781 Ga0055536_1010072 Ga0055536_10100721 189
215 3300003781 Ga0055536_1043225 Ga0055536_10432253 189
216 3300003791 Ga0055530_10000492 Ga0055530_1000049231 189
217 3300003792 Ga0055540_1003253 Ga0055540_10032531 189
218 3300003792 Ga0055540_1007552 Ga0055540_10075521 189
219 3300003792 Ga0055540_1013970 Ga0055540_10139703 189
220 3300003794 Ga0055531_10001855 Ga0055531_1000185513 189
221 3300003794 Ga0055531_10037310 Ga0055531_100373101 189
222 3300003794 Ga0055531_10072334 Ga0055531_100723341 189
223 3300005457 Ga0070662_100015528 Ga0070662_1000155285 189
224 3300005459 Ga0068867_100584520 Ga0068867_1005845202 189
225 3300005539 Ga0068853_100005208 Ga0068853_1000052087 189
226 3300005563 Ga0068855_100297279 Ga0068855_1002972793 189
227 3300005577 Ga0068857_101172972 Ga0068857_1011729721 189
228 3300005578 Ga0068854_100208943 Ga0068854_1002089432 189
229 3300005578 Ga0068854_100611008 Ga0068854_1006110083 189
230 3300005616 Ga0068852_100138477 Ga0068852_1001384771 189
231 3300005616 Ga0068852_100433322 Ga0068852_1004333222 189
232 3300005834 Ga0068851_10061028 Ga0068851_100610282 189
233 3300005844 Ga0068862_100070359 Ga0068862_1000703593 189
234 3300006048 Ga0075363_100034165 Ga0075363_1000341653 189
235 3300006048 Ga0075363_100121305 Ga0075363_1001213052 189
236 3300006051 Ga0075364_10229246 Ga0075364_102292462 189
237 3300006058 Ga0075432_10093771 Ga0075432_100937712 189
238 3300006177 Ga0075362_10029707 Ga0075362_100297072 189
239 3300006177 Ga0075362_10184216 Ga0075362_101842163 189
240 3300006178 Ga0075367_10363776 Ga0075367_103637762 189
241 3300006195 Ga0075366_10257249 Ga0075366_102572491 189
242 3300006195 Ga0075366_10266250 Ga0075366_102662501 189
243 3300006195 Ga0075366_10471815 Ga0075366_104718151 189
244 3300006237 Ga0097621_100552643 Ga0097621_1005526431 189
245 3300006353 Ga0075370_10046427 Ga0075370_100464274 189
246 3300006353 Ga0075370_10176867 Ga0075370_101768672 189
247 3300006358 Ga0068871_100053786 Ga0068871_1000537864 189
248 3300006948 Ga0099826_10163178 Ga0099826_101631783 189
249 3300006948 Ga0099826_10348996 Ga0099826_103489961 189
250 3300009036 Ga0105244_10004693 Ga0105244_100046937 189
251 3300009098 Ga0105245_10749167 Ga0105245_107491671 189
252 3300009148 Ga0105243_10009710 Ga0105243_100097107 189
253 3300009148 Ga0105243_10020150 Ga0105243_100201505 189
254 3300009545 Ga0105237_10257893 Ga0105237_102578932 189
255 3300009551 Ga0105238_10915651 Ga0105238_109156511 189
256 3300010375 Ga0105239_10383288 Ga0105239_103832882 189
257 3300011119 Ga0105246_10088977 Ga0105246_100889772 189
258 3300011119 Ga0105246_10285122 Ga0105246_102851222 189
259 3300012502 Ga0157347_1019401 Ga0157347_10194011 189
260 3300013100 Ga0157373_10027789 Ga0157373_100277892 189
261 3300013100 Ga0157373_10257096 Ga0157373_102570962 189
262 3300013100 Ga0157373_10326485 Ga0157373_103264852 189
263 3300013104 Ga0157370_10037489 Ga0157370_100374894 189
264 3300013104 Ga0157370_10436312 Ga0157370_104363122 189
265 3300013104 Ga0157370_11130318 Ga0157370_111303181 189
266 3300013104 Ga0157370_11134255 Ga0157370_111342551 189
267 3300013105 Ga0157369_10013458 Ga0157369_100134585 189
268 3300014497 Ga0182008_10021365 Ga0182008_100213652 189
269 3300015261 Ga0182006_1002216 Ga0182006_10022163 189
270 3300015261 Ga0182006_1097797 Ga0182006_10977972 189
271 3300015261 Ga0182006_1104774 Ga0182006_11047742 189
272 3300015262 Ga0182007_10000825 Ga0182007_1000082518 189
273 3300017792 Ga0163161_10011479 Ga0163161_100114794 189
274 3300017792 Ga0163161_10046138 Ga0163161_100461381 189
275 3300017792 Ga0163161_10164250 Ga0163161_101642503 189
276 3300025208 Ga0209436_107649 Ga0209436_1076492 189
277 3300025228 Ga0209672_101515 Ga0209672_1015158 189
278 3300025242 Ga0209258_100199 Ga0209258_1001998 189
279 3300025245 Ga0207425_1004716 Ga0207425_10047165 189
280 3300025254 Ga0209148_1000179 Ga0209148_10001798 189
281 3300025258 Ga0209129_1000071 Ga0209129_1000071125 189
282 3300025258 Ga0209129_1001902 Ga0209129_10019026 189
283 3300025263 Ga0209565_1002195 Ga0209565_10021953 189
284 3300025273 Ga0209673_1001906 Ga0209673_10019064 189
285 3300025273 Ga0209673_1020278 Ga0209673_10202782 189
286 3300025284 Ga0209130_1000773 Ga0209130_100077325 189
287 3300025284 Ga0209130_1036330 Ga0209130_10363302 189
288 3300025291 Ga0209675_1006924 Ga0209675_10069245 189
289 3300025292 Ga0209676_1000005 Ga0209676_100000558 189
290 3300025292 Ga0209676_1001007 Ga0209676_10010073 189
291 3300025292 Ga0209676_1003004 Ga0209676_10030043 189
292 3300025294 Ga0209025_1000544 Ga0209025_100054412 189
293 3300025294 Ga0209025_1004201 Ga0209025_10042014 189
294 3300025295 Ga0209564_1000239 Ga0209564_100023948 189
295 3300025297 Ga0209758_1000027 Ga0209758_1000027384 189
296 3300025297 Ga0209758_1003037 Ga0209758_10030375 189
297 3300025298 Ga0209050_1000007 Ga0209050_10000071040 189
298 3300025298 Ga0209050_1001089 Ga0209050_10010893 189
299 3300025298 Ga0209050_1044987 Ga0209050_10449873 189
300 3300025299 Ga0209256_1000081 Ga0209256_1000081125 189
301 3300025302 Ga0207426_1000027 Ga0207426_1000027349 189
302 3300025302 Ga0207426_1000614 Ga0207426_100061451 189
303 3300025303 Ga0209051_1000009 Ga0209051_100000958 189
304 3300025303 Ga0209051_1000347 Ga0209051_100034759 189
305 3300025303 Ga0209051_1000373 Ga0209051_100037338 189
306 3300025303 Ga0209051_1000553 Ga0209051_100055337 189
307 3300025303 Ga0209051_1002578 Ga0209051_10025783 189
308 3300025304 Ga0209257_1000011 Ga0209257_100001132 189
309 3300025304 Ga0209257_1000449 Ga0209257_100044956 189
310 3300025304 Ga0209257_1007816 Ga0209257_10078162 189
311 3300025728 Ga0207655_1001731 Ga0207655_100173115 189
312 3300025924 Ga0207694_10112687 Ga0207694_101126871 189
313 3300025927 Ga0207687_10652041 Ga0207687_106520412 189
314 3300025933 Ga0207706_10006469 Ga0207706_1000646913 189
315 3300025933 Ga0207706_10025344 Ga0207706_100253446 189
316 3300025935 Ga0207709_10001584 Ga0207709_1000158413 189
317 3300025935 Ga0207709_10010549 Ga0207709_100105493 189
318 3300025935 Ga0207709_10048245 Ga0207709_100482452 189
319 3300025949 Ga0207667_10212548 Ga0207667_102125483 189
320 3300025981 Ga0207640_10543384 Ga0207640_105433842 189
321 3300025981 Ga0207640_10617161 Ga0207640_106171612 189
322 3300026089 Ga0207648_10075188 Ga0207648_100751883 189
323 3300026116 Ga0207674_10364952 Ga0207674_103649522 189
324 3300026142 Ga0207698_10095965 Ga0207698_100959653 189
325 3300026142 Ga0207698_10103117 Ga0207698_101031172 189
326 3300028794 Ga0307515_10355143 Ga0307515_103551432 189
327 3300030731 Ga0316177_1127556 Ga0316177_11275562 189
328 3300030732 Ga0316176_1066153 Ga0316176_10661539 189
329 3300030735 Ga0316178_1094039 Ga0316178_10940394 189
330 3300030742 Ga0316183_1057193 Ga0316183_10571931 189
331 3300030744 Ga0316181_1035278 Ga0316181_10352785 189
332 3300030745 Ga0316182_1266332 Ga0316182_12663322 189
333 3300031548 Ga0307408_100142697 Ga0307408_1001426973 189
334 3300031548 Ga0307408_100614523 Ga0307408_1006145231 189
335 3300031548 Ga0307408_100875682 Ga0307408_1008756821 189
336 3300031649 Ga0307514_10085169 Ga0307514_100851692 189
337 3300031649 Ga0307514_10088797 Ga0307514_100887973 189
338 3300031731 Ga0307405_10057533 Ga0307405_100575334 189
339 3300031731 Ga0307405_10388662 Ga0307405_103886622 189
340 3300031731 Ga0307405_10470981 Ga0307405_104709813 189
341 3300031901 Ga0307406_10000749 Ga0307406_100007497 189
342 3300031903 Ga0307407_10183238 Ga0307407_101832382 189
343 3300031911 Ga0307412_10035707 Ga0307412_100357073 189
344 3300031911 Ga0307412_10748151 Ga0307412_107481511 189
345 3300031911 Ga0307412_10992161 Ga0307412_109921612 189
346 3300032004 Ga0307414_10298732 Ga0307414_102987323 189
347 3300032005 Ga0307411_10104682 Ga0307411_101046822 189
348 3300041413 Ga0439465_0060292 Ga0439465_0060292_404_979 189
349 3300041460 Ga0451802_2037073 Ga0451802_2037073_82_651 189
350 3300042002 Ga0439442_000506 Ga0439442_000506_1783_2358 189
351 3300042122 Ga0450920_021113 Ga0450920_021113_12_587 189
352 3300042134 Ga0450898_004980 Ga0450898_004980_531_1106 189
353 3300042145 Ga0450906_001292 Ga0450906_001292_2184_2759 189
354 3300042145 Ga0450906_013541 Ga0450906_013541_75_644 189
355 3300042146 Ga0450907_009867 Ga0450907_009867_108_683 189
356 3300042147 Ga0450910_010794 Ga0450910_010794_533_1108 189
357 3300042184 Ga0450908_012096 Ga0450908_012096_376_951 189
358 3300042435 Ga0439434_0009598 Ga0439434_0009598_696_1271 189
359 3300042531 Ga0450918_000592 Ga0450918_000592_4327_4902 189
360 3300046507 Ga0495606_0108377 Ga0495606_0108377_367_945 189
361 3300046515 Ga0495620_0024367 Ga0495620_0024367_287_856 189
362 3300046530 Ga0495654_0165699 Ga0495654_0165699_67_636 189
363 3300046616 Ga0495668_0105529 Ga0495668_0105529_458_1027 189
364 3300046660 Ga0495625_0144819 Ga0495625_0144819_932_1501 189
365 3300048904 Ga0496101_0044216 Ga0496101_0044216_2236_2814 189
366 3300048920 Ga0496117_0043935 Ga0496117_0043935_1289_1858 189
367 3300048920 Ga0496117_0186879 Ga0496117_0186879_150_719 189
368 3300048921 Ga0496118_0015239 Ga0496118_0015239_5768_6337 189
369 3300048925 Ga0496122_0445520 Ga0496122_0445520_35_604 189
370 3300048926 Ga0496123_0018667 Ga0496123_0018667_162_758 189
371 3300048926 Ga0496123_0245115 Ga0496123_0245115_37_606 189
372 3300048927 Ga0496124_0352344 Ga0496124_0352344_132_701 189
373 3300048928 Ga0496125_0085355 Ga0496125_0085355_1602_2213 189
374 3300049679 Ga0501249_016872 Ga0501249_016872_241_810 189
375 3300050489 nmdc:mga03683_182873_c1 nmdc:mga03683_182873_c1_287_862 189
376 3300050489 nmdc:mga03683_19859_c1 nmdc:mga03683_19859_c1_330_899 189
377 3300050490 nmdc:mga03n38_234848_c1 nmdc:mga03n38_234848_c1_95_664 189
378 3300050490 nmdc:mga03n38_8334_c1 nmdc:mga03n38_8334_c1_470_1045 189
379 3300050491 nmdc:mga00v17_188764_c1 nmdc:mga00v17_188764_c1_308_877 189
380 3300050492 nmdc:mga0yw44_371606_c1 nmdc:mga0yw44_371606_c1_44_613 189
381 3300050493 nmdc:mga0k408_342079_c1 nmdc:mga0k408_342079_c1_43_621 189
382 3300050496 nmdc:mga07m45_1912_c1 nmdc:mga07m45_1912_c1_930_1499 189
383 3300050496 nmdc:mga07m45_255924_c1 nmdc:mga07m45_255924_c1_128_703 189
384 3300050516 nmdc:mga0sz30_75035_c1 nmdc:mga0sz30_75035_c1_414_983 189
385 3300053079 Ga0500610_0046780 Ga0500610_0046780_1581_2150 189
386 3300053079 Ga0500610_0054170 Ga0500610_0054170_156_731 189
387 3300053111 Ga0500572_130890 Ga0500572_130890_121_690 189
388 3300053117 Ga0500593_022053 Ga0500593_022053_595_1164 189
389 3300053121 Ga0500607_004123 Ga0500607_004123_2982_3551 189
390 3300053121 Ga0500607_270342 Ga0500607_270342_17_586 189
391 3300053128 Ga0500626_226966 Ga0500626_226966_38_607 189
392 3300053136 Ga0500559_0070332 Ga0500559_0070332_347_916 189
393 3300053158 Ga0500627_0001256 Ga0500627_0001256_1779_2348 189
394 3300053161 Ga0500634_0018405 Ga0500634_0018405_1677_2246 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08242

Methyltransf_12

Methyltransferase domain

35

122

0.89

PF07021

MetW

Methionine biosynthesis protein MetW

19

116

0.86

PF05724

TPMT

Thiopurine S-methyltransferase (TPMT)

9

80

0.82

PF13489

Methyltransf_23

Methyltransferase domain

10

175

0.82

PF08241

Methyltransf_11

Methyltransferase domain

35

124

0.81

PF13649

Methyltransf_25

Methyltransferase domain

34

120

0.81

PF03848

TehB

Tellurite resistance protein TehB

18

165

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mer-assembly2.cif.gz_B crystal structure of the methyltransferase slr1183 from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr145 0.8152 13 175
2xva-assembly3.cif.gz_C crystal structure of the tellurite detoxification protein tehb from e. coli in complex with sinefungin 0.8141 10 172
4j91-assembly1.cif.gz_C-2 diamond-shaped octameric structure of ktra with adp bound 0.8141 30 93
6isv-assembly1.cif.gz_B structure of acetophenone reductase from geotrichum candidum nbrc 4597 in complex with nad 0.8052 24 114
4dq0-assembly4.cif.gz_D the crystal structure of tellurite resistance protein from escherichia coli o157:h7 str. sakai 0.8048 10 172
ID Description Score Start End Superfamily
af_A0A1D6FP61_65_209_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9123 29 66 3.40.50.150
af_Q4D7A8_87_267_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8875 11 172 3.40.50.150
af_Q54Y84_189_377_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8832 26 161 3.40.50.150
af_L7N687_2_189_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8665 12 144 3.40.50.150
af_Q93574_127_280_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8582 29 66 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A259RHZ3-F1-model_v4 SAM-dependent methyltransferase 0.9836 11 112 GO:0008168
GO:0032259
AF-A0A2J7VLD2-F1-model_v4 Malonyl-[acyl-carrier protein] O-methyltransferase (EC 2.1.1.197) 0.9712 11 186 GO:0032259
GO:0102130
AF-A0A519I1D4-F1-model_v4 deleted 0.9656 7 96
AF-A0A4P6UMF0-F1-model_v4 Class I SAM-dependent methyltransferase 0.9612 10 172 GO:0008168
GO:0032259
AF-F3KNS0-F1-model_v4 Type 12 methyltransferase 0.9608 25 172 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
87.77 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map