F432911

General Info

Members Datasets Scaffolds Average Seq Length
394 365 154 354

Family's Representative Sequence

Representative Sequence 3300025920|Ga0207649_10231854|Ga0207649_102318542
Length 341
Sequence MSGLKLRGVRKSFGAVEVIKGVDLDIDDKEFVVFVGPSGCGKSTLLRMIAGQRVNDLDPSNRGIAMVFQSYALYPHMTVRENMGFALRFAGVPKPEITRQVDEAARILELGPLMNRLPKELSGGQRQRVAIGRAIVRHPQVFLFDEPLSNLDAELRVHMRIEIARLHKELATTIIYVTHDQVEAMTLADKIVVLRDGSVSQVGSPLQLYDDPDNLFVAGFIGSPKMNFLPGVIDGAAVRLPQYGNAAIPLALTARPAAGTAVTVGIRPEHFKAGGAAHLDLNIEMIEHLGSETYAYARSGEGDLLTIATQNDRALKAGEALVAQFDPAKALLFDPAGQRIR

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
5 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
6 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
7 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
8 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
9 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
10 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
11 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
12 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
13 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
14 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
15 2516143018 Ensifer sp. BR816 Isolate Nodule
16 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
17 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
18 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
19 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
20 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
21 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
22 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
23 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
24 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
25 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
26 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
27 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
28 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
29 2643221557 Ensifer sp. Root558 Isolate Unclassified
30 2643221591 Devosia sp. Root685 Isolate Unclassified
31 2643221610 Ensifer sp. Root74 Isolate Unclassified
32 2643221629 Devosia sp. Root105 Isolate Unclassified
33 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
34 2643221662 Devosia sp. Root413D1 Isolate Unclassified
35 2643221668 Ensifer sp. Root423 Isolate Unclassified
36 2643221675 Ensifer sp. Root1298 Isolate Unclassified
37 2643221680 Ensifer sp. Root1312 Isolate Unclassified
38 2643221718 Rhizobium sp. Root268 Isolate Unclassified
39 2643221723 Ensifer sp. Root278 Isolate Unclassified
40 2643221726 Ensifer sp. Root954 Isolate Unclassified
41 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
42 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
43 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
44 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
45 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
46 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
47 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
48 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
49 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
50 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
51 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
52 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
53 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
54 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
55 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
56 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
57 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
58 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
59 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
60 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
61 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
62 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
63 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
64 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
65 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
66 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
67 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
68 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
69 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
70 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
71 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
72 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
73 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
74 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
75 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
76 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
77 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
78 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
79 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
80 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
81 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
82 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
83 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
84 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
85 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
86 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
87 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
88 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
89 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
90 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
91 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
92 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
93 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
94 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
95 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
96 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
97 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
98 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
99 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
100 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
101 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
102 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
103 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
104 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
105 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
106 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
107 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
108 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
109 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
110 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
111 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
112 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
113 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
114 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
115 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
116 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
117 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
118 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
119 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
120 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
121 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
122 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
123 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
124 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
125 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
126 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
127 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
128 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
129 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
130 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
131 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
132 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
133 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
134 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
135 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
136 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
137 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
138 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
139 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
140 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
141 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
142 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
143 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
144 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
145 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
146 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
147 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
148 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
149 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
150 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
151 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
152 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
153 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
154 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
155 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
156 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
157 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
158 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
159 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
160 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
161 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
162 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
163 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
164 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
165 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
166 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
167 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
168 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
169 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
170 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
171 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
172 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
173 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
174 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
175 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
176 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
177 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
178 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
179 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
180 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
181 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
182 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
183 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
184 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
185 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
186 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
187 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
188 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
189 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
190 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
191 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
192 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
193 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
194 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
195 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
196 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
197 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
198 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
199 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
200 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
201 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
202 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
203 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
204 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
205 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
206 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
207 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
208 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
209 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
210 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
211 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
212 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
213 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
214 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
215 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
216 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
217 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
218 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
219 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
220 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
221 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
222 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
223 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
224 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
225 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
226 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
227 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
228 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
229 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
230 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
231 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
232 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
233 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
234 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
235 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
236 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
237 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
238 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
239 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
240 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
241 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
242 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
243 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
244 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
245 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
246 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
247 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
248 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
249 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
250 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
251 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
252 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
253 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
254 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
255 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
256 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
257 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
258 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
259 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
260 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
261 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
262 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
263 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
264 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
265 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
266 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
267 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
268 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
269 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
270 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
271 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
273 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
274 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
276 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
277 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
278 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
289 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
290 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
292 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
293 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
294 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
295 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
296 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
297 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
298 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
299 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
300 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
301 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
302 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
303 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
304 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
305 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
306 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
307 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
308 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
309 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
310 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
311 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
312 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
313 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
314 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
315 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
316 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
317 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
318 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
319 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
320 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
321 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
322 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
323 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
324 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
325 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
326 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
327 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
328 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
329 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
330 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
331 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
332 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
333 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
334 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
335 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
336 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
337 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
346 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
347 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
350 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
351 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
352 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
353 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
354 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
355 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
356 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
357 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
358 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
359 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
360 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
361 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
362 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
363 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
364 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
365 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 39.09
Metatranscriptomes 0
Isolates 60.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.63
Nodule 55.08
Rhizoplane 0.76
Rhizosphere 25.38
Stem 0
Stem Tuber 0
Unclassified 10.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000038 3300002987 Bacteria 72800
2 JGI25159J45721_1000110 3300002987 Bacteria 38863
3 JGI25151J46595_10005926 3300003187 Bacteria 6235
4 JGI25160J50197_1000007 3300003354 Bacteria 316012
5 JGI25161J50226_1000651 3300003374 Bacteria 13930
6 Ga0055526_1003513 3300003771 Bacteria 9908
7 Ga0055524_1002249 3300003775 Bacteria 10094
8 Ga0055524_1013590 3300003775 Bacteria 3065
9 Ga0055531_10024188 3300003794 Bacteria 2250
10 Ga0055543_1000227 3300004625 Bacteria 44640
11 Ga0065165_1000011 3300005262 Bacteria 316465
12 Ga0070658_10005380 3300005327 Bacteria 10387
13 Ga0070658_10070360 3300005327 Bacteria 2864
14 Ga0070661_100054651 3300005344 Bacteria 2924
15 Ga0070674_100003199 3300005356 Bacteria 9131
16 Ga0070673_100008684 3300005364 Bacteria 6774
17 Ga0070667_100226121 3300005367 Bacteria 1667
18 Ga0070662_100262431 3300005457 Bacteria 1392
19 Ga0068853_100003215 3300005539 Bacteria 12485
20 Ga0070672_100025843 3300005543 Bacteria 4361
21 Ga0068854_100017589 3300005578 Bacteria 4784
22 Ga0068856_100097308 3300005614 Bacteria 2932
23 Ga0068852_100011902 3300005616 Bacteria 6579
24 Ga0068852_100019976 3300005616 Bacteria 5318
25 Ga0075362_10042274 3300006177 Bacteria 2014
26 Ga0075367_10016873 3300006178 Bacteria 3996
27 Ga0075370_10070895 3300006353 Bacteria 1993
28 Ga0068865_100065245 3300006881 Bacteria 2564
29 Ga0079104_1007094 3300006946 Bacteria 4122
30 Ga0105241_10064964 3300009174 Bacteria 2819
31 Ga0105242_10307774 3300009176 Bacteria 1449
32 Ga0105238_10065704 3300009551 Bacteria 3629
33 Ga0105239_10138081 3300010375 Bacteria 2714
34 Ga0157371_10047349 3300013102 Bacteria 3057
35 Ga0171463_1002 3300013249 Bacteria 1274851
36 Ga0157372_10104885 3300013307 Bacteria 3232
37 Ga0183363_1016 3300015690 Bacteria 67144
38 Ga0214542_1000700 3300021321 Bacteria 63279
39 Ga0214543_1000005 3300021327 Bacteria 454523
40 Ga0214543_1000016 3300021327 Bacteria 295257
41 Ga0228711_1003692 3300022739 Bacteria 23762
42 Ga0228710_1003402 3300022740 Bacteria 25316
43 Ga0209436_100172 3300025208 Bacteria 31063
44 Ga0209130_1000033 3300025284 Bacteria 316064
45 Ga0209676_1004293 3300025292 Bacteria 8034
46 Ga0209676_1023114 3300025292 Bacteria 2041
47 Ga0209025_1000032 3300025294 Bacteria 416141
48 Ga0209564_1000147 3300025295 Bacteria 172628
49 Ga0209050_1029100 3300025298 Bacteria 1775
50 Ga0209256_1000064 3300025299 Bacteria 250853
51 Ga0209256_1001807 3300025299 Bacteria 20127
52 Ga0207426_1000078 3300025302 Bacteria 316064
53 Ga0209051_1035396 3300025303 Bacteria 1858
54 Ga0209257_1008742 3300025304 Bacteria 5638
55 Ga0207645_10013248 3300025907 Bacteria 5563
56 Ga0207657_10020899 3300025919 Bacteria 6178
57 Ga0207657_10094085 3300025919 Bacteria 2495
58 Ga0207649_10231854 3300025920 Bacteria 1321
59 Ga0207691_10126408 3300025940 Bacteria 2262
60 Ga0207640_10019227 3300025981 Bacteria 4032
61 Ga0207640_10211364 3300025981 Bacteria 1478
62 Ga0207639_10029542 3300026041 Bacteria 4015
63 Ga0207674_10006151 3300026116 Bacteria 14177
64 Ga0207683_10029002 3300026121 Bacteria 4790
65 Ga0207698_10025688 3300026142 Bacteria 4154
66 Ga0209281_1000138 3300027111 Bacteria 180979
67 Ga0209281_1000330 3300027111 Bacteria 82146
68 Ga0209282_1000020 3300027666 Bacteria 180986
69 Ga0268266_10075369 3300028379 Bacteria 2931
70 Ga0265319_1041620 3300028563 Bacteria 1549
71 Ga0265318_10004837 3300028577 Bacteria 6435
72 Ga0307515_10000375 3300028794 Bacteria 109285
73 Ga0307515_10001284 3300028794 Bacteria 56989
74 Ga0265332_10091286 3300031238 Bacteria 1287
75 Ga0265320_10010973 3300031240 Bacteria 5357
76 Ga0265340_10021640 3300031247 Bacteria 3297
77 Ga0265339_10117933 3300031249 Bacteria 1367
78 Ga0265327_10018277 3300031251 Bacteria 4355
79 Ga0265316_10141691 3300031344 Bacteria 1805
80 Ga0307513_10000685 3300031456 Bacteria 48701
81 Ga0307513_10127200 3300031456 Bacteria 2501
82 Ga0307408_100041540 3300031548 Bacteria 3261
83 Ga0265313_10042273 3300031595 Bacteria 2240
84 Ga0265313_10058255 3300031595 Bacteria 1821
85 Ga0307508_10064796 3300031616 Bacteria 3221
86 Ga0265314_10038092 3300031711 Bacteria 3477
87 Ga0307516_10051285 3300031730 Bacteria 4045
88 Ga0307516_10123695 3300031730 Bacteria 2374
89 Ga0307412_10143700 3300031911 Bacteria 1751
90 Ga0315914_1004277 3300031967 Bacteria 21387
91 Ga0307416_100099996 3300032002 Bacteria 2521
92 Ga0307510_10157437 3300033180 Bacteria 1876
93 Ga0315913_1001134 3300033430 Bacteria 28065
94 Ga0315915_1000006 3300033464 Bacteria 330709
95 Ga0373962_0015484 3300035242 Bacteria 1956
96 Ga0373931_0113550 3300035691 Bacteria 1540
97 Ga0373935_0045608 3300035692 Bacteria 2766
98 Ga0373927_0007154 3300035695 Bacteria 7570
99 Ga0373925_0001079 3300037068 Bacteria 24530
100 Ga0395899_0003257 3300037312 Bacteria 12872
101 Ga0395899_0016029 3300037312 Bacteria 5714
102 Ga0395900_0004883 3300037418 Bacteria 14118
103 Ga0395900_0088848 3300037418 Bacteria 3177
104 Ga0395900_0691983 3300037418 Bacteria 953
105 Ga0395905_0012234 3300037471 Bacteria 8263
106 Ga0395905_0024634 3300037471 Bacteria 5677
107 Ga0395905_0053805 3300037471 Bacteria 3767
108 Ga0395901_0129473 3300038443 Bacteria 2652
109 Ga0395901_0416335 3300038443 Bacteria 1378
110 Ga0439449_0005914 3300042007 Bacteria 4675
111 Ga0439449_0019461 3300042007 Bacteria 2545
112 Ga0451577_0003389 3300042876 Bacteria 17827
113 Ga0466965_0000200 3300044683 Bacteria 18672
114 Ga0466964_0005438 3300044706 Bacteria 4728
115 Ga0466964_0007826 3300044706 Bacteria 4000
116 Ga0453684_0007780 3300044712 Bacteria 19553
117 Ga0466968_0003305 3300044735 Bacteria 5945
118 Ga0466968_0013283 3300044735 Bacteria 3236
119 Ga0495592_0054106 3300046454 Bacteria 2975
120 Ga0495638_0008240 3300046460 Bacteria 7406
121 Ga0495662_0012517 3300046476 Bacteria 4139
122 Ga0495622_0030234 3300046557 Bacteria 2531
123 Ga0495635_0091206 3300046663 Bacteria 2084
124 Ga0495604_0014327 3300047317 Bacteria 6323
125 Ga0496111_0020948 3300048914 Bacteria 4559
126 Ga0496116_0065847 3300048919 Bacteria 2322
127 Ga0496124_0118797 3300048927 Bacteria 2116
128 Ga0496125_0000481 3300048928 Bacteria 70594
129 Ga0501031_0020906 3300049568 Bacteria 4267
130 Ga0501032_0066352 3300049569 Bacteria 2411
131 Ga0501033_0000776 3300049570 Bacteria 29378
132 Ga0501033_0196346 3300049570 Bacteria 1443
133 Ga0501034_0002012 3300049571 Bacteria 25645
134 Ga0501034_0095886 3300049571 Bacteria 2962
135 Ga0501034_0141388 3300049571 Bacteria 2386
136 Ga0501034_0262240 3300049571 Bacteria 1670
137 Ga0501036_0048089 3300049572 Bacteria 3612
138 Ga0501036_0167195 3300049572 Bacteria 1853
139 Ga0501037_0062196 3300049573 Bacteria 2721
140 Ga0501038_0025214 3300049574 Bacteria 5300
141 Ga0501047_0219351 3300049581 Bacteria 1758
142 Ga0501070_0094100 3300049586 Bacteria 2479
143 Ga0501077_0071170 3300049593 Bacteria 2204
144 Ga0501280_007978 3300049776 Bacteria 1477
145 Ga0501035_0000882 3300049822 Bacteria 31844
146 nmdc:mga0k408_77350_c1 3300050493 Bacteria 1946
147 nmdc:mga07m45_114222_c1 3300050496 Bacteria 1557
148 nmdc:mga0qj67_43012_c1 3300050509 Bacteria 3557
149 Ga0500608_098489 3300053122 Bacteria 1357
150 Ga0500608_116749 3300053122 Bacteria 1216
151 Ga0500559_0013062 3300053136 Bacteria 3522
152 Ga0500590_000094 3300053148 Bacteria 23126
153 Ga0500604_0004601 3300053151 Bacteria 3655
154 Ga0500622_0000370 3300053156 Bacteria 43300

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10070360 Ga0070658_100703602 292
2 3300037418 Ga0395900_0691983 Ga0395900_0691983_25_939 300
3 3300044706 Ga0466964_0007826 Ga0466964_0007826_3006_3965 308
4 3300053122 Ga0500608_098489 Ga0500608_098489_393_1340 308
5 iso_pu_bacteria 2738541317 2738944304 324
6 iso_pu_bacteria 2913308742 2913308923 324
7 iso_pu_bacteria 2970143518 2970149358 336
8 3300005614 Ga0068856_100097308 Ga0068856_1000973082 337
9 3300025920 Ga0207649_10231854 Ga0207649_102318542 337
10 iso_pu_bacteria 2643221591 2643964180 345
11 3300005616 Ga0068852_100019976 Ga0068852_1000199763 347
12 3300013102 Ga0157371_10047349 Ga0157371_100473492 347
13 3300025981 Ga0207640_10019227 Ga0207640_100192273 347
14 3300026142 Ga0207698_10025688 Ga0207698_100256882 347
15 3300037312 Ga0395899_0016029 Ga0395899_0016029_516_1571 347
16 3300038443 Ga0395901_0416335 Ga0395901_0416335_309_1364 347
17 3300005327 Ga0070658_10005380 Ga0070658_100053802 348
18 3300005344 Ga0070661_100054651 Ga0070661_1000546512 348
19 3300005356 Ga0070674_100003199 Ga0070674_1000031996 348
20 3300005364 Ga0070673_100008684 Ga0070673_1000086842 348
21 3300005457 Ga0070662_100262431 Ga0070662_1002624311 348
22 3300005543 Ga0070672_100025843 Ga0070672_1000258432 348
23 3300005578 Ga0068854_100017589 Ga0068854_1000175893 348
24 3300005616 Ga0068852_100011902 Ga0068852_1000119022 348
25 3300006178 Ga0075367_10016873 Ga0075367_100168734 348
26 3300006353 Ga0075370_10070895 Ga0075370_100708952 348
27 3300006881 Ga0068865_100065245 Ga0068865_1000652452 348
28 3300009174 Ga0105241_10064964 Ga0105241_100649642 348
29 3300009176 Ga0105242_10307774 Ga0105242_103077741 348
30 3300009551 Ga0105238_10065704 Ga0105238_100657042 348
31 3300010375 Ga0105239_10138081 Ga0105239_101380812 348
32 3300013307 Ga0157372_10104885 Ga0157372_101048852 348
33 3300025907 Ga0207645_10013248 Ga0207645_100132484 348
34 3300025919 Ga0207657_10020899 Ga0207657_100208994 348
35 3300025919 Ga0207657_10094085 Ga0207657_100940852 348
36 3300025940 Ga0207691_10126408 Ga0207691_101264082 348
37 3300025981 Ga0207640_10211364 Ga0207640_102113642 348
38 3300026041 Ga0207639_10029542 Ga0207639_100295422 348
39 3300026116 Ga0207674_10006151 Ga0207674_1000615111 348
40 3300026121 Ga0207683_10029002 Ga0207683_100290023 348
41 3300028379 Ga0268266_10075369 Ga0268266_100753692 348
42 3300031249 Ga0265339_10117933 Ga0265339_101179332 348
43 3300031595 Ga0265313_10058255 Ga0265313_100582551 348
44 3300035242 Ga0373962_0015484 Ga0373962_0015484_737_1795 348
45 3300049568 Ga0501031_0020906 Ga0501031_0020906_1573_2631 348
46 3300049569 Ga0501032_0066352 Ga0501032_0066352_246_1304 348
47 3300049571 Ga0501034_0095886 Ga0501034_0095886_1337_2395 348
48 3300049571 Ga0501034_0141388 Ga0501034_0141388_895_1953 348
49 3300049572 Ga0501036_0167195 Ga0501036_0167195_201_1259 348
50 3300049573 Ga0501037_0062196 Ga0501037_0062196_198_1256 348
51 3300049574 Ga0501038_0025214 Ga0501038_0025214_616_1674 348
52 3300049581 Ga0501047_0219351 Ga0501047_0219351_255_1313 348
53 3300049586 Ga0501070_0094100 Ga0501070_0094100_1050_2108 348
54 3300049593 Ga0501077_0071170 Ga0501077_0071170_167_1225 348
55 3300050493 nmdc:mga0k408_77350_c1 nmdc:mga0k408_77350_c1_779_1837 348
56 3300050496 nmdc:mga07m45_114222_c1 nmdc:mga07m45_114222_c1_279_1337 348
57 3300005367 Ga0070667_100226121 Ga0070667_1002261211 349
58 3300048914 Ga0496111_0020948 Ga0496111_0020948_3127_4185 349
59 3300048919 Ga0496116_0065847 Ga0496116_0065847_901_1959 349
60 3300048927 Ga0496124_0118797 Ga0496124_0118797_773_1831 349
61 3300048928 Ga0496125_0000481 Ga0496125_0000481_21201_22259 349
62 iso_pu_bacteria 8018150411 8018153716 349
63 iso_pu_bacteria 2510065057 2510303998 350
64 iso_pu_bacteria 2511231052 2511497366 350
65 iso_pu_bacteria 2512047086 2512529808 350
66 iso_pu_bacteria 2513237086 2513582028 350
67 iso_pu_bacteria 2513237091 2513615163 350
68 iso_pu_bacteria 2513237140 2513881559 350
69 iso_pu_bacteria 2513237143 2513901250 350
70 iso_pu_bacteria 2515154107 2515609648 350
71 iso_pu_bacteria 2516653046 2516895402 350
72 iso_pu_bacteria 2551306084 2551682387 350
73 iso_pu_bacteria 2551306085 2551688580 350
74 iso_pu_bacteria 2551306086 2551697081 350
75 iso_pu_bacteria 2551306087 2551704535 350
76 iso_pu_bacteria 2551306089 2551710177 350
77 iso_pu_bacteria 2551306090 2551720528 350
78 iso_pu_bacteria 2551306091 2551724911 350
79 iso_pu_bacteria 2855825444 2855828199 350
80 iso_pu_bacteria 2855839649 2855843309 350
81 iso_pu_bacteria 2858800743 2858805668 350
82 iso_pu_bacteria 2915986958 2915993505 350
83 iso_pu_bacteria 2915993759 2915995688 350
84 iso_pu_bacteria 2916000859 2916004499 350
85 iso_pu_bacteria 2916007675 2916012633 350
86 iso_pu_bacteria 2916014648 2916017008 350
87 iso_pu_bacteria 2916021584 2916027632 350
88 iso_pu_bacteria 2916028427 2916029577 350
89 iso_pu_bacteria 2916035215 2916039952 350
90 iso_pu_bacteria 2916048683 2916051421 350
91 iso_pu_bacteria 2916055098 2916059240 350
92 iso_pu_bacteria 2916076590 2916078215 350
93 iso_pu_bacteria 2921201388 2921208255 350
94 iso_pu_bacteria 2921208531 2921209680 350
95 iso_pu_bacteria 2921237296 2921241386 350
96 iso_pu_bacteria 2921244191 2921247005 350
97 iso_pu_bacteria 2921257292 2921258421 350
98 iso_pu_bacteria 2921263974 2921267259 350
99 iso_pu_bacteria 2921282425 2921287601 350
100 iso_pu_bacteria 2921289301 2921291586 350
101 iso_pu_bacteria 2921296804 2921296830 350
102 iso_pu_bacteria 2924144063 2924144178 350
103 iso_pu_bacteria 2924150972 2924151106 350
104 iso_pu_bacteria 2924158325 2924158437 350
105 iso_pu_bacteria 2924165586 2924166274 350
106 iso_pu_bacteria 2924172951 2924173021 350
107 iso_pu_bacteria 2924179722 2924179849 350
108 iso_pu_bacteria 2924186466 2924187023 350
109 iso_pu_bacteria 2924193448 2924197662 350
110 iso_pu_bacteria 2924200457 2924202331 350
111 iso_pu_bacteria 2924207177 2924210427 350
112 iso_pu_bacteria 2924214083 2924214216 350
113 iso_pu_bacteria 2924221636 2924228072 350
114 iso_pu_bacteria 2924228884 2924230832 350
115 iso_pu_bacteria 2936996657 2936996881 350
116 iso_pu_bacteria 2937002841 2937004897 350
117 iso_pu_bacteria 2937009748 2937013636 350
118 iso_pu_bacteria 2937016420 2937016595 350
119 iso_pu_bacteria 2937023124 2937026452 350
120 iso_pu_bacteria 2937042894 2937046994 350
121 iso_pu_bacteria 2937049772 2937055005 350
122 iso_pu_bacteria 2937056579 2937059737 350
123 iso_pu_bacteria 2937063883 2937066865 350
124 iso_pu_bacteria 2937071275 2937073584 350
125 iso_pu_bacteria 2937091812 2937094776 350
126 iso_pu_bacteria 2937098957 2937098958 350
127 iso_pu_bacteria 2937106411 2937108118 350
128 iso_pu_bacteria 2937113482 2937119126 350
129 iso_pu_bacteria 2937119839 2937121557 350
130 iso_pu_bacteria 2937126314 2937127135 350
131 iso_pu_bacteria 2957382221 2957388002 350
132 iso_pu_bacteria 2957388812 2957392347 350
133 iso_pu_bacteria 2957395598 2957395679 350
134 iso_pu_bacteria 2957402308 2957402470 350
135 iso_pu_bacteria 2957408893 2957413996 350
136 iso_pu_bacteria 2957415311 2957418497 350
137 iso_pu_bacteria 2957422303 2957424517 350
138 iso_pu_bacteria 2957430029 2957433317 350
139 iso_pu_bacteria 2957443900 2957444281 350
140 iso_pu_bacteria 2957450854 2957455545 350
141 iso_pu_bacteria 2957457609 2957458547 350
142 iso_pu_bacteria 2957464669 2957466687 350
143 iso_pu_bacteria 2957471148 2957471197 350
144 iso_pu_bacteria 2957478035 2957482646 350
145 iso_pu_bacteria 2957484790 2957489599 350
146 iso_pu_bacteria 2957491536 2957497028 350
147 iso_pu_bacteria 2957498199 2957503932 350
148 iso_pu_bacteria 2957505466 2957512645 350
149 iso_pu_bacteria 2960584000 2960588576 350
150 iso_pu_bacteria 2960597568 2960599462 350
151 iso_pu_bacteria 2960603979 2960607289 350
152 iso_pu_bacteria 2960610863 2960611234 350
153 iso_pu_bacteria 2960617483 2960619446 350
154 iso_pu_bacteria 2960624210 2960627907 350
155 iso_pu_bacteria 2960637947 2960638487 350
156 iso_pu_bacteria 2960645483 2960647134 350
157 iso_pu_bacteria 2960652885 2960660133 350
158 iso_pu_bacteria 2960660292 2960662398 350
159 iso_pu_bacteria 2960667422 2960669126 350
160 iso_pu_bacteria 2960687367 2960689462 350
161 iso_pu_bacteria 2964607997 2964608682 350
162 iso_pu_bacteria 2964615318 2964617415 350
163 iso_pu_bacteria 2964621998 2964623118 350
164 iso_pu_bacteria 2964628898 2964630071 350
165 iso_pu_bacteria 2964636051 2964638307 350
166 iso_pu_bacteria 2964643177 2964645131 350
167 iso_pu_bacteria 2964649959 2964651873 350
168 iso_pu_bacteria 2964656573 2964660884 350
169 iso_pu_bacteria 2964663802 2964667192 350
170 iso_pu_bacteria 2964670856 2964677188 350
171 iso_pu_bacteria 2964685014 2964690561 350
172 iso_pu_bacteria 2964691889 2964697028 350
173 iso_pu_bacteria 2964698721 2964703450 350
174 iso_pu_bacteria 2964705432 2964705708 350
175 iso_pu_bacteria 2964712639 2964715023 350
176 iso_pu_bacteria 2964719344 2964724127 350
177 iso_pu_bacteria 2967664464 2967669183 350
178 iso_pu_bacteria 2967671571 2967675817 350
179 iso_pu_bacteria 2967678726 2967682473 350
180 iso_pu_bacteria 2967693043 2967697172 350
181 iso_pu_bacteria 2967699805 2967700759 350
182 iso_pu_bacteria 2967706974 2967707031 350
183 iso_pu_bacteria 2967714385 2967717737 350
184 iso_pu_bacteria 2967735183 2967740493 350
185 iso_pu_bacteria 2967742019 2967742078 350
186 iso_pu_bacteria 2967748971 2967752970 350
187 iso_pu_bacteria 2967755722 2967758352 350
188 iso_pu_bacteria 2967762386 2967767307 350
189 iso_pu_bacteria 2967769361 2967771132 350
190 iso_pu_bacteria 2967775926 2967779655 350
191 iso_pu_bacteria 2970019648 2970021434 350
192 iso_pu_bacteria 2970033650 2970036489 350
193 iso_pu_bacteria 2970040964 2970041307 350
194 iso_pu_bacteria 2970047711 2970051203 350
195 iso_pu_bacteria 2970054988 2970055056 350
196 iso_pu_bacteria 2970061556 2970066876 350
197 iso_pu_bacteria 2970068827 2970071956 350
198 iso_pu_bacteria 2970076120 2970076259 350
199 iso_pu_bacteria 2970082768 2970082896 350
200 iso_pu_bacteria 2970088815 2970090867 350
201 iso_pu_bacteria 2970095765 2970096047 350
202 iso_pu_bacteria 2970102677 2970104804 350
203 iso_pu_bacteria 2970109326 2970109439 350
204 iso_pu_bacteria 2970116247 2970116343 350
205 iso_pu_bacteria 2970129317 2970132727 350
206 iso_pu_bacteria 2970136068 2970142209 350
207 iso_pu_bacteria 2970149975 2970150172 350
208 iso_pu_bacteria 2970156795 2970159737 350
209 iso_pu_bacteria 2970164137 2970166059 350
210 iso_pu_bacteria 2970170962 2970175134 350
211 iso_pu_bacteria 2970177841 2970177942 350
212 iso_pu_bacteria 2970184632 2970188345 350
213 iso_pu_bacteria 2970191845 2970195302 350
214 iso_pu_bacteria 2977516862 2977516957 350
215 iso_pu_bacteria 2977523885 2977526225 350
216 iso_pu_bacteria 2977537788 2977544215 350
217 iso_pu_bacteria 2977551784 2977553924 350
218 iso_pu_bacteria 2977558990 2977564326 350
219 iso_pu_bacteria 2977565890 2977568143 350
220 iso_pu_bacteria 2977572785 2977577657 350
221 iso_pu_bacteria 2977579622 2977582760 350
222 iso_pu_bacteria 2989776772 2989780810 350
223 iso_pu_bacteria 648276728 648736903 350
224 iso_pu_bacteria 8003992118 8003995890 350
225 iso_pu_bacteria 8005246636 8005250587 350
226 3300028563 Ga0265319_1041620 Ga0265319_10416201 351
227 3300028577 Ga0265318_10004837 Ga0265318_100048375 351
228 3300031238 Ga0265332_10091286 Ga0265332_100912862 351
229 3300031240 Ga0265320_10010973 Ga0265320_100109731 351
230 3300031247 Ga0265340_10021640 Ga0265340_100216402 351
231 3300031344 Ga0265316_10141691 Ga0265316_101416912 351
232 3300031595 Ga0265313_10042273 Ga0265313_100422732 351
233 3300031711 Ga0265314_10038092 Ga0265314_100380922 351
234 3300035691 Ga0373931_0113550 Ga0373931_0113550_73_1155 351
235 3300053151 Ga0500604_0004601 Ga0500604_0004601_760_1836 351
236 iso_pu_bacteria 2508501122 2509110368 351
237 iso_pu_bacteria 2509276019 2509377324 351
238 iso_pu_bacteria 2512875026 2512969945 351
239 iso_pu_bacteria 2513237089 2513602549 351
240 iso_pu_bacteria 2513237156 2513984715 351
241 iso_pu_bacteria 2513237160 2514005694 351
242 iso_pu_bacteria 2516143018 2516208285 351
243 iso_pu_bacteria 2517487022 2517565175 351
244 iso_pu_bacteria 2523231067 2523470541 351
245 iso_pu_bacteria 2558860100 2558862151 351
246 iso_pu_bacteria 2599185156 2599335843 351
247 iso_pu_bacteria 2599185352 2600192781 351
248 iso_pu_bacteria 2643221557 2643804530 351
249 iso_pu_bacteria 2643221610 2644065511 351
250 iso_pu_bacteria 2643221629 2644168042 351
251 iso_pu_bacteria 2643221637 2644209151 351
252 iso_pu_bacteria 2643221662 2644348737 351
253 iso_pu_bacteria 2643221668 2644375499 351
254 iso_pu_bacteria 2643221675 2644417113 351
255 iso_pu_bacteria 2643221680 2644448135 351
256 iso_pu_bacteria 2643221718 2644652625 351
257 iso_pu_bacteria 2643221723 2644677650 351
258 iso_pu_bacteria 2643221726 2644686712 351
259 iso_pu_bacteria 2657244999 2657684582 351
260 iso_pu_bacteria 2690316117 2692318028 351
261 iso_pu_bacteria 2791355082 2792580523 351
262 iso_pu_bacteria 2791355091 2792623432 351
263 iso_pu_bacteria 2791355092 2792630271 351
264 iso_pu_bacteria 2791355094 2792640707 351
265 iso_pu_bacteria 2791355253 2793280479 351
266 iso_pu_bacteria 2802428858 2802716370 351
267 iso_pu_bacteria 2802428859 2802722592 351
268 iso_pu_bacteria 2802428860 2802729266 351
269 iso_pu_bacteria 2802428861 2802735658 351
270 iso_pu_bacteria 2802428862 2802741767 351
271 iso_pu_bacteria 2802428863 2802748216 351
272 iso_pu_bacteria 2802429268 2804754327 351
273 iso_pu_bacteria 2838074704 2838077916 351
274 iso_pu_bacteria 2842922631 2842927006 351
275 iso_pu_bacteria 2847417321 2847423467 351
276 iso_pu_bacteria 2848992105 2848998435 351
277 iso_pu_bacteria 2850079185 2850085462 351
278 iso_pu_bacteria 2855872281 2855875087 351
279 iso_pu_bacteria 2896384573 2896388483 351
280 iso_pu_bacteria 2913295892 2913296459 351
281 iso_pu_bacteria 2915980308 2915984628 351
282 iso_pu_bacteria 2916061851 2916061894 351
283 iso_pu_bacteria 2920760137 2920764579 351
284 iso_pu_bacteria 2920822456 2920826900 351
285 iso_pu_bacteria 2921250672 2921255802 351
286 iso_pu_bacteria 2937029754 2937030847 351
287 iso_pu_bacteria 2937036028 2937041812 351
288 iso_pu_bacteria 2937078374 2937080968 351
289 iso_pu_bacteria 2937084907 2937085083 351
290 iso_pu_bacteria 2941499720 2941505908 351
291 iso_pu_bacteria 2957375807 2957377102 351
292 iso_pu_bacteria 2960591022 2960592370 351
293 iso_pu_bacteria 2960631154 2960631344 351
294 iso_pu_bacteria 2960680706 2960682832 351
295 iso_pu_bacteria 2960693952 2960696102 351
296 iso_pu_bacteria 2967686174 2967686858 351
297 iso_pu_bacteria 2967728569 2967731592 351
298 iso_pu_bacteria 2970026789 2970026913 351
299 iso_pu_bacteria 2970122695 2970126861 351
300 iso_pu_bacteria 2977530762 2977532965 351
301 iso_pu_bacteria 2977544691 2977545092 351
302 iso_pu_bacteria 643692032 643822136 351
303 iso_pu_bacteria 8003999396 8004003654 351
304 iso_pu_bacteria 8024486573 8024486619 351
305 iso_pu_bacteria 8049293176 8049297384 351
306 iso_pu_bacteria 8054558443 8054562343 351
307 3300049570 Ga0501033_0000776 Ga0501033_0000776_16675_17748 352
308 3300049571 Ga0501034_0002012 Ga0501034_0002012_16339_17418 352
309 3300049822 Ga0501035_0000882 Ga0501035_0000882_11860_12933 352
310 3300037312 Ga0395899_0003257 Ga0395899_0003257_5140_6270 353
311 3300037418 Ga0395900_0004883 Ga0395900_0004883_7941_9071 353
312 3300037471 Ga0395905_0053805 Ga0395905_0053805_149_1279 353
313 3300038443 Ga0395901_0129473 Ga0395901_0129473_1216_2346 353
314 3300044683 Ga0466965_0000200 Ga0466965_0000200_4986_6080 353
315 3300044706 Ga0466964_0005438 Ga0466964_0005438_2182_3276 353
316 3300044735 Ga0466968_0003305 Ga0466968_0003305_21_1115 353
317 3300044735 Ga0466968_0013283 Ga0466968_0013283_1639_2733 353
318 3300027111 Ga0209281_1000330 Ga0209281_100033034 354
319 3300031548 Ga0307408_100041540 Ga0307408_1000415403 354
320 3300031730 Ga0307516_10051285 Ga0307516_100512852 354
321 3300032002 Ga0307416_100099996 Ga0307416_1000999962 354
322 3300037418 Ga0395900_0088848 Ga0395900_0088848_1168_2253 354
323 3300037471 Ga0395905_0012234 Ga0395905_0012234_3811_4896 354
324 3300037471 Ga0395905_0024634 Ga0395905_0024634_1215_2303 354
325 3300042007 Ga0439449_0005914 Ga0439449_0005914_993_2063 354
326 3300049776 Ga0501280_007978 Ga0501280_007978_207_1298 354
327 3300053136 Ga0500559_0013062 Ga0500559_0013062_1104_2189 354
328 iso_pu_bacteria 2964678106 2964682022 354
329 3300002987 JGI25159J45721_1000038 JGI25159J45721_100003864 355
330 3300002987 JGI25159J45721_1000110 JGI25159J45721_100011024 355
331 3300003187 JGI25151J46595_10005926 JGI25151J46595_100059265 355
332 3300003354 JGI25160J50197_1000007 JGI25160J50197_100000725 355
333 3300003374 JGI25161J50226_1000651 JGI25161J50226_100065112 355
334 3300003771 Ga0055526_1003513 Ga0055526_10035137 355
335 3300003775 Ga0055524_1002249 Ga0055524_10022496 355
336 3300003775 Ga0055524_1013590 Ga0055524_10135902 355
337 3300003794 Ga0055531_10024188 Ga0055531_100241882 355
338 3300004625 Ga0055543_1000227 Ga0055543_10002277 355
339 3300005262 Ga0065165_1000011 Ga0065165_1000011268 355
340 3300005539 Ga0068853_100003215 Ga0068853_1000032159 355
341 3300006177 Ga0075362_10042274 Ga0075362_100422742 355
342 3300006946 Ga0079104_1007094 Ga0079104_10070942 355
343 3300013249 Ga0171463_1002 Ga0171463_1002137 355
344 3300015690 Ga0183363_1016 Ga0183363_101618 355
345 3300021321 Ga0214542_1000700 Ga0214542_100070038 355
346 3300021327 Ga0214543_1000005 Ga0214543_1000005159 355
347 3300021327 Ga0214543_1000016 Ga0214543_100001657 355
348 3300022739 Ga0228711_1003692 Ga0228711_100369216 355
349 3300022740 Ga0228710_1003402 Ga0228710_100340218 355
350 3300025208 Ga0209436_100172 Ga0209436_1001722 355
351 3300025284 Ga0209130_1000033 Ga0209130_1000033265 355
352 3300025292 Ga0209676_1004293 Ga0209676_10042937 355
353 3300025292 Ga0209676_1023114 Ga0209676_10231141 355
354 3300025294 Ga0209025_1000032 Ga0209025_100003224 355
355 3300025295 Ga0209564_1000147 Ga0209564_1000147128 355
356 3300025298 Ga0209050_1029100 Ga0209050_10291002 355
357 3300025299 Ga0209256_1000064 Ga0209256_1000064146 355
358 3300025299 Ga0209256_1001807 Ga0209256_10018072 355
359 3300025302 Ga0207426_1000078 Ga0207426_1000078265 355
360 3300025303 Ga0209051_1035396 Ga0209051_10353962 355
361 3300025304 Ga0209257_1008742 Ga0209257_10087426 355
362 3300027111 Ga0209281_1000138 Ga0209281_100013815 355
363 3300027666 Ga0209282_1000020 Ga0209282_100002015 355
364 3300028794 Ga0307515_10000375 Ga0307515_100003752 355
365 3300028794 Ga0307515_10001284 Ga0307515_1000128449 355
366 3300031251 Ga0265327_10018277 Ga0265327_100182774 355
367 3300031456 Ga0307513_10000685 Ga0307513_1000068517 355
368 3300031456 Ga0307513_10127200 Ga0307513_101272002 355
369 3300031616 Ga0307508_10064796 Ga0307508_100647962 355
370 3300031730 Ga0307516_10123695 Ga0307516_101236952 355
371 3300031911 Ga0307412_10143700 Ga0307412_101437002 355
372 3300031967 Ga0315914_1004277 Ga0315914_10042776 355
373 3300033180 Ga0307510_10157437 Ga0307510_101574372 355
374 3300033430 Ga0315913_1001134 Ga0315913_100113413 355
375 3300033464 Ga0315915_1000006 Ga0315915_1000006111 355
376 3300035692 Ga0373935_0045608 Ga0373935_0045608_487_1575 355
377 3300035695 Ga0373927_0007154 Ga0373927_0007154_3991_5079 355
378 3300037068 Ga0373925_0001079 Ga0373925_0001079_7966_9054 355
379 3300042007 Ga0439449_0019461 Ga0439449_0019461_462_1535 355
380 3300042876 Ga0451577_0003389 Ga0451577_0003389_6718_7818 355
381 3300044712 Ga0453684_0007780 Ga0453684_0007780_4867_5967 355
382 3300046454 Ga0495592_0054106 Ga0495592_0054106_387_1466 355
383 3300046460 Ga0495638_0008240 Ga0495638_0008240_755_1843 355
384 3300046476 Ga0495662_0012517 Ga0495662_0012517_2410_3489 355
385 3300046557 Ga0495622_0030234 Ga0495622_0030234_904_1983 355
386 3300046663 Ga0495635_0091206 Ga0495635_0091206_752_1831 355
387 3300047317 Ga0495604_0014327 Ga0495604_0014327_2915_3994 355
388 3300049570 Ga0501033_0196346 Ga0501033_0196346_42_1130 355
389 3300049571 Ga0501034_0262240 Ga0501034_0262240_392_1480 355
390 3300049572 Ga0501036_0048089 Ga0501036_0048089_1189_2277 355
391 3300050509 nmdc:mga0qj67_43012_c1 nmdc:mga0qj67_43012_c1_648_1748 355
392 3300053122 Ga0500608_116749 Ga0500608_116749_81_1160 355
393 3300053148 Ga0500590_000094 Ga0500590_000094_8757_9836 355
394 3300053156 Ga0500622_0000370 Ga0500622_0000370_4789_5877 355

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08402

TOBE_2

TOBE domain

264

333

0.98

PF00005

ABC_tran

ABC transporter

19

149

0.95

PF17912

OB_MalK

MalK OB fold domain

222

271

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9095 3 225
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9072 3 222
4mki-assembly1.cif.gz_B cobalt transporter atp-binding subunit 0.9065 3 222
8bmr-assembly1.cif.gz_A cryo-em structure of the wild-type solitary ecf module in msp2n2 lipid nanodiscs in the atpase open and nucleotide-free conformation 0.9013 1 223
6hs3-assembly1.cif.gz_B crystal structure of an abc transporter related protein from burkholderia pseudomallei 0.9008 4 224
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9505 4 216 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9461 2 217 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9336 2 217 3.40.50.300
2awnA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9333 4 216 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9313 4 216 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X9BG07-F1-model_v4 ABC transporter ATP-binding protein 0.9451 4 186 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A2V9R859-F1-model_v4 ABC transporter domain-containing protein 0.945 1 152 GO:0005524
GO:0016887
AF-A0A3C0JFJ3-F1-model_v4 ABC transporter 0.9362 2 155 GO:0005524
GO:0016887
AF-A0A382V5S9-F1-model_v4 ABC transporter domain-containing protein 0.9358 48 191 GO:0005524
GO:0016887
GO:0055052
AF-A0A382V5S9-F1-model_v4 ABC transporter domain-containing protein 0.9297 48 191 GO:0005524
GO:0016887
GO:0055052

Feature Viewer

pLDDT pTM Quality
88.58 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map