F432960

General Info

Members Datasets Scaffolds Average Seq Length
394 148 788 196

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0315873|Ga0395900_0315873_699_1349
Length 216
Sequence MHPSFIASVSRSTSGESPMKALALVPLTILIAAPAPAAPRTETAVLAGGCFWGMELVFEHVKGVTSAVSGYAGGSAHDANYESVSSEATGHAEAVKITYDPAQVSYAQLLQIYFTVAHDPTEVDRQGPDVGHSYRSAIFPQSPDQARFAKAFIARLNSAHIYKAPIATKVESGGFFPAEAFHQGFGRKHPSYPYIVINDRPKVVALQHKFPTLYKA

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 2.79
Rhizosphere 95.43
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0315873 3300037418 Bacteria 1544
2 JGI24740J21852_10001128 3300001979 Bacteria 12095
3 JGI24743J22301_10030089 3300001991 Bacteria 1067
4 JGI24735J21928_10027356 3300002067 Bacteria 1709
5 JGI24735J21928_10054290 3300002067 Bacteria 1154
6 Ga0070658_10053035 3300005327 Bacteria 3290
7 Ga0070658_10327879 3300005327 Bacteria 1308
8 Ga0070658_10408030 3300005327 Bacteria 1167
9 Ga0070676_10054898 3300005328 Bacteria 2350
10 Ga0070676_10681652 3300005328 Bacteria 749
11 Ga0070683_100001218 3300005329 Bacteria 19546
12 Ga0070683_100988640 3300005329 Bacteria 808
13 Ga0070666_10084935 3300005335 Bacteria 2167
14 Ga0070680_100000600 3300005336 Bacteria 24915
15 Ga0070680_100004470 3300005336 Bacteria 10532
16 Ga0070680_100004642 3300005336 Bacteria 10330
17 Ga0070680_100008845 3300005336 Bacteria 7720
18 Ga0070680_100010643 3300005336 Bacteria 7095
19 Ga0070680_100075460 3300005336 Bacteria 2775
20 Ga0068868_100007620 3300005338 Bacteria 7720
21 Ga0068868_100118673 3300005338 Bacteria 2156
22 Ga0070660_100019096 3300005339 Bacteria 5017
23 Ga0070660_100048163 3300005339 Bacteria 3272
24 Ga0070689_100450530 3300005340 Bacteria 1095
25 Ga0070691_10005745 3300005341 Bacteria 5657
26 Ga0070661_100004224 3300005344 Bacteria 9907
27 Ga0070661_100018362 3300005344 Bacteria 4973
28 Ga0070661_100104921 3300005344 Bacteria 2106
29 Ga0070661_100236607 3300005344 Bacteria 1405
30 Ga0070692_10023266 3300005345 Bacteria 3034
31 Ga0070669_100084313 3300005353 Bacteria 2371
32 Ga0070675_100241995 3300005354 Bacteria 1577
33 Ga0070671_100001537 3300005355 Bacteria 17332
34 Ga0070671_100012222 3300005355 Bacteria 6908
35 Ga0070671_100644126 3300005355 Bacteria 917
36 Ga0070674_100037016 3300005356 Bacteria 3280
37 Ga0070673_100154480 3300005364 Bacteria 1946
38 Ga0070673_100347951 3300005364 Bacteria 1315
39 Ga0070659_100009776 3300005366 Bacteria 7050
40 Ga0070659_100100186 3300005366 Bacteria 2331
41 Ga0070667_100064335 3300005367 Bacteria 3112
42 Ga0070709_10501909 3300005434 Bacteria 922
43 Ga0070714_100002762 3300005435 Bacteria 12941
44 Ga0070714_100034448 3300005435 Bacteria 4240
45 Ga0070714_100109792 3300005435 Bacteria 2441
46 Ga0070714_100138351 3300005435 Bacteria 2183
47 Ga0070714_100195610 3300005435 Bacteria 1847
48 Ga0070714_101039626 3300005435 Bacteria 797
49 Ga0070713_100014792 3300005436 Bacteria 5807
50 Ga0070713_100330626 3300005436 Bacteria 1409
51 Ga0070713_100633999 3300005436 Bacteria 1017
52 Ga0070663_100019561 3300005455 Bacteria 4466
53 Ga0070663_100145436 3300005455 Bacteria 1813
54 Ga0070663_100268470 3300005455 Bacteria 1356
55 Ga0070678_100041966 3300005456 Bacteria 3248
56 Ga0070678_100240884 3300005456 Bacteria 1512
57 Ga0070662_100086003 3300005457 Bacteria 2351
58 Ga0070662_100171919 3300005457 Bacteria 1702
59 Ga0070681_10112990 3300005458 Bacteria 2656
60 Ga0070681_10237086 3300005458 Bacteria 1738
61 Ga0070679_100046755 3300005530 Bacteria 4314
62 Ga0070679_100049402 3300005530 Bacteria 4189
63 Ga0070679_100059635 3300005530 Bacteria 3803
64 Ga0070679_100082142 3300005530 Bacteria 3212
65 Ga0070684_100003221 3300005535 Bacteria 12209
66 Ga0070684_100360417 3300005535 Bacteria 1338
67 Ga0070684_100471349 3300005535 Unclassified 1161
68 Ga0068853_100015242 3300005539 Bacteria 6318
69 Ga0068853_100019914 3300005539 Bacteria 5572
70 Ga0068853_100272879 3300005539 Bacteria 1558
71 Ga0070665_100035413 3300005548 Bacteria 5019
72 Ga0068855_100024176 3300005563 Bacteria 7273
73 Ga0068855_100113748 3300005563 Bacteria 3104
74 Ga0068855_100145956 3300005563 Bacteria 2693
75 Ga0068855_100278373 3300005563 Bacteria 1859
76 Ga0068855_100389072 3300005563 Bacteria 1530
77 Ga0068855_101481214 3300005563 Bacteria 697
78 Ga0070664_100003525 3300005564 Bacteria 12637
79 Ga0070664_100007149 3300005564 Bacteria 9000
80 Ga0070664_100007605 3300005564 Bacteria 8749
81 Ga0070664_100287592 3300005564 Bacteria 1483
82 Ga0068857_100005521 3300005577 Bacteria 10789
83 Ga0068857_100020750 3300005577 Bacteria 5781
84 Ga0068854_100002199 3300005578 Bacteria 11994
85 Ga0068854_100024114 3300005578 Bacteria 4163
86 Ga0068856_100088542 3300005614 Bacteria 3078
87 Ga0068856_100240055 3300005614 Bacteria 1827
88 Ga0068856_100995255 3300005614 Bacteria 857
89 Ga0068852_100000831 3300005616 Bacteria 20424
90 Ga0068852_100011601 3300005616 Bacteria 6645
91 Ga0068852_100245466 3300005616 Bacteria 1713
92 Ga0068852_101552013 3300005616 Bacteria 684
93 Ga0068864_100315859 3300005618 Bacteria 1466
94 Ga0068851_10109249 3300005834 Bacteria 1475
95 Ga0068851_10268626 3300005834 Bacteria 972
96 Ga0068863_100655696 3300005841 Bacteria 1041
97 Ga0068858_100347273 3300005842 Bacteria 1421
98 Ga0081539_10012130 3300005985 Bacteria 6694
99 Ga0070717_10002352 3300006028 Bacteria 13323
100 Ga0070717_10332725 3300006028 Bacteria 1355
101 Ga0070716_100125153 3300006173 Bacteria 1616
102 Ga0070716_100192038 3300006173 Bacteria 1350
103 Ga0070712_100017962 3300006175 Bacteria 4585
104 Ga0070712_100117901 3300006175 Bacteria 1993
105 Ga0097621_100135296 3300006237 Bacteria 2101
106 Ga0097621_100405137 3300006237 Bacteria 1222
107 Ga0097621_100674376 3300006237 Bacteria 950
108 Ga0068871_100537077 3300006358 Bacteria 1058
109 Ga0105240_10021655 3300009093 Bacteria 8546
110 Ga0105240_10103868 3300009093 Bacteria 3451
111 Ga0105240_10243986 3300009093 Bacteria 2081
112 Ga0105240_10578268 3300009093 Bacteria 1239
113 Ga0105245_10030661 3300009098 Bacteria 4756
114 Ga0105248_11055867 3300009177 Bacteria 918
115 Ga0105237_10595950 3300009545 Bacteria 1112
116 Ga0105238_10024336 3300009551 Bacteria 6172
117 Ga0105238_10044294 3300009551 Bacteria 4499
118 Ga0105238_10498215 3300009551 Bacteria 1219
119 Ga0157373_10028202 3300013100 Bacteria 4051
120 Ga0157373_10028291 3300013100 Bacteria 4043
121 Ga0157373_10033596 3300013100 Bacteria 3689
122 Ga0157373_10038286 3300013100 Bacteria 3438
123 Ga0157373_10122536 3300013100 Bacteria 1827
124 Ga0157373_10188646 3300013100 Bacteria 1453
125 Ga0157373_10245794 3300013100 Bacteria 1265
126 Ga0157371_10013741 3300013102 Bacteria 6139
127 Ga0157371_10148477 3300013102 Bacteria 1671
128 Ga0157371_10409757 3300013102 Bacteria 993
129 Ga0157370_10029253 3300013104 Bacteria 5411
130 Ga0157370_10042552 3300013104 Bacteria 4376
131 Ga0157370_10051440 3300013104 Bacteria 3935
132 Ga0157370_10098495 3300013104 Bacteria 2742
133 Ga0157370_10273010 3300013104 Bacteria 1562
134 Ga0157370_10595903 3300013104 Bacteria 1012
135 Ga0157369_10025684 3300013105 Bacteria 6536
136 Ga0157369_10133336 3300013105 Bacteria 2631
137 Ga0157369_10171673 3300013105 Bacteria 2285
138 Ga0157369_10316821 3300013105 Bacteria 1622
139 Ga0157369_10327820 3300013105 Bacteria 1591
140 Ga0157369_10597857 3300013105 Bacteria 1139
141 Ga0157369_10798838 3300013105 Bacteria 969
142 Ga0157374_10011569 3300013296 Bacteria 7648
143 Ga0157374_10242366 3300013296 Bacteria 1773
144 Ga0157374_10847696 3300013296 Bacteria 931
145 Ga0157378_10174087 3300013297 Bacteria 2021
146 Ga0163162_10147462 3300013306 Bacteria 2470
147 Ga0157372_10314408 3300013307 Bacteria 1823
148 Ga0157375_10012994 3300013308 Bacteria 7396
149 Ga0182008_10067921 3300014497 Bacteria 1754
150 Ga0157376_10396273 3300014969 Bacteria 1334
151 Ga0206353_10764760 3300020082 Bacteria 4021
152 Ga0213876_10014546 3300021384 Bacteria 4170
153 Ga0213875_10018096 3300021388 Bacteria 3399
154 Ga0207697_10013660 3300025315 Bacteria 3384
155 Ga0207656_10005491 3300025321 Bacteria 4484
156 Ga0207656_10148914 3300025321 Bacteria 1107
157 Ga0207656_10317272 3300025321 Bacteria 774
158 Ga0207680_10030568 3300025903 Bacteria 3039
159 Ga0207647_10003634 3300025904 Bacteria 11545
160 Ga0207647_10155611 3300025904 Bacteria 1335
161 Ga0207699_10281310 3300025906 Bacteria 1156
162 Ga0207705_10002048 3300025909 Bacteria 15684
163 Ga0207705_10012947 3300025909 Bacteria 6020
164 Ga0207705_10020277 3300025909 Bacteria 4754
165 Ga0207705_10038560 3300025909 Bacteria 3421
166 Ga0207705_10063728 3300025909 Bacteria 2663
167 Ga0207705_10204523 3300025909 Bacteria 1496
168 Ga0207707_10156437 3300025912 Bacteria 1994
169 Ga0207707_10331103 3300025912 Bacteria 1314
170 Ga0207695_10504593 3300025913 Bacteria 1092
171 Ga0207671_10338110 3300025914 Bacteria 1193
172 Ga0207693_10080281 3300025915 Bacteria 2554
173 Ga0207693_10173839 3300025915 Bacteria 1695
174 Ga0207660_10001449 3300025917 Bacteria 15925
175 Ga0207660_10004293 3300025917 Bacteria 9299
176 Ga0207660_10009882 3300025917 Bacteria 6181
177 Ga0207660_10024393 3300025917 Bacteria 4095
178 Ga0207657_10002987 3300025919 Bacteria 18126
179 Ga0207657_10008881 3300025919 Bacteria 10166
180 Ga0207657_10009008 3300025919 Bacteria 10079
181 Ga0207657_10020224 3300025919 Bacteria 6297
182 Ga0207657_10021622 3300025919 Bacteria 6048
183 Ga0207657_10023825 3300025919 Bacteria 5689
184 Ga0207657_10029826 3300025919 Bacteria 4959
185 Ga0207657_10316029 3300025919 Bacteria 1236
186 Ga0207657_10468186 3300025919 Bacteria 988
187 Ga0207649_10008251 3300025920 Bacteria 5674
188 Ga0207649_10014529 3300025920 Bacteria 4410
189 Ga0207649_10116354 3300025920 Bacteria 1795
190 Ga0207649_10174979 3300025920 Bacteria 1498
191 Ga0207649_10373421 3300025920 Bacteria 1061
192 Ga0207649_10716281 3300025920 Bacteria 777
193 Ga0207652_10018830 3300025921 Bacteria 5667
194 Ga0207652_10027830 3300025921 Bacteria 4714
195 Ga0207652_10101773 3300025921 Bacteria 2538
196 Ga0207652_10286096 3300025921 Bacteria 1487
197 Ga0207681_10078476 3300025923 Bacteria 2324
198 Ga0207694_10031171 3300025924 Bacteria 4072
199 Ga0207687_10062712 3300025927 Bacteria 2630
200 Ga0207700_10018607 3300025928 Bacteria 4674
201 Ga0207700_10042032 3300025928 Bacteria 3348
202 Ga0207700_10442541 3300025928 Bacteria 1144
203 Ga0207664_10014967 3300025929 Bacteria 5617
204 Ga0207664_10035382 3300025929 Bacteria 3853
205 Ga0207664_10293620 3300025929 Bacteria 1429
206 Ga0207664_10516102 3300025929 Bacteria 1071
207 Ga0207644_10002341 3300025931 Bacteria 12242
208 Ga0207644_10068768 3300025931 Bacteria 2584
209 Ga0207644_10243399 3300025931 Bacteria 1433
210 Ga0207690_10014783 3300025932 Bacteria 4721
211 Ga0207690_10050815 3300025932 Bacteria 2769
212 Ga0207690_10058090 3300025932 Bacteria 2615
213 Ga0207690_10067188 3300025932 Bacteria 2458
214 Ga0207706_10037548 3300025933 Bacteria 4300
215 Ga0207706_10103356 3300025933 Bacteria 2506
216 Ga0207706_10312908 3300025933 Bacteria 1367
217 Ga0207665_10023939 3300025939 Bacteria 4023
218 Ga0207661_10012319 3300025944 Bacteria 6212
219 Ga0207661_10125483 3300025944 Bacteria 2191
220 Ga0207679_10012859 3300025945 Bacteria 5474
221 Ga0207679_10041305 3300025945 Bacteria 3306
222 Ga0207667_10038815 3300025949 Bacteria 5079
223 Ga0207667_10083718 3300025949 Bacteria 3303
224 Ga0207667_10096684 3300025949 Bacteria 3048
225 Ga0207667_10116811 3300025949 Bacteria 2749
226 Ga0207667_10140118 3300025949 Bacteria 2490
227 Ga0207667_10160546 3300025949 Bacteria 2312
228 Ga0207667_10424967 3300025949 Bacteria 1352
229 Ga0207667_10623624 3300025949 Bacteria 1086
230 Ga0207651_10306098 3300025960 Bacteria 1323
231 Ga0207651_10600966 3300025960 Bacteria 961
232 Ga0207640_10004539 3300025981 Bacteria 7536
233 Ga0207640_10016159 3300025981 Bacteria 4335
234 Ga0207640_10072008 3300025981 Bacteria 2330
235 Ga0207640_10936630 3300025981 Bacteria 759
236 Ga0207658_10029106 3300025986 Bacteria 3897
237 Ga0207677_10002146 3300026023 Bacteria 10364
238 Ga0207677_10263994 3300026023 Bacteria 1405
239 Ga0207639_10007563 3300026041 Bacteria 7409
240 Ga0207639_10167724 3300026041 Bacteria 1856
241 Ga0207639_10806131 3300026041 Bacteria 875
242 Ga0207678_10001499 3300026067 Bacteria 21399
243 Ga0207678_10006189 3300026067 Bacteria 10637
244 Ga0207678_10016516 3300026067 Bacteria 6481
245 Ga0207678_10093208 3300026067 Bacteria 2574
246 Ga0207702_10033063 3300026078 Bacteria 4317
247 Ga0207702_10035513 3300026078 Bacteria 4168
248 Ga0207702_10096260 3300026078 Bacteria 2603
249 Ga0207702_10175609 3300026078 Bacteria 1968
250 Ga0207702_10231501 3300026078 Bacteria 1727
251 Ga0207702_10261390 3300026078 Bacteria 1630
252 Ga0207676_10275276 3300026095 Bacteria 1526
253 Ga0207674_10006840 3300026116 Bacteria 13373
254 Ga0207674_10006984 3300026116 Bacteria 13212
255 Ga0207683_10181489 3300026121 Bacteria 1908
256 Ga0207683_10268094 3300026121 Bacteria 1559
257 Ga0207698_10001077 3300026142 Bacteria 15878
258 Ga0207698_10006883 3300026142 Bacteria 7115
259 Ga0207698_10164649 3300026142 Bacteria 1944
260 Ga0207698_10491641 3300026142 Bacteria 1192
261 Ga0268266_10042643 3300028379 Bacteria 3876
262 Ga0373941_0246323 3300035115 Bacteria 696
263 Ga0373943_0010539 3300035170 Bacteria 4143
264 Ga0373962_0061111 3300035242 Bacteria 1107
265 Ga0373935_0366646 3300035692 Bacteria 1029
266 Ga0373927_0058752 3300035695 Bacteria 2488
267 Ga0373925_0275961 3300037068 Bacteria 1353
268 Ga0395899_0000416 3300037312 Bacteria 49361
269 Ga0395899_0004509 3300037312 Bacteria 10857
270 Ga0395899_0010953 3300037312 Bacteria 6947
271 Ga0395899_0095881 3300037312 Bacteria 2145
272 Ga0395899_0117671 3300037312 Bacteria 1906
273 Ga0395899_0194318 3300037312 Bacteria 1418
274 Ga0395899_0252598 3300037312 Bacteria 1209
275 Ga0395899_0459281 3300037312 Bacteria 832
276 Ga0395899_0463748 3300037312 Bacteria 827
277 Ga0395900_0000969 3300037418 Bacteria 37329
278 Ga0395900_0001168 3300037418 Bacteria 32771
279 Ga0395900_0009816 3300037418 Bacteria 9808
280 Ga0395900_0012046 3300037418 Bacteria 8840
281 Ga0395900_0018641 3300037418 Bacteria 7077
282 Ga0395900_0033578 3300037418 Bacteria 5280
283 Ga0395900_0035767 3300037418 Bacteria 5117
284 Ga0395900_0069053 3300037418 Bacteria 3631
285 Ga0395900_0076122 3300037418 Bacteria 3449
286 Ga0395900_0146491 3300037418 Bacteria 2414
287 Ga0395900_0190641 3300037418 Bacteria 2079
288 Ga0395900_0233722 3300037418 Bacteria 1847
289 Ga0395900_0325036 3300037418 Bacteria 1517
290 Ga0395900_0332003 3300037418 Bacteria 1498
291 Ga0395900_0358771 3300037418 Bacteria 1429
292 Ga0395900_0548411 3300037418 Bacteria 1101
293 Ga0395900_0675219 3300037418 Bacteria 968
294 Ga0395898_0000192 3300037466 Bacteria 156121
295 Ga0395898_0007693 3300037466 Bacteria 11440
296 Ga0395898_0046816 3300037466 Bacteria 4247
297 Ga0395898_0067812 3300037466 Bacteria 3453
298 Ga0395898_0090997 3300037466 Bacteria 2935
299 Ga0395898_0125452 3300037466 Bacteria 2459
300 Ga0395898_0138346 3300037466 Bacteria 2331
301 Ga0395898_0164717 3300037466 Bacteria 2120
302 Ga0395898_0255720 3300037466 Bacteria 1670
303 Ga0395898_0321296 3300037466 Bacteria 1476
304 Ga0395898_0329632 3300037466 Bacteria 1456
305 Ga0395898_0586350 3300037466 Bacteria 1057
306 Ga0395905_0000066 3300037471 Bacteria 183121
307 Ga0395905_0001950 3300037471 Bacteria 23641
308 Ga0395905_0005775 3300037471 Bacteria 12578
309 Ga0395905_0006447 3300037471 Bacteria 11813
310 Ga0395905_0008941 3300037471 Bacteria 9834
311 Ga0395905_0010414 3300037471 Bacteria 9047
312 Ga0395905_0014026 3300037471 Bacteria 7662
313 Ga0395905_0040382 3300037471 Bacteria 4377
314 Ga0395905_0050156 3300037471 Bacteria 3911
315 Ga0395905_0067422 3300037471 Bacteria 3352
316 Ga0395905_0074894 3300037471 Bacteria 3172
317 Ga0395905_0181621 3300037471 Bacteria 1975
318 Ga0395905_0223198 3300037471 Bacteria 1763
319 Ga0395905_0247029 3300037471 Bacteria 1667
320 Ga0395905_0706450 3300037471 Bacteria 910
321 Ga0395905_0740237 3300037471 Bacteria 885
322 Ga0395905_0816015 3300037471 Bacteria 836
323 Ga0395905_1131186 3300037471 Bacteria 686
324 Ga0436364_1309458 3300037853 Bacteria 2261
325 Ga0436364_1467667 3300037853 Bacteria 13726
326 Ga0395901_0000732 3300038443 Bacteria 37201
327 Ga0395901_0005896 3300038443 Bacteria 12398
328 Ga0395901_0012944 3300038443 Bacteria 8463
329 Ga0395901_0024237 3300038443 Bacteria 6226
330 Ga0395901_0047933 3300038443 Bacteria 4436
331 Ga0395901_0152849 3300038443 Bacteria 2424
332 Ga0395901_0194974 3300038443 Bacteria 2124
333 Ga0395901_0271549 3300038443 Bacteria 1764
334 Ga0395901_0404030 3300038443 Bacteria 1403
335 Ga0395901_0837139 3300038443 Bacteria 906
336 Ga0436365_0009947 3300039437 Bacteria 10730
337 Ga0436363_0219221 3300039450 Bacteria 2172
338 Ga0466972_0027364 3300044658 Bacteria 2822
339 Ga0466966_0005151 3300044684 Bacteria 8591
340 Ga0466966_0029920 3300044684 Bacteria 3540
341 Ga0466966_0032309 3300044684 Bacteria 3392
342 Ga0466961_0006258 3300044693 Bacteria 7559
343 Ga0466961_0012151 3300044693 Bacteria 5505
344 Ga0466961_0029760 3300044693 Bacteria 3508
345 Ga0466961_0051039 3300044693 Bacteria 2642
346 Ga0466961_0082378 3300044693 Bacteria 2035
347 Ga0466963_0021399 3300044694 Bacteria 4080
348 Ga0466963_0072220 3300044694 Bacteria 2324
349 Ga0466963_0291842 3300044694 Bacteria 1146
350 Ga0466964_0027579 3300044706 Bacteria 2231
351 Ga0466971_0025240 3300044719 Bacteria 2654
352 Ga0466971_0111515 3300044719 Bacteria 1262
353 Ga0466968_0177799 3300044735 Bacteria 988
354 Ga0466970_0017183 3300044765 Bacteria 3736
355 Ga0466970_0060938 3300044765 Bacteria 2021
356 Ga0466957_0098695 3300044842 Bacteria 1838
357 Ga0466957_0102990 3300044842 Bacteria 1802
358 Ga0466957_0250006 3300044842 Bacteria 1179
359 Ga0466959_0067661 3300045049 Bacteria 2589
360 Ga0466959_0104240 3300045049 Bacteria 2029
361 Ga0466959_0106127 3300045049 Bacteria 2008
362 Ga0466959_0170258 3300045049 Bacteria 1528
363 Ga0466959_0196053 3300045049 Bacteria 1407
364 Ga0466959_0221038 3300045049 Bacteria 1314
365 Ga0466958_0003181 3300045836 Bacteria 8459
366 Ga0466958_0010806 3300045836 Bacteria 5125
367 Ga0466958_0142944 3300045836 Bacteria 1507
368 Ga0466958_0189609 3300045836 Bacteria 1306
369 Ga0466967_0055812 3300045976 Bacteria 3480
370 Ga0466967_0084572 3300045976 Bacteria 2871
371 Ga0466967_0801486 3300045976 Bacteria 935
372 Ga0495621_0000768 3300046539 Bacteria 8126
373 Ga0495647_0087887 3300046681 Bacteria 1270
374 Ga0495669_0013834 3300046684 Bacteria 3445
375 Ga0495670_0014349 3300046691 Bacteria 3895
376 Ga0495581_0361169 3300047315 Bacteria 848
377 Ga0496100_0043356 3300048903 Bacteria 2877
378 Ga0496100_0467142 3300048903 Bacteria 969
379 Ga0496107_0030666 3300048910 Bacteria 3833
380 Ga0496109_0515244 3300048912 Bacteria 1129
381 Ga0496110_0329498 3300048913 Bacteria 1391
382 Ga0496110_0768454 3300048913 Bacteria 867
383 Ga0496112_0029553 3300048915 Bacteria 5300
384 Ga0496112_0037155 3300048915 Bacteria 4754
385 Ga0496113_0066401 3300048916 Bacteria 2732
386 Ga0496114_0032503 3300048917 Bacteria 4295
387 Ga0496115_0028051 3300048918 Bacteria 4409
388 Ga0501067_0034944 3300049583 Bacteria 2790
389 Ga0501069_0518531 3300049585 Bacteria 712
390 nmdc:mga03n38_478122_c1 3300050490 Bacteria 696
391 Ga0466962_0006762 3300061719 Bacteria 5501
392 Ga0466962_0077424 3300061719 Bacteria 1590
393 Ga0466962_0082651 3300061719 Bacteria 1536
394 Ga0466962_0380662 3300061719 Bacteria 705
395 Ga0395900_0315873
396 JGI24740J21852_10001128
397 JGI24743J22301_10030089
398 JGI24735J21928_10027356
399 JGI24735J21928_10054290
400 Ga0070658_10053035
401 Ga0070658_10327879
402 Ga0070658_10408030
403 Ga0070676_10054898
404 Ga0070676_10681652
405 Ga0070683_100001218
406 Ga0070683_100988640
407 Ga0070666_10084935
408 Ga0070680_100000600
409 Ga0070680_100004470
410 Ga0070680_100004642
411 Ga0070680_100008845
412 Ga0070680_100010643
413 Ga0070680_100075460
414 Ga0068868_100007620
415 Ga0068868_100118673
416 Ga0070660_100019096
417 Ga0070660_100048163
418 Ga0070689_100450530
419 Ga0070691_10005745
420 Ga0070661_100004224
421 Ga0070661_100018362
422 Ga0070661_100104921
423 Ga0070661_100236607
424 Ga0070692_10023266
425 Ga0070669_100084313
426 Ga0070675_100241995
427 Ga0070671_100001537
428 Ga0070671_100012222
429 Ga0070671_100644126
430 Ga0070674_100037016
431 Ga0070673_100154480
432 Ga0070673_100347951
433 Ga0070659_100009776
434 Ga0070659_100100186
435 Ga0070667_100064335
436 Ga0070709_10501909
437 Ga0070714_100002762
438 Ga0070714_100034448
439 Ga0070714_100109792
440 Ga0070714_100138351
441 Ga0070714_100195610
442 Ga0070714_101039626
443 Ga0070713_100014792
444 Ga0070713_100330626
445 Ga0070713_100633999
446 Ga0070663_100019561
447 Ga0070663_100145436
448 Ga0070663_100268470
449 Ga0070678_100041966
450 Ga0070678_100240884
451 Ga0070662_100086003
452 Ga0070662_100171919
453 Ga0070681_10112990
454 Ga0070681_10237086
455 Ga0070679_100046755
456 Ga0070679_100049402
457 Ga0070679_100059635
458 Ga0070679_100082142
459 Ga0070684_100003221
460 Ga0070684_100360417
461 Ga0070684_100471349
462 Ga0068853_100015242
463 Ga0068853_100019914
464 Ga0068853_100272879
465 Ga0070665_100035413
466 Ga0068855_100024176
467 Ga0068855_100113748
468 Ga0068855_100145956
469 Ga0068855_100278373
470 Ga0068855_100389072
471 Ga0068855_101481214
472 Ga0070664_100003525
473 Ga0070664_100007149
474 Ga0070664_100007605
475 Ga0070664_100287592
476 Ga0068857_100005521
477 Ga0068857_100020750
478 Ga0068854_100002199
479 Ga0068854_100024114
480 Ga0068856_100088542
481 Ga0068856_100240055
482 Ga0068856_100995255
483 Ga0068852_100000831
484 Ga0068852_100011601
485 Ga0068852_100245466
486 Ga0068852_101552013
487 Ga0068864_100315859
488 Ga0068851_10109249
489 Ga0068851_10268626
490 Ga0068863_100655696
491 Ga0068858_100347273
492 Ga0081539_10012130
493 Ga0070717_10002352
494 Ga0070717_10332725
495 Ga0070716_100125153
496 Ga0070716_100192038
497 Ga0070712_100017962
498 Ga0070712_100117901
499 Ga0097621_100135296
500 Ga0097621_100405137
501 Ga0097621_100674376
502 Ga0068871_100537077
503 Ga0105240_10021655
504 Ga0105240_10103868
505 Ga0105240_10243986
506 Ga0105240_10578268
507 Ga0105245_10030661
508 Ga0105248_11055867
509 Ga0105237_10595950
510 Ga0105238_10024336
511 Ga0105238_10044294
512 Ga0105238_10498215
513 Ga0157373_10028202
514 Ga0157373_10028291
515 Ga0157373_10033596
516 Ga0157373_10038286
517 Ga0157373_10122536
518 Ga0157373_10188646
519 Ga0157373_10245794
520 Ga0157371_10013741
521 Ga0157371_10148477
522 Ga0157371_10409757
523 Ga0157370_10029253
524 Ga0157370_10042552
525 Ga0157370_10051440
526 Ga0157370_10098495
527 Ga0157370_10273010
528 Ga0157370_10595903
529 Ga0157369_10025684
530 Ga0157369_10133336
531 Ga0157369_10171673
532 Ga0157369_10316821
533 Ga0157369_10327820
534 Ga0157369_10597857
535 Ga0157369_10798838
536 Ga0157374_10011569
537 Ga0157374_10242366
538 Ga0157374_10847696
539 Ga0157378_10174087
540 Ga0163162_10147462
541 Ga0157372_10314408
542 Ga0157375_10012994
543 Ga0182008_10067921
544 Ga0157376_10396273
545 Ga0206353_10764760
546 Ga0213876_10014546
547 Ga0213875_10018096
548 Ga0207697_10013660
549 Ga0207656_10005491
550 Ga0207656_10148914
551 Ga0207656_10317272
552 Ga0207680_10030568
553 Ga0207647_10003634
554 Ga0207647_10155611
555 Ga0207699_10281310
556 Ga0207705_10002048
557 Ga0207705_10012947
558 Ga0207705_10020277
559 Ga0207705_10038560
560 Ga0207705_10063728
561 Ga0207705_10204523
562 Ga0207707_10156437
563 Ga0207707_10331103
564 Ga0207695_10504593
565 Ga0207671_10338110
566 Ga0207693_10080281
567 Ga0207693_10173839
568 Ga0207660_10001449
569 Ga0207660_10004293
570 Ga0207660_10009882
571 Ga0207660_10024393
572 Ga0207657_10002987
573 Ga0207657_10008881
574 Ga0207657_10009008
575 Ga0207657_10020224
576 Ga0207657_10021622
577 Ga0207657_10023825
578 Ga0207657_10029826
579 Ga0207657_10316029
580 Ga0207657_10468186
581 Ga0207649_10008251
582 Ga0207649_10014529
583 Ga0207649_10116354
584 Ga0207649_10174979
585 Ga0207649_10373421
586 Ga0207649_10716281
587 Ga0207652_10018830
588 Ga0207652_10027830
589 Ga0207652_10101773
590 Ga0207652_10286096
591 Ga0207681_10078476
592 Ga0207694_10031171
593 Ga0207687_10062712
594 Ga0207700_10018607
595 Ga0207700_10042032
596 Ga0207700_10442541
597 Ga0207664_10014967
598 Ga0207664_10035382
599 Ga0207664_10293620
600 Ga0207664_10516102
601 Ga0207644_10002341
602 Ga0207644_10068768
603 Ga0207644_10243399
604 Ga0207690_10014783
605 Ga0207690_10050815
606 Ga0207690_10058090
607 Ga0207690_10067188
608 Ga0207706_10037548
609 Ga0207706_10103356
610 Ga0207706_10312908
611 Ga0207665_10023939
612 Ga0207661_10012319
613 Ga0207661_10125483
614 Ga0207679_10012859
615 Ga0207679_10041305
616 Ga0207667_10038815
617 Ga0207667_10083718
618 Ga0207667_10096684
619 Ga0207667_10116811
620 Ga0207667_10140118
621 Ga0207667_10160546
622 Ga0207667_10424967
623 Ga0207667_10623624
624 Ga0207651_10306098
625 Ga0207651_10600966
626 Ga0207640_10004539
627 Ga0207640_10016159
628 Ga0207640_10072008
629 Ga0207640_10936630
630 Ga0207658_10029106
631 Ga0207677_10002146
632 Ga0207677_10263994
633 Ga0207639_10007563
634 Ga0207639_10167724
635 Ga0207639_10806131
636 Ga0207678_10001499
637 Ga0207678_10006189
638 Ga0207678_10016516
639 Ga0207678_10093208
640 Ga0207702_10033063
641 Ga0207702_10035513
642 Ga0207702_10096260
643 Ga0207702_10175609
644 Ga0207702_10231501
645 Ga0207702_10261390
646 Ga0207676_10275276
647 Ga0207674_10006840
648 Ga0207674_10006984
649 Ga0207683_10181489
650 Ga0207683_10268094
651 Ga0207698_10001077
652 Ga0207698_10006883
653 Ga0207698_10164649
654 Ga0207698_10491641
655 Ga0268266_10042643
656 Ga0373941_0246323
657 Ga0373943_0010539
658 Ga0373962_0061111
659 Ga0373935_0366646
660 Ga0373927_0058752
661 Ga0373925_0275961
662 Ga0395899_0000416
663 Ga0395899_0004509
664 Ga0395899_0010953
665 Ga0395899_0095881
666 Ga0395899_0117671
667 Ga0395899_0194318
668 Ga0395899_0252598
669 Ga0395899_0459281
670 Ga0395899_0463748
671 Ga0395900_0000969
672 Ga0395900_0001168
673 Ga0395900_0009816
674 Ga0395900_0012046
675 Ga0395900_0018641
676 Ga0395900_0033578
677 Ga0395900_0035767
678 Ga0395900_0069053
679 Ga0395900_0076122
680 Ga0395900_0146491
681 Ga0395900_0190641
682 Ga0395900_0233722
683 Ga0395900_0325036
684 Ga0395900_0332003
685 Ga0395900_0358771
686 Ga0395900_0548411
687 Ga0395900_0675219
688 Ga0395898_0000192
689 Ga0395898_0007693
690 Ga0395898_0046816
691 Ga0395898_0067812
692 Ga0395898_0090997
693 Ga0395898_0125452
694 Ga0395898_0138346
695 Ga0395898_0164717
696 Ga0395898_0255720
697 Ga0395898_0321296
698 Ga0395898_0329632
699 Ga0395898_0586350
700 Ga0395905_0000066
701 Ga0395905_0001950
702 Ga0395905_0005775
703 Ga0395905_0006447
704 Ga0395905_0008941
705 Ga0395905_0010414
706 Ga0395905_0014026
707 Ga0395905_0040382
708 Ga0395905_0050156
709 Ga0395905_0067422
710 Ga0395905_0074894
711 Ga0395905_0181621
712 Ga0395905_0223198
713 Ga0395905_0247029
714 Ga0395905_0706450
715 Ga0395905_0740237
716 Ga0395905_0816015
717 Ga0395905_1131186
718 Ga0436364_1309458
719 Ga0436364_1467667
720 Ga0395901_0000732
721 Ga0395901_0005896
722 Ga0395901_0012944
723 Ga0395901_0024237
724 Ga0395901_0047933
725 Ga0395901_0152849
726 Ga0395901_0194974
727 Ga0395901_0271549
728 Ga0395901_0404030
729 Ga0395901_0837139
730 Ga0436365_0009947
731 Ga0436363_0219221
732 Ga0466972_0027364
733 Ga0466966_0005151
734 Ga0466966_0029920
735 Ga0466966_0032309
736 Ga0466961_0006258
737 Ga0466961_0012151
738 Ga0466961_0029760
739 Ga0466961_0051039
740 Ga0466961_0082378
741 Ga0466963_0021399
742 Ga0466963_0072220
743 Ga0466963_0291842
744 Ga0466964_0027579
745 Ga0466971_0025240
746 Ga0466971_0111515
747 Ga0466968_0177799
748 Ga0466970_0017183
749 Ga0466970_0060938
750 Ga0466957_0098695
751 Ga0466957_0102990
752 Ga0466957_0250006
753 Ga0466959_0067661
754 Ga0466959_0104240
755 Ga0466959_0106127
756 Ga0466959_0170258
757 Ga0466959_0196053
758 Ga0466959_0221038
759 Ga0466958_0003181
760 Ga0466958_0010806
761 Ga0466958_0142944
762 Ga0466958_0189609
763 Ga0466967_0055812
764 Ga0466967_0084572
765 Ga0466967_0801486
766 Ga0495621_0000768
767 Ga0495647_0087887
768 Ga0495669_0013834
769 Ga0495670_0014349
770 Ga0495581_0361169
771 Ga0496100_0043356
772 Ga0496100_0467142
773 Ga0496107_0030666
774 Ga0496109_0515244
775 Ga0496110_0329498
776 Ga0496110_0768454
777 Ga0496112_0029553
778 Ga0496112_0037155
779 Ga0496113_0066401
780 Ga0496114_0032503
781 Ga0496115_0028051
782 Ga0501067_0034944
783 Ga0501069_0518531
784 nmdc:mga03n38_478122_c1
785 Ga0466962_0006762
786 Ga0466962_0077424
787 Ga0466962_0082651
788 Ga0466962_0380662

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

43

196

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gwb-assembly1.cif.gz_A-2 crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 0.9447 32 182
3bqf-assembly1.cif.gz_A structure of the central domain (msra) of neisseria meningitidis pilb (complex with a substrate) 0.9432 30 182
7e43-assembly1.cif.gz_B structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori 0.9429 30 182
5fa9-assembly1.cif.gz_A bifunctional methionine sulfoxide reductase ab (msrab) from treponema denticola 0.9426 30 180
7e43-assembly2.cif.gz_A structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori 0.9419 30 182
ID Description Score Start End Superfamily
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.944 32 179 3.30.1060.10
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9401 31 182 3.30.1060.10
3e0mA01 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9388 32 180 3.30.1060.10
af_P0A084_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9349 30 181 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9317 32 179 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A4Q5W4M2-F1-model_v4 deleted 0.9934 34 206
AF-A0A531M5G0-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9922 34 200 GO:0008113
GO:0033744
AF-A0A3B8PAK8-F1-model_v4 deleted 0.9922 33 161
AF-A0A514KVM9-F1-model_v4 deleted 0.9921 29 206
AF-A0A529LRA0-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9921 41 206 GO:0008113
GO:0033744

Map