F432843

General Info

Members Datasets Scaffolds Average Seq Length
394 191 788 275

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100036225|Ga0068854_1000362252
Length 308
Sequence LTQYFIDDMSQQELNKDSKHNLPLPGATAKAMATRGRRGKEEEVWKKNKVVIAGAGPGDAELITLKLQKRLIEADVIITDRLVNPAIIKEHASKSVEVILTGKQGYHDGSVSQEEINELIVRHALAGKKVLRLKGGDVAFFSNVLDELRCLTVNEIEFEIIPGITAASGASAYAGIPLTARGFSREVKILTLTQCKHYSSETWKQLANSTETLVFYMTSKHLDDLVEILLRYTRKPNTPLAVIEQATTIYQRVHVTTLKNCKKDISGKDFSSPSLVIIGKVVNLYQQFNWFKAGKEGSLFNELILANK

Samples

Sample ID Description Type Environment
1 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
143 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
144 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
145 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
146 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
147 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
148 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
173 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
174 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
175 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
186 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
187 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
188 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
189 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
190 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.25
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.54
Nodule 0
Rhizoplane 0
Rhizosphere 96.45
Stem 0
Stem Tuber 0
Unclassified 14.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068854_100036225 3300005578 Unclassified 3458
2 MRS1b_contig_1046090 2162886011 Unclassified 985
3 rootH1_10096683 3300003316 Bacteria 1364
4 rootL2_10259359 3300003322 Bacteria 1756
5 rootL2_10375556 3300003322 Bacteria 1377
6 rootH1_10325920 3300003323 Bacteria 1703
7 Ga0065704_10239708 3300005289 Bacteria 1019
8 Ga0065712_10010625 3300005290 Bacteria 1932
9 Ga0065712_10074592 3300005290 Unclassified 4046
10 Ga0065712_10096499 3300005290 Bacteria 2181
11 Ga0065712_10163253 3300005290 Bacteria 1283
12 Ga0065707_10158554 3300005295 Bacteria 1566
13 Ga0065707_10163506 3300005295 Bacteria 1542
14 Ga0070658_10235829 3300005327 Bacteria 1550
15 Ga0070676_10007488 3300005328 Bacteria 5861
16 Ga0070676_10041645 3300005328 Bacteria 2664
17 Ga0070676_10059934 3300005328 Bacteria 2259
18 Ga0070683_100000468 3300005329 Bacteria 28362
19 Ga0070683_100028498 3300005329 Bacteria 5047
20 Ga0070690_100225904 3300005330 Bacteria 1314
21 Ga0070670_100011576 3300005331 Bacteria 7540
22 Ga0070670_100045059 3300005331 Bacteria 3791
23 Ga0070670_100062605 3300005331 Bacteria 3194
24 Ga0070670_100068667 3300005331 Bacteria 3042
25 Ga0070677_10008245 3300005333 Bacteria 3499
26 Ga0068869_100001213 3300005334 Bacteria 15157
27 Ga0068869_100016283 3300005334 Bacteria 5008
28 Ga0068869_100026043 3300005334 Bacteria 4067
29 Ga0068869_100028066 3300005334 Bacteria 3929
30 Ga0068869_100047512 3300005334 Bacteria 3100
31 Ga0068869_100051482 3300005334 Bacteria 2988
32 Ga0068869_100079068 3300005334 Bacteria 2450
33 Ga0068869_100175736 3300005334 Bacteria 1676
34 Ga0070666_10010506 3300005335 Bacteria 5792
35 Ga0070666_10067566 3300005335 Bacteria 2427
36 Ga0068868_100002430 3300005338 Bacteria 12901
37 Ga0068868_100005337 3300005338 Bacteria 9021
38 Ga0068868_100112538 3300005338 Bacteria 2213
39 Ga0068868_100122621 3300005338 Unclassified 2121
40 Ga0068868_100211325 3300005338 Unclassified 1621
41 Ga0068868_100633280 3300005338 Bacteria 950
42 Ga0070689_100007820 3300005340 Bacteria 7492
43 Ga0070689_100036867 3300005340 Unclassified 3739
44 Ga0070687_100077646 3300005343 Bacteria 1802
45 Ga0070661_100000179 3300005344 Bacteria 52306
46 Ga0070661_100005295 3300005344 Bacteria 8892
47 Ga0070661_100109747 3300005344 Unclassified 2059
48 Ga0070668_100046033 3300005347 Bacteria 3349
49 Ga0070669_100018080 3300005353 Bacteria 5035
50 Ga0070669_100019577 3300005353 Bacteria 4834
51 Ga0070669_100081845 3300005353 Unclassified 2406
52 Ga0070669_100091084 3300005353 Bacteria 2286
53 Ga0070669_100120118 3300005353 Unclassified 2004
54 Ga0070669_100250311 3300005353 Bacteria 1411
55 Ga0070669_100369572 3300005353 Bacteria 1168
56 Ga0070675_100036384 3300005354 Bacteria 4006
57 Ga0070675_100043606 3300005354 Bacteria 3667
58 Ga0070675_100109354 3300005354 Bacteria 2336
59 Ga0070675_100280977 3300005354 Bacteria 1463
60 Ga0070671_100007610 3300005355 Bacteria 8664
61 Ga0070674_100012790 3300005356 Bacteria 5164
62 Ga0070673_100007053 3300005364 Bacteria 7370
63 Ga0070673_100025747 3300005364 Bacteria 4335
64 Ga0070673_100103721 3300005364 Bacteria 2347
65 Ga0070688_100001613 3300005365 Bacteria 11291
66 Ga0070688_100047424 3300005365 Bacteria 2665
67 Ga0070688_100082719 3300005365 Unclassified 2081
68 Ga0070659_100009725 3300005366 Bacteria 7063
69 Ga0070667_100020311 3300005367 Bacteria 5513
70 Ga0070713_100061666 3300005436 Bacteria 3138
71 Ga0070700_100070920 3300005441 Bacteria 2223
72 Ga0070678_100083759 3300005456 Bacteria 2425
73 Ga0070662_100003840 3300005457 Bacteria 9410
74 Ga0070662_100010257 3300005457 Bacteria 6141
75 Ga0070662_100041177 3300005457 Bacteria 3294
76 Ga0070662_100126255 3300005457 Unclassified 1967
77 Ga0070662_100360561 3300005457 Unclassified 1193
78 Ga0068867_100019220 3300005459 Bacteria 4867
79 Ga0068867_100099342 3300005459 Unclassified 2220
80 Ga0068867_100106378 3300005459 Unclassified 2149
81 Ga0068867_100156401 3300005459 Unclassified 1795
82 Ga0068867_100365413 3300005459 Bacteria 1208
83 Ga0068867_100384803 3300005459 Unclassified 1179
84 Ga0070685_10010865 3300005466 Bacteria 4745
85 Ga0070685_10100462 3300005466 Unclassified 1766
86 Ga0070698_100001682 3300005471 Bacteria 24673
87 Ga0070698_100010443 3300005471 Bacteria 9914
88 Ga0070699_100092938 3300005518 Bacteria 2639
89 Ga0070684_100000484 3300005535 Bacteria 27334
90 Ga0070684_100004834 3300005535 Bacteria 10293
91 Ga0070684_100093773 3300005535 Bacteria 2673
92 Ga0068853_100002848 3300005539 Bacteria 13108
93 Ga0068853_100139531 3300005539 Unclassified 2175
94 Ga0068853_100550430 3300005539 Unclassified 1093
95 Ga0068853_100590165 3300005539 Unclassified 1055
96 Ga0070672_100062369 3300005543 Unclassified 2942
97 Ga0070672_100074516 3300005543 Bacteria 2707
98 Ga0070672_100151345 3300005543 Unclassified 1919
99 Ga0070672_100155611 3300005543 Bacteria 1893
100 Ga0070672_100529462 3300005543 Bacteria 1021
101 Ga0070686_100097909 3300005544 Bacteria 1976
102 Ga0070686_100149046 3300005544 Bacteria 1637
103 Ga0070686_100211065 3300005544 Bacteria 1398
104 Ga0070665_100000009 3300005548 Bacteria 562640
105 Ga0070665_100464693 3300005548 Unclassified 1276
106 Ga0068855_100012113 3300005563 Bacteria 10420
107 Ga0070664_100000140 3300005564 Bacteria 49126
108 Ga0068857_100003859 3300005577 Bacteria 12613
109 Ga0068857_100140991 3300005577 Bacteria 2179
110 Ga0068857_100147176 3300005577 Unclassified 2132
111 Ga0068854_100216472 3300005578 Bacteria 1513
112 Ga0068852_100034493 3300005616 Bacteria 4211
113 Ga0068859_100034175 3300005617 Bacteria 5104
114 Ga0068859_100094686 3300005617 Unclassified 3039
115 Ga0068859_100173485 3300005617 Bacteria 2238
116 Ga0068859_100264818 3300005617 Bacteria 1811
117 Ga0068859_100321133 3300005617 Bacteria 1642
118 Ga0068859_100508727 3300005617 Bacteria 1299
119 Ga0068864_100024936 3300005618 Bacteria 5031
120 Ga0068864_100482657 3300005618 Unclassified 1190
121 Ga0068864_100494658 3300005618 Unclassified 1176
122 Ga0068864_100586530 3300005618 Bacteria 1080
123 Ga0068866_10011875 3300005718 Bacteria 3784
124 Ga0068861_100159208 3300005719 Bacteria 1861
125 Ga0068870_10041466 3300005840 Bacteria 2392
126 Ga0068863_100026092 3300005841 Bacteria 5575
127 Ga0068863_100040278 3300005841 Bacteria 4443
128 Ga0068863_100172499 3300005841 Bacteria 2075
129 Ga0068858_100032141 3300005842 Bacteria 4875
130 Ga0068858_100137310 3300005842 Bacteria 2295
131 Ga0068858_100257606 3300005842 Bacteria 1658
132 Ga0068860_100000033 3300005843 Bacteria 245461
133 Ga0068860_100001094 3300005843 Bacteria 29839
134 Ga0068860_100003278 3300005843 Bacteria 16660
135 Ga0068860_100114644 3300005843 Unclassified 2577
136 Ga0068862_100003222 3300005844 Bacteria 14130
137 Ga0068862_100015256 3300005844 Bacteria 6381
138 Ga0068862_100111078 3300005844 Unclassified 2406
139 Ga0068862_100250884 3300005844 Bacteria 1613
140 Ga0070715_10020222 3300006163 Bacteria 2565
141 Ga0075362_10090315 3300006177 Bacteria 1421
142 Ga0075366_10157144 3300006195 Bacteria 1377
143 Ga0097621_100004679 3300006237 Bacteria 9559
144 Ga0097621_100121702 3300006237 Bacteria 2213
145 Ga0068871_100019974 3300006358 Bacteria 5124
146 Ga0068871_100122186 3300006358 Unclassified 2201
147 Ga0075428_100003257 3300006844 Bacteria 17776
148 Ga0075428_100017559 3300006844 Bacteria 7903
149 Ga0075428_100173755 3300006844 Bacteria 2334
150 Ga0075428_100303638 3300006844 Bacteria 1716
151 Ga0075428_100568381 3300006844 Bacteria 1212
152 Ga0075430_100073998 3300006846 Bacteria 2856
153 Ga0075431_100015671 3300006847 Bacteria 7684
154 Ga0075434_100158217 3300006871 Bacteria 2285
155 Ga0075429_100011176 3300006880 Bacteria 7772
156 Ga0075429_100027418 3300006880 Bacteria 4944
157 Ga0068865_100109997 3300006881 Unclassified 2031
158 Ga0068865_100515438 3300006881 Bacteria 999
159 Ga0097620_100034172 3300006931 Bacteria 5104
160 Ga0097620_100094687 3300006931 Unclassified 3039
161 Ga0097620_100173485 3300006931 Bacteria 2238
162 Ga0097620_100264797 3300006931 Bacteria 1811
163 Ga0097620_100321117 3300006931 Bacteria 1642
164 Ga0097620_100508741 3300006931 Bacteria 1299
165 Ga0105240_10001874 3300009093 Bacteria 34962
166 Ga0105240_10471123 3300009093 Bacteria 1402
167 Ga0111539_10004306 3300009094 Bacteria 18619
168 Ga0111539_10050447 3300009094 Bacteria 4957
169 Ga0111539_10154074 3300009094 Unclassified 2689
170 Ga0105247_10001273 3300009101 Bacteria 18658
171 Ga0105242_10022395 3300009176 Bacteria 4967
172 Ga0105237_10602005 3300009545 Unclassified 1106
173 Ga0105238_10001036 3300009551 Bacteria 28205
174 Ga0105249_10000349 3300009553 Bacteria 46353
175 Ga0105249_10006346 3300009553 Bacteria 10276
176 Ga0105249_10012599 3300009553 Bacteria 7456
177 Ga0105249_10088741 3300009553 Bacteria 2888
178 Ga0105249_10228930 3300009553 Bacteria 1833
179 Ga0105249_10233946 3300009553 Bacteria 1813
180 Ga0105249_10352951 3300009553 Bacteria 1490
181 Ga0105249_10637464 3300009553 Bacteria 1123
182 Ga0105246_10460255 3300011119 Bacteria 1071
183 Ga0157371_10003631 3300013102 Bacteria 13889
184 Ga0157371_10043496 3300013102 Unclassified 3199
185 Ga0157370_10466534 3300013104 Bacteria 1160
186 Ga0157369_10079468 3300013105 Bacteria 3513
187 Ga0157374_10000237 3300013296 Bacteria 51331
188 Ga0157374_10006341 3300013296 Bacteria 10032
189 Ga0157374_10009282 3300013296 Bacteria 8435
190 Ga0157378_10056319 3300013297 Bacteria 3503
191 Ga0157378_10076183 3300013297 Bacteria 3022
192 Ga0157378_10162918 3300013297 Bacteria 2087
193 Ga0163162_10039220 3300013306 Bacteria 4732
194 Ga0163162_10091353 3300013306 Bacteria 3127
195 Ga0163162_10487827 3300013306 Unclassified 1363
196 Ga0157372_10031476 3300013307 Bacteria 5809
197 Ga0157372_10170731 3300013307 Bacteria 2516
198 Ga0157372_10205269 3300013307 Bacteria 2283
199 Ga0157372_10278914 3300013307 Unclassified 1943
200 Ga0157372_10687122 3300013307 Bacteria 1191
201 Ga0157375_10015682 3300013308 Bacteria 6787
202 Ga0157375_10044474 3300013308 Bacteria 4315
203 Ga0157375_10146993 3300013308 Unclassified 2488
204 Ga0157375_10576785 3300013308 Bacteria 1285
205 Ga0157375_10637353 3300013308 Bacteria 1223
206 Ga0163163_10000088 3300014325 Bacteria 101126
207 Ga0163163_10183815 3300014325 Bacteria 2138
208 Ga0163163_10203601 3300014325 Unclassified 2028
209 Ga0163163_10316842 3300014325 Bacteria 1613
210 Ga0157380_10018146 3300014326 Bacteria 5219
211 Ga0157380_10117286 3300014326 Bacteria 2248
212 Ga0157380_10204010 3300014326 Bacteria 1756
213 Ga0157377_10002434 3300014745 Bacteria 8221
214 Ga0157377_10003168 3300014745 Bacteria 7418
215 Ga0157377_10013211 3300014745 Bacteria 4175
216 Ga0157377_10019188 3300014745 Bacteria 3570
217 Ga0157377_10057184 3300014745 Bacteria 2217
218 Ga0157377_10343487 3300014745 Unclassified 999
219 Ga0157379_10022878 3300014968 Bacteria 5540
220 Ga0157379_10114534 3300014968 Bacteria 2424
221 Ga0157376_10013805 3300014969 Bacteria 6039
222 Ga0157376_10022291 3300014969 Bacteria 4933
223 Ga0157376_10139123 3300014969 Bacteria 2176
224 Ga0157376_10302382 3300014969 Bacteria 1515
225 Ga0157376_10543708 3300014969 Bacteria 1148
226 Ga0157376_10587750 3300014969 Bacteria 1107
227 Ga0163161_10002796 3300017792 Bacteria 12374
228 Ga0163161_10057222 3300017792 Bacteria 2833
229 Ga0163161_10059011 3300017792 Bacteria 2790
230 Ga0163161_10172799 3300017792 Bacteria 1653
231 Ga0207666_1023206 3300025271 Bacteria 922
232 Ga0207697_10066126 3300025315 Bacteria 1510
233 Ga0207710_10003840 3300025900 Bacteria 6639
234 Ga0207680_10052568 3300025903 Bacteria 2442
235 Ga0207685_10035436 3300025905 Bacteria 1821
236 Ga0207645_10037033 3300025907 Bacteria 3132
237 Ga0207645_10039700 3300025907 Bacteria 3016
238 Ga0207645_10142903 3300025907 Bacteria 1560
239 Ga0207643_10045390 3300025908 Bacteria 2482
240 Ga0207643_10166579 3300025908 Bacteria 1328
241 Ga0207643_10311204 3300025908 Unclassified 982
242 Ga0207705_10183735 3300025909 Bacteria 1579
243 Ga0207654_10028965 3300025911 Bacteria 3025
244 Ga0207695_10033449 3300025913 Bacteria 5606
245 Ga0207671_10009404 3300025914 Bacteria 8171
246 Ga0207662_10312377 3300025918 Bacteria 1047
247 Ga0207649_10000419 3300025920 Bacteria 31284
248 Ga0207649_10130949 3300025920 Bacteria 1703
249 Ga0207649_10428365 3300025920 Unclassified 995
250 Ga0207681_10034508 3300025923 Bacteria 3327
251 Ga0207681_10077433 3300025923 Bacteria 2338
252 Ga0207681_10478282 3300025923 Bacteria 1017
253 Ga0207650_10035559 3300025925 Bacteria 3619
254 Ga0207650_10293039 3300025925 Bacteria 1327
255 Ga0207659_10010615 3300025926 Bacteria 5792
256 Ga0207659_10063825 3300025926 Bacteria 2664
257 Ga0207690_10019230 3300025932 Bacteria 4201
258 Ga0207706_10002103 3300025933 Bacteria 19496
259 Ga0207706_10010719 3300025933 Bacteria 8373
260 Ga0207706_10011281 3300025933 Bacteria 8142
261 Ga0207706_10066636 3300025933 Bacteria 3169
262 Ga0207706_10307891 3300025933 Bacteria 1380
263 Ga0207686_10000429 3300025934 Bacteria 28636
264 Ga0207686_10209412 3300025934 Bacteria 1401
265 Ga0207686_10265301 3300025934 Bacteria 1261
266 Ga0207670_10025992 3300025936 Bacteria 3684
267 Ga0207670_10200704 3300025936 Bacteria 1515
268 Ga0207669_10090597 3300025937 Bacteria 1989
269 Ga0207691_10020815 3300025940 Bacteria 6198
270 Ga0207691_10041511 3300025940 Bacteria 4246
271 Ga0207691_10234964 3300025940 Bacteria 1586
272 Ga0207689_10003192 3300025942 Bacteria 15033
273 Ga0207689_10015874 3300025942 Bacteria 6379
274 Ga0207689_10065325 3300025942 Bacteria 2993
275 Ga0207689_10068183 3300025942 Unclassified 2924
276 Ga0207689_10141805 3300025942 Bacteria 1980
277 Ga0207661_10000370 3300025944 Bacteria 28914
278 Ga0207679_10000266 3300025945 Bacteria 39927
279 Ga0207679_10005882 3300025945 Bacteria 7710
280 Ga0207651_10061527 3300025960 Bacteria 2612
281 Ga0207651_10101832 3300025960 Bacteria 2133
282 Ga0207651_10109870 3300025960 Bacteria 2067
283 Ga0207712_10001437 3300025961 Bacteria 16256
284 Ga0207712_10003042 3300025961 Bacteria 10707
285 Ga0207712_10026373 3300025961 Bacteria 3870
286 Ga0207712_10151736 3300025961 Bacteria 1790
287 Ga0207712_10221585 3300025961 Bacteria 1513
288 Ga0207712_10491863 3300025961 Bacteria 1047
289 Ga0207712_10505505 3300025961 Bacteria 1034
290 Ga0207712_10578823 3300025961 Bacteria 969
291 Ga0207668_10141309 3300025972 Bacteria 1852
292 Ga0207668_10233319 3300025972 Bacteria 1485
293 Ga0207640_10056277 3300025981 Bacteria 2580
294 Ga0207658_10208910 3300025986 Bacteria 1635
295 Ga0207658_10260631 3300025986 Bacteria 1477
296 Ga0207677_10207387 3300026023 Bacteria 1562
297 Ga0207703_10226431 3300026035 Bacteria 1674
298 Ga0207639_10006867 3300026041 Bacteria 7754
299 Ga0207639_10146488 3300026041 Bacteria 1973
300 Ga0207639_10150448 3300026041 Bacteria 1949
301 Ga0207678_10244709 3300026067 Bacteria 1536
302 Ga0207708_10202926 3300026075 Bacteria 1582
303 Ga0207641_10000448 3300026088 Bacteria 47082
304 Ga0207641_10026975 3300026088 Bacteria 4744
305 Ga0207641_10070743 3300026088 Bacteria 2998
306 Ga0207648_10000568 3300026089 Bacteria 41399
307 Ga0207648_10052344 3300026089 Unclassified 3569
308 Ga0207648_10058044 3300026089 Bacteria 3376
309 Ga0207648_10129562 3300026089 Bacteria 2220
310 Ga0207648_10491522 3300026089 Unclassified 1122
311 Ga0207676_10001414 3300026095 Bacteria 17829
312 Ga0207676_10115879 3300026095 Bacteria 2251
313 Ga0207674_10007803 3300026116 Bacteria 12446
314 Ga0207674_10024112 3300026116 Bacteria 6506
315 Ga0207674_10047093 3300026116 Bacteria 4423
316 Ga0207674_10081609 3300026116 Bacteria 3235
317 Ga0207674_10197406 3300026116 Bacteria 1962
318 Ga0207674_10316786 3300026116 Unclassified 1509
319 Ga0207675_100001208 3300026118 Bacteria 25725
320 Ga0207675_100008005 3300026118 Bacteria 9960
321 Ga0207675_100214120 3300026118 Bacteria 1854
322 Ga0207675_100221924 3300026118 Unclassified 1821
323 Ga0207675_100487495 3300026118 Bacteria 1226
324 Ga0207683_10090329 3300026121 Bacteria 2727
325 Ga0207683_10175055 3300026121 Bacteria 1944
326 Ga0207698_10085377 3300026142 Bacteria 2563
327 Ga0207698_10089626 3300026142 Bacteria 2513
328 Ga0268266_10000014 3300028379 Bacteria 644033
329 Ga0268266_10113232 3300028379 Bacteria 2406
330 Ga0268266_10703137 3300028379 Unclassified 974
331 Ga0268265_10549484 3300028380 Bacteria 1096
332 Ga0268264_10000013 3300028381 Bacteria 513859
333 Ga0268264_10011744 3300028381 Bacteria 7222
334 Ga0268264_10233907 3300028381 Bacteria 1698
335 Ga0265340_10120260 3300031247 Bacteria 1209
336 Ga0265327_10046993 3300031251 Bacteria 2280
337 Ga0265313_10007814 3300031595 Bacteria 7224
338 Ga0373924_0019939 3300035410 Bacteria 2602
339 Ga0373933_0004020 3300035724 Bacteria 8106
340 Ga0373937_0002104 3300036401 Bacteria 16647
341 Ga0395905_0097590 3300037471 Unclassified 2759
342 Ga0439439_0026926 3300041406 Unclassified 1451
343 Ga0439453_0010663 3300041408 Bacteria 1520
344 Ga0439465_0072730 3300041413 Unclassified 1154
345 Ga0439431_0005173 3300041997 Bacteria 2876
346 Ga0450922_004575 3300042124 Bacteria 1273
347 Ga0450923_005172 3300042125 Bacteria 2091
348 Ga0450897_000566 3300042128 Unclassified 2111
349 Ga0451577_0027122 3300042876 Bacteria 5185
350 Ga0466972_0037511 3300044658 Unclassified 2369
351 Ga0453684_0002542 3300044712 Bacteria 43901
352 Ga0466968_0084465 3300044735 Bacteria 1399
353 Ga0451576_0017769 3300045051 Bacteria 7815
354 Ga0495638_0159747 3300046460 Bacteria 1301
355 Ga0495607_0215941 3300046501 Bacteria 941
356 Ga0495608_0084952 3300046511 Unclassified 2052
357 Ga0495630_0002556 3300046517 Bacteria 12625
358 Ga0495648_0001328 3300046524 Bacteria 24502
359 Ga0495640_0070861 3300046533 Bacteria 2341
360 Ga0495598_0026555 3300046537 Bacteria 1588
361 Ga0495621_0003488 3300046539 Bacteria 4341
362 Ga0495604_0331027 3300047317 Unclassified 1016
363 Ga0495687_000106 3300047443 Bacteria 128130
364 Ga0495684_0133947 3300047471 Unclassified 1860
365 Ga0495686_0007856 3300047472 Bacteria 7929
366 Ga0495686_0029961 3300047472 Bacteria 3536
367 Ga0501033_0031966 3300049570 Bacteria 3951
368 Ga0501034_0005007 3300049571 Bacteria 14572
369 Ga0501037_0422671 3300049573 Bacteria 912
370 Ga0501038_0441666 3300049574 Bacteria 1002
371 Ga0501047_0583274 3300049581 Unclassified 941
372 Ga0501072_0440640 3300049588 Bacteria 1032
373 Ga0501202_008786 3300049652 Unclassified 1847
374 Ga0501239_002953 3300049672 Unclassified 1586
375 Ga0501257_001418 3300049686 Bacteria 4955
376 Ga0501245_007896 3300049708 Bacteria 1510
377 Ga0501035_0456982 3300049822 Bacteria 1056
378 Ga0501044_0010442 3300049823 Bacteria 10079
379 nmdc:mga03683_83583_c1 3300050489 Bacteria 1382
380 nmdc:mga0k408_1625_c2 3300050493 Bacteria 3485
381 nmdc:mga07m45_76505_c2 3300050496 Bacteria 1540
382 nmdc:mga09592_41171_c1 3300050508 Bacteria 3884
383 nmdc:mga0qj67_197895_c1 3300050509 Bacteria 1633
384 nmdc:mga0qj67_7342_c1 3300050509 Bacteria 8145
385 nmdc:mga08y16_221183_c1 3300050511 Bacteria 1960
386 nmdc:mga08y16_247641_c1 3300050511 Bacteria 1841
387 nmdc:mga0n895_38974_c1 3300050512 Bacteria 4607
388 Ga0500583_0002350 3300053092 Bacteria 5668
389 Ga0500641_0001197 3300053096 Bacteria 9243
390 Ga0500568_0001302 3300053139 Bacteria 16386
391 Ga0500622_0004860 3300053156 Bacteria 8234
392 Ga0500611_000004 3300053727 Bacteria 253326
393 Ga0587077_008752 3300059493 Bacteria 1516
394 2958513259 2958512119 Bacteria 4528530
395 Ga0068854_100036225
396 MRS1b_contig_1046090
397 rootH1_10096683
398 rootL2_10259359
399 rootL2_10375556
400 rootH1_10325920
401 Ga0065704_10239708
402 Ga0065712_10010625
403 Ga0065712_10074592
404 Ga0065712_10096499
405 Ga0065712_10163253
406 Ga0065707_10158554
407 Ga0065707_10163506
408 Ga0070658_10235829
409 Ga0070676_10007488
410 Ga0070676_10041645
411 Ga0070676_10059934
412 Ga0070683_100000468
413 Ga0070683_100028498
414 Ga0070690_100225904
415 Ga0070670_100011576
416 Ga0070670_100045059
417 Ga0070670_100062605
418 Ga0070670_100068667
419 Ga0070677_10008245
420 Ga0068869_100001213
421 Ga0068869_100016283
422 Ga0068869_100026043
423 Ga0068869_100028066
424 Ga0068869_100047512
425 Ga0068869_100051482
426 Ga0068869_100079068
427 Ga0068869_100175736
428 Ga0070666_10010506
429 Ga0070666_10067566
430 Ga0068868_100002430
431 Ga0068868_100005337
432 Ga0068868_100112538
433 Ga0068868_100122621
434 Ga0068868_100211325
435 Ga0068868_100633280
436 Ga0070689_100007820
437 Ga0070689_100036867
438 Ga0070687_100077646
439 Ga0070661_100000179
440 Ga0070661_100005295
441 Ga0070661_100109747
442 Ga0070668_100046033
443 Ga0070669_100018080
444 Ga0070669_100019577
445 Ga0070669_100081845
446 Ga0070669_100091084
447 Ga0070669_100120118
448 Ga0070669_100250311
449 Ga0070669_100369572
450 Ga0070675_100036384
451 Ga0070675_100043606
452 Ga0070675_100109354
453 Ga0070675_100280977
454 Ga0070671_100007610
455 Ga0070674_100012790
456 Ga0070673_100007053
457 Ga0070673_100025747
458 Ga0070673_100103721
459 Ga0070688_100001613
460 Ga0070688_100047424
461 Ga0070688_100082719
462 Ga0070659_100009725
463 Ga0070667_100020311
464 Ga0070713_100061666
465 Ga0070700_100070920
466 Ga0070678_100083759
467 Ga0070662_100003840
468 Ga0070662_100010257
469 Ga0070662_100041177
470 Ga0070662_100126255
471 Ga0070662_100360561
472 Ga0068867_100019220
473 Ga0068867_100099342
474 Ga0068867_100106378
475 Ga0068867_100156401
476 Ga0068867_100365413
477 Ga0068867_100384803
478 Ga0070685_10010865
479 Ga0070685_10100462
480 Ga0070698_100001682
481 Ga0070698_100010443
482 Ga0070699_100092938
483 Ga0070684_100000484
484 Ga0070684_100004834
485 Ga0070684_100093773
486 Ga0068853_100002848
487 Ga0068853_100139531
488 Ga0068853_100550430
489 Ga0068853_100590165
490 Ga0070672_100062369
491 Ga0070672_100074516
492 Ga0070672_100151345
493 Ga0070672_100155611
494 Ga0070672_100529462
495 Ga0070686_100097909
496 Ga0070686_100149046
497 Ga0070686_100211065
498 Ga0070665_100000009
499 Ga0070665_100464693
500 Ga0068855_100012113
501 Ga0070664_100000140
502 Ga0068857_100003859
503 Ga0068857_100140991
504 Ga0068857_100147176
505 Ga0068854_100216472
506 Ga0068852_100034493
507 Ga0068859_100034175
508 Ga0068859_100094686
509 Ga0068859_100173485
510 Ga0068859_100264818
511 Ga0068859_100321133
512 Ga0068859_100508727
513 Ga0068864_100024936
514 Ga0068864_100482657
515 Ga0068864_100494658
516 Ga0068864_100586530
517 Ga0068866_10011875
518 Ga0068861_100159208
519 Ga0068870_10041466
520 Ga0068863_100026092
521 Ga0068863_100040278
522 Ga0068863_100172499
523 Ga0068858_100032141
524 Ga0068858_100137310
525 Ga0068858_100257606
526 Ga0068860_100000033
527 Ga0068860_100001094
528 Ga0068860_100003278
529 Ga0068860_100114644
530 Ga0068862_100003222
531 Ga0068862_100015256
532 Ga0068862_100111078
533 Ga0068862_100250884
534 Ga0070715_10020222
535 Ga0075362_10090315
536 Ga0075366_10157144
537 Ga0097621_100004679
538 Ga0097621_100121702
539 Ga0068871_100019974
540 Ga0068871_100122186
541 Ga0075428_100003257
542 Ga0075428_100017559
543 Ga0075428_100173755
544 Ga0075428_100303638
545 Ga0075428_100568381
546 Ga0075430_100073998
547 Ga0075431_100015671
548 Ga0075434_100158217
549 Ga0075429_100011176
550 Ga0075429_100027418
551 Ga0068865_100109997
552 Ga0068865_100515438
553 Ga0097620_100034172
554 Ga0097620_100094687
555 Ga0097620_100173485
556 Ga0097620_100264797
557 Ga0097620_100321117
558 Ga0097620_100508741
559 Ga0105240_10001874
560 Ga0105240_10471123
561 Ga0111539_10004306
562 Ga0111539_10050447
563 Ga0111539_10154074
564 Ga0105247_10001273
565 Ga0105242_10022395
566 Ga0105237_10602005
567 Ga0105238_10001036
568 Ga0105249_10000349
569 Ga0105249_10006346
570 Ga0105249_10012599
571 Ga0105249_10088741
572 Ga0105249_10228930
573 Ga0105249_10233946
574 Ga0105249_10352951
575 Ga0105249_10637464
576 Ga0105246_10460255
577 Ga0157371_10003631
578 Ga0157371_10043496
579 Ga0157370_10466534
580 Ga0157369_10079468
581 Ga0157374_10000237
582 Ga0157374_10006341
583 Ga0157374_10009282
584 Ga0157378_10056319
585 Ga0157378_10076183
586 Ga0157378_10162918
587 Ga0163162_10039220
588 Ga0163162_10091353
589 Ga0163162_10487827
590 Ga0157372_10031476
591 Ga0157372_10170731
592 Ga0157372_10205269
593 Ga0157372_10278914
594 Ga0157372_10687122
595 Ga0157375_10015682
596 Ga0157375_10044474
597 Ga0157375_10146993
598 Ga0157375_10576785
599 Ga0157375_10637353
600 Ga0163163_10000088
601 Ga0163163_10183815
602 Ga0163163_10203601
603 Ga0163163_10316842
604 Ga0157380_10018146
605 Ga0157380_10117286
606 Ga0157380_10204010
607 Ga0157377_10002434
608 Ga0157377_10003168
609 Ga0157377_10013211
610 Ga0157377_10019188
611 Ga0157377_10057184
612 Ga0157377_10343487
613 Ga0157379_10022878
614 Ga0157379_10114534
615 Ga0157376_10013805
616 Ga0157376_10022291
617 Ga0157376_10139123
618 Ga0157376_10302382
619 Ga0157376_10543708
620 Ga0157376_10587750
621 Ga0163161_10002796
622 Ga0163161_10057222
623 Ga0163161_10059011
624 Ga0163161_10172799
625 Ga0207666_1023206
626 Ga0207697_10066126
627 Ga0207710_10003840
628 Ga0207680_10052568
629 Ga0207685_10035436
630 Ga0207645_10037033
631 Ga0207645_10039700
632 Ga0207645_10142903
633 Ga0207643_10045390
634 Ga0207643_10166579
635 Ga0207643_10311204
636 Ga0207705_10183735
637 Ga0207654_10028965
638 Ga0207695_10033449
639 Ga0207671_10009404
640 Ga0207662_10312377
641 Ga0207649_10000419
642 Ga0207649_10130949
643 Ga0207649_10428365
644 Ga0207681_10034508
645 Ga0207681_10077433
646 Ga0207681_10478282
647 Ga0207650_10035559
648 Ga0207650_10293039
649 Ga0207659_10010615
650 Ga0207659_10063825
651 Ga0207690_10019230
652 Ga0207706_10002103
653 Ga0207706_10010719
654 Ga0207706_10011281
655 Ga0207706_10066636
656 Ga0207706_10307891
657 Ga0207686_10000429
658 Ga0207686_10209412
659 Ga0207686_10265301
660 Ga0207670_10025992
661 Ga0207670_10200704
662 Ga0207669_10090597
663 Ga0207691_10020815
664 Ga0207691_10041511
665 Ga0207691_10234964
666 Ga0207689_10003192
667 Ga0207689_10015874
668 Ga0207689_10065325
669 Ga0207689_10068183
670 Ga0207689_10141805
671 Ga0207661_10000370
672 Ga0207679_10000266
673 Ga0207679_10005882
674 Ga0207651_10061527
675 Ga0207651_10101832
676 Ga0207651_10109870
677 Ga0207712_10001437
678 Ga0207712_10003042
679 Ga0207712_10026373
680 Ga0207712_10151736
681 Ga0207712_10221585
682 Ga0207712_10491863
683 Ga0207712_10505505
684 Ga0207712_10578823
685 Ga0207668_10141309
686 Ga0207668_10233319
687 Ga0207640_10056277
688 Ga0207658_10208910
689 Ga0207658_10260631
690 Ga0207677_10207387
691 Ga0207703_10226431
692 Ga0207639_10006867
693 Ga0207639_10146488
694 Ga0207639_10150448
695 Ga0207678_10244709
696 Ga0207708_10202926
697 Ga0207641_10000448
698 Ga0207641_10026975
699 Ga0207641_10070743
700 Ga0207648_10000568
701 Ga0207648_10052344
702 Ga0207648_10058044
703 Ga0207648_10129562
704 Ga0207648_10491522
705 Ga0207676_10001414
706 Ga0207676_10115879
707 Ga0207674_10007803
708 Ga0207674_10024112
709 Ga0207674_10047093
710 Ga0207674_10081609
711 Ga0207674_10197406
712 Ga0207674_10316786
713 Ga0207675_100001208
714 Ga0207675_100008005
715 Ga0207675_100214120
716 Ga0207675_100221924
717 Ga0207675_100487495
718 Ga0207683_10090329
719 Ga0207683_10175055
720 Ga0207698_10085377
721 Ga0207698_10089626
722 Ga0268266_10000014
723 Ga0268266_10113232
724 Ga0268266_10703137
725 Ga0268265_10549484
726 Ga0268264_10000013
727 Ga0268264_10011744
728 Ga0268264_10233907
729 Ga0265340_10120260
730 Ga0265327_10046993
731 Ga0265313_10007814
732 Ga0373924_0019939
733 Ga0373933_0004020
734 Ga0373937_0002104
735 Ga0395905_0097590
736 Ga0439439_0026926
737 Ga0439453_0010663
738 Ga0439465_0072730
739 Ga0439431_0005173
740 Ga0450922_004575
741 Ga0450923_005172
742 Ga0450897_000566
743 Ga0451577_0027122
744 Ga0466972_0037511
745 Ga0453684_0002542
746 Ga0466968_0084465
747 Ga0451576_0017769
748 Ga0495638_0159747
749 Ga0495607_0215941
750 Ga0495608_0084952
751 Ga0495630_0002556
752 Ga0495648_0001328
753 Ga0495640_0070861
754 Ga0495598_0026555
755 Ga0495621_0003488
756 Ga0495604_0331027
757 Ga0495687_000106
758 Ga0495684_0133947
759 Ga0495686_0007856
760 Ga0495686_0029961
761 Ga0501033_0031966
762 Ga0501034_0005007
763 Ga0501037_0422671
764 Ga0501038_0441666
765 Ga0501047_0583274
766 Ga0501072_0440640
767 Ga0501202_008786
768 Ga0501239_002953
769 Ga0501257_001418
770 Ga0501245_007896
771 Ga0501035_0456982
772 Ga0501044_0010442
773 nmdc:mga03683_83583_c1
774 nmdc:mga0k408_1625_c2
775 nmdc:mga07m45_76505_c2
776 nmdc:mga09592_41171_c1
777 nmdc:mga0qj67_197895_c1
778 nmdc:mga0qj67_7342_c1
779 nmdc:mga08y16_221183_c1
780 nmdc:mga08y16_247641_c1
781 nmdc:mga0n895_38974_c1
782 Ga0500583_0002350
783 Ga0500641_0001197
784 Ga0500568_0001302
785 Ga0500622_0004860
786 Ga0500611_000004
787 Ga0587077_008752
788 2958513259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

49

262

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pr2-assembly1.cif.gz_A r261a/s128a s. typhimurium siroheme synthase 0.9401 6 252
6p7d-assembly1.cif.gz_A d104n s. typhimurium siroheme synthase 0.9364 6 252
6pr2-assembly1.cif.gz_B r261a/s128a s. typhimurium siroheme synthase 0.9341 5 252
6veb-assembly1.cif.gz_B precorrin-2-bound s128a s. typhimurium siroheme synthase 0.9317 5 252
6pqz-assembly1.cif.gz_B p133g/s128a s. typhimurium siroheme synthase 0.9315 5 252
ID Description Score Start End Superfamily
1pjsB05 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.916 126 252 3.30.950.10
1pjsA04 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9116 7 125 3.40.1010.10
1s4dH02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9093 129 250 3.30.950.10
af_Q2FVM0_1_122_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9071 3 125 3.40.1010.10
af_A0A0R0IWM0_102_225_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9039 3 125 3.40.1010.10
ID Description Score Start End GO Terms
AF-A0A537I0L7-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9549 1 263 GO:0004851
GO:0019354
GO:0032259
AF-A0A537KQ76-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9515 7 265 GO:0004851
GO:0019354
GO:0032259
AF-A0A537I0L7-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9479 1 263 GO:0004851
GO:0019354
GO:0032259
AF-A0A7S8HE03-F1-model_v4 precorrin-2 dehydrogenase (EC 1.3.1.76) 0.9434 5 97 GO:0004325
GO:0008168
GO:0019354
GO:0043115
AF-A0A5B8V4I5-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9418 6 265 GO:0004851
GO:0019354
GO:0032259

Map