F432831

General Info

Members Datasets Scaffolds Average Seq Length
394 173 389 236

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_10004142|Ga0070685_100041422
Length 259
Sequence MPRPWVSQSASDAAKAIRAGSGRDGPMSDSSNDYAYLAENWASVRERVDAACRAAGRDPGKVSILPVSKTFGPEVVRAAMALGLHRFGENKVQEIRGKSEALAGEPIEWVVIGHLQTNKTKDVARLASEVQSLDRLELADALQRRLELEDRALDVLIEVKTSPEDSKHGLPAEQLTSFLQALRAYDRLRVRGLMTLAVQSDDPAEVRACFRQLRQLSVAGRDQGHDLTRLSMGMSGDFPLAIAEGATEIRIGTAIFGVR

Samples

Sample ID Description Type Environment
1 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
2 2739367700 Dyella sp. YR388 Isolate Unclassified
3 2884411467 Dyella sp. AD56 Isolate Rhizosphere
4 2928963466 Dyella japonica 1073 Isolate Unclassified
5 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
127 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
128 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
156 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 0.76
Isolates 1.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.04
Nodule 0
Rhizoplane 1.78
Rhizosphere 71.07
Stem 0
Stem Tuber 0
Unclassified 8.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10004343 3300001989 Bacteria 5429
2 JGI25156J39149_1003639 3300002705 Bacteria 4963
3 JGI25156J39149_1003884 3300002705 Bacteria 4744
4 JGI25156J39149_1004132 3300002705 Bacteria 4506
5 JGI25162J39368_1000312 3300002737 Bacteria 43079
6 JGI25162J39368_1000579 3300002737 Bacteria 26843
7 JGI25162J39368_1002648 3300002737 Bacteria 6606
8 JGI25162J39368_1002933 3300002737 Bacteria 5774
9 JGI25154J39366_1008632 3300002738 Bacteria 1302
10 JGI25154J39366_1008852 3300002738 Bacteria 1273
11 JGI25157J39369_1000191 3300002741 Bacteria 51859
12 JGI25157J39369_1001907 3300002741 Bacteria 6322
13 JGI25157J39369_1008033 3300002741 Bacteria 1490
14 JGI25163J39215_1000093 3300002771 Bacteria 37259
15 JGI25164J39214_1000057 3300002772 Bacteria 113023
16 JGI25164J39214_1000140 3300002772 Bacteria 70123
17 JGI25164J39214_1000390 3300002772 Bacteria 25835
18 JGI25164J39214_1000782 3300002772 Bacteria 11508
19 JGI25165J46597_1000072 3300003214 Bacteria 192184
20 JGI25165J46597_1000261 3300003214 Bacteria 70135
21 JGI25165J46597_1000725 3300003214 Bacteria 25839
22 JGI25153J46596_10021237 3300003215 Bacteria 2425
23 Ga0006562J51391_1189161 3300003578 Bacteria 8713
24 Ga0006562J51391_1189162 3300003578 Bacteria 8520
25 Ga0055538_1000938 3300003751 Bacteria 7052
26 Ga0055539_1001751 3300003752 Bacteria 3765
27 Ga0055533_1000524 3300003756 Bacteria 13801
28 Ga0055527_1000031 3300003760 Bacteria 159089
29 Ga0055535_1000171 3300003761 Bacteria 70123
30 Ga0055535_1000203 3300003761 Bacteria 63507
31 Ga0055535_1000547 3300003761 Bacteria 32284
32 Ga0055535_1003195 3300003761 Bacteria 4851
33 Ga0055535_1007655 3300003761 Bacteria 2035
34 Ga0055542_1000100 3300003762 Bacteria 117410
35 Ga0055542_1000392 3300003762 Bacteria 44074
36 Ga0055542_1000400 3300003762 Bacteria 43079
37 Ga0055542_1000461 3300003762 Bacteria 38427
38 Ga0055542_1000487 3300003762 Bacteria 36731
39 Ga0055529_1000073 3300003763 Bacteria 159093
40 Ga0055529_1000160 3300003763 Bacteria 92524
41 Ga0055529_1000260 3300003763 Bacteria 62931
42 Ga0055529_1005412 3300003763 Bacteria 1851
43 Ga0070658_10117832 3300005327 Bacteria 2205
44 Ga0070683_100032923 3300005329 Bacteria 4724
45 Ga0070683_100241739 3300005329 Bacteria 1717
46 Ga0070683_100260020 3300005329 Bacteria 1651
47 Ga0070680_100041833 3300005336 Bacteria 3716
48 Ga0070682_100002950 3300005337 Bacteria 9443
49 Ga0070682_100007071 3300005337 Bacteria 6314
50 Ga0070660_100022975 3300005339 Bacteria 4617
51 Ga0070689_100002527 3300005340 Bacteria 11979
52 Ga0070661_100003074 3300005344 Bacteria 11482
53 Ga0070659_100000820 3300005366 Bacteria 22687
54 Ga0070667_100613145 3300005367 Bacteria 1003
55 Ga0070714_100000030 3300005435 Bacteria 136610
56 Ga0070713_100000235 3300005436 Bacteria 36581
57 Ga0070663_100029555 3300005455 Bacteria 3746
58 Ga0070663_100072393 3300005455 Bacteria 2511
59 Ga0070663_100171828 3300005455 Bacteria 1676
60 Ga0070663_100319317 3300005455 Bacteria 1248
61 Ga0070681_10032908 3300005458 Bacteria 5205
62 Ga0070685_10004142 3300005466 Bacteria 7317
63 Ga0070679_100024363 3300005530 Bacteria 5929
64 Ga0068853_100000942 3300005539 Bacteria 20406
65 Ga0068853_100016228 3300005539 Bacteria 6128
66 Ga0068853_100120600 3300005539 Bacteria 2339
67 Ga0068853_100697045 3300005539 Bacteria 968
68 Ga0070696_100002365 3300005546 Bacteria 12463
69 Ga0070693_100026186 3300005547 Bacteria 3147
70 Ga0068855_100002423 3300005563 Bacteria 23028
71 Ga0068855_100008383 3300005563 Bacteria 12496
72 Ga0068855_100012478 3300005563 Bacteria 10256
73 Ga0068855_100039903 3300005563 Bacteria 5573
74 Ga0068855_100116550 3300005563 Bacteria 3061
75 Ga0068855_100123691 3300005563 Bacteria 2959
76 Ga0070664_100852497 3300005564 Bacteria 853
77 Ga0068857_100002972 3300005577 Bacteria 13966
78 Ga0068857_100015480 3300005577 Bacteria 6662
79 Ga0068857_100256945 3300005577 Bacteria 1603
80 Ga0068854_100030222 3300005578 Bacteria 3757
81 Ga0068854_100071393 3300005578 Bacteria 2540
82 Ga0068854_100174169 3300005578 Bacteria 1676
83 Ga0068856_100000053 3300005614 Bacteria 106241
84 Ga0068856_100005680 3300005614 Bacteria 12284
85 Ga0068856_100021078 3300005614 Bacteria 6334
86 Ga0068856_100025763 3300005614 Bacteria 5735
87 Ga0068856_100137357 3300005614 Bacteria 2450
88 Ga0068852_100000041 3300005616 Bacteria 92967
89 Ga0068852_100001846 3300005616 Bacteria 14398
90 Ga0068852_100059540 3300005616 Bacteria 3312
91 Ga0068859_100389594 3300005617 Bacteria 1489
92 Ga0068851_10026507 3300005834 Bacteria 2849
93 Ga0068858_100128730 3300005842 Bacteria 2373
94 Ga0068862_100017991 3300005844 Bacteria 5887
95 Ga0097620_100389603 3300006931 Bacteria 1489
96 Ga0105240_10000251 3300009093 Bacteria 106709
97 Ga0105240_10001964 3300009093 Bacteria 33970
98 Ga0105240_10004404 3300009093 Bacteria 21477
99 Ga0105240_10007753 3300009093 Bacteria 15530
100 Ga0105240_10017916 3300009093 Bacteria 9526
101 Ga0105240_10018395 3300009093 Bacteria 9382
102 Ga0105240_10320426 3300009093 Bacteria 1767
103 Ga0105241_10000098 3300009174 Bacteria 64907
104 Ga0105241_10006306 3300009174 Bacteria 8749
105 Ga0105241_10417228 3300009174 Bacteria 1180
106 Ga0105248_10002347 3300009177 Bacteria 21003
107 Ga0105248_10589830 3300009177 Unclassified 1254
108 Ga0105237_10000007 3300009545 Bacteria 367690
109 Ga0105237_10002806 3300009545 Bacteria 21160
110 Ga0105237_10022153 3300009545 Bacteria 6519
111 Ga0105237_10061871 3300009545 Bacteria 3741
112 Ga0105237_10115516 3300009545 Bacteria 2677
113 Ga0105237_10165489 3300009545 Bacteria 2210
114 Ga0105238_10000416 3300009551 Bacteria 44967
115 Ga0105238_10001618 3300009551 Bacteria 22540
116 Ga0105238_10007508 3300009551 Bacteria 10922
117 Ga0105238_10037538 3300009551 Bacteria 4924
118 Ga0105238_10039465 3300009551 Bacteria 4787
119 Ga0105238_10071895 3300009551 Bacteria 3456
120 Ga0105238_10141075 3300009551 Bacteria 2386
121 Ga0105238_10203092 3300009551 Bacteria 1958
122 Ga0105239_10002494 3300010375 Bacteria 23436
123 Ga0105239_10006809 3300010375 Bacteria 13187
124 Ga0105239_10018068 3300010375 Bacteria 7800
125 Ga0105239_10181416 3300010375 Bacteria 2355
126 Ga0105239_10767914 3300010375 Bacteria 1103
127 Ga0157314_1000216 3300012500 Bacteria 6242
128 Ga0157373_10047776 3300013100 Bacteria 3052
129 Ga0157373_10096494 3300013100 Bacteria 2081
130 Ga0157371_10086170 3300013102 Bacteria 2225
131 Ga0157370_10000003 3300013104 Bacteria 367417
132 Ga0157370_10000662 3300013104 Bacteria 42848
133 Ga0157370_10004578 3300013104 Bacteria 15833
134 Ga0157370_10084921 3300013104 Bacteria 2974
135 Ga0157370_10223959 3300013104 Bacteria 1741
136 Ga0157369_10000094 3300013105 Bacteria 122205
137 Ga0157369_10004756 3300013105 Bacteria 15961
138 Ga0157369_10067772 3300013105 Bacteria 3835
139 Ga0157369_10169675 3300013105 Bacteria 2300
140 Ga0157369_10240066 3300013105 Bacteria 1893
141 Ga0157369_10281670 3300013105 Bacteria 1731
142 Ga0157369_10387579 3300013105 Bacteria 1450
143 Ga0157369_10655921 3300013105 Bacteria 1082
144 Ga0157374_10064713 3300013296 Bacteria 3432
145 Ga0157378_10084688 3300013297 Bacteria 2871
146 Ga0157378_10196242 3300013297 Bacteria 1907
147 Ga0157378_10337849 3300013297 Bacteria 1468
148 Ga0157372_10000074 3300013307 Bacteria 106584
149 Ga0157372_10022036 3300013307 Bacteria 6889
150 Ga0157372_10023047 3300013307 Bacteria 6746
151 Ga0157372_10066367 3300013307 Bacteria 4054
152 Ga0157372_10174157 3300013307 Bacteria 2490
153 Ga0157372_10231717 3300013307 Bacteria 2141
154 Ga0157372_10243998 3300013307 Bacteria 2084
155 Ga0157372_10310029 3300013307 Bacteria 1837
156 Ga0157372_10436492 3300013307 Bacteria 1526
157 Ga0157375_10020413 3300013308 Bacteria 6052
158 Ga0182008_10025563 3300014497 Bacteria 2998
159 Ga0157379_10234648 3300014968 Bacteria 1663
160 Ga0182007_10036741 3300015262 Bacteria 1647
161 Ga0183368_1003 3300015687 Bacteria 1276390
162 Ga0206353_10744876 3300020082 Bacteria 1024
163 Ga0209760_100364 3300025207 Bacteria 12209
164 Ga0209784_100011 3300025224 Bacteria 546770
165 Ga0209566_101061 3300025225 Bacteria 11008
166 Ga0209674_100012 3300025226 Bacteria 950162
167 Ga0209674_101055 3300025226 Bacteria 8298
168 Ga0209672_100016 3300025228 Bacteria 522604
169 Ga0209672_100112 3300025228 Bacteria 92842
170 Ga0209672_100325 3300025228 Bacteria 31169
171 Ga0209672_101557 3300025228 Bacteria 7857
172 Ga0209672_104059 3300025228 Bacteria 2824
173 Ga0207427_100019 3300025231 Bacteria 513977
174 Ga0207427_100055 3300025231 Bacteria 209093
175 Ga0207427_100118 3300025231 Bacteria 102109
176 Ga0207427_100120 3300025231 Bacteria 101516
177 Ga0207427_103070 3300025231 Bacteria 3789
178 Ga0209437_100020 3300025233 Bacteria 656374
179 Ga0209437_100054 3300025233 Bacteria 366715
180 Ga0209437_100127 3300025233 Bacteria 190741
181 Ga0209437_100231 3300025233 Bacteria 94387
182 Ga0209437_100362 3300025233 Bacteria 50377
183 Ga0209258_100012 3300025242 Bacteria 825544
184 Ga0209258_100064 3300025242 Bacteria 293837
185 Ga0209258_100139 3300025242 Bacteria 167268
186 Ga0209258_100216 3300025242 Bacteria 111904
187 Ga0209258_100642 3300025242 Bacteria 26804
188 Ga0209258_101424 3300025242 Bacteria 8477
189 Ga0209646_1000381 3300025246 Bacteria 28523
190 Ga0209646_1002422 3300025246 Bacteria 4159
191 Ga0209646_1003225 3300025246 Bacteria 3272
192 Ga0209026_1000037 3300025250 Bacteria 282562
193 Ga0209026_1000108 3300025250 Bacteria 148837
194 Ga0209026_1000146 3300025250 Bacteria 111481
195 Ga0209026_1000205 3300025250 Bacteria 81843
196 Ga0209026_1001988 3300025250 Bacteria 8154
197 Ga0209026_1006828 3300025250 Bacteria 2706
198 Ga0209677_107622 3300025253 Bacteria 2259
199 Ga0209148_1000001 3300025254 Bacteria 2545271
200 Ga0209148_1000005 3300025254 Bacteria 1806504
201 Ga0209148_1000014 3300025254 Bacteria 925277
202 Ga0209148_1000073 3300025254 Bacteria 320851
203 Ga0209148_1000173 3300025254 Bacteria 130560
204 Ga0209759_1000418 3300025256 Bacteria 52100
205 Ga0209759_1000498 3300025256 Bacteria 43322
206 Ga0209759_1001111 3300025256 Bacteria 17358
207 Ga0209759_1003474 3300025256 Bacteria 6249
208 Ga0209759_1005023 3300025256 Bacteria 4753
209 Ga0209759_1008012 3300025256 Bacteria 3336
210 Ga0209129_1002145 3300025258 Bacteria 10011
211 Ga0209233_1000002 3300025261 Bacteria 2501366
212 Ga0209233_1000020 3300025261 Bacteria 798224
213 Ga0209233_1000063 3300025261 Bacteria 395810
214 Ga0209233_1000147 3300025261 Bacteria 186517
215 Ga0209455_1000014 3300025272 Bacteria 806601
216 Ga0209455_1000018 3300025272 Bacteria 718034
217 Ga0209455_1000019 3300025272 Bacteria 705658
218 Ga0209455_1000474 3300025272 Bacteria 30028
219 Ga0209455_1002769 3300025272 Bacteria 6560
220 Ga0209455_1008770 3300025272 Bacteria 2714
221 Ga0209758_1001158 3300025297 Bacteria 33729
222 Ga0207656_10029278 3300025321 Bacteria 2267
223 Ga0207692_10163990 3300025898 Bacteria 1283
224 Ga0207647_10006620 3300025904 Bacteria 8417
225 Ga0207705_10166549 3300025909 Bacteria 1658
226 Ga0207654_10000424 3300025911 Bacteria 24204
227 Ga0207654_10001029 3300025911 Bacteria 15243
228 Ga0207654_10004538 3300025911 Bacteria 7014
229 Ga0207707_10022589 3300025912 Bacteria 5499
230 Ga0207707_10049326 3300025912 Bacteria 3667
231 Ga0207695_10000129 3300025913 Bacteria 225939
232 Ga0207695_10000194 3300025913 Bacteria 171422
233 Ga0207695_10001665 3300025913 Bacteria 35766
234 Ga0207695_10001945 3300025913 Bacteria 32068
235 Ga0207695_10004570 3300025913 Bacteria 18811
236 Ga0207671_10000763 3300025914 Bacteria 40900
237 Ga0207671_10001550 3300025914 Bacteria 26296
238 Ga0207671_10002198 3300025914 Bacteria 21168
239 Ga0207693_10107116 3300025915 Bacteria 2193
240 Ga0207660_10030107 3300025917 Bacteria 3729
241 Ga0207657_10015424 3300025919 Bacteria 7402
242 Ga0207657_10033091 3300025919 Bacteria 4664
243 Ga0207657_10079254 3300025919 Bacteria 2764
244 Ga0207652_10027959 3300025921 Bacteria 4703
245 Ga0207694_10000301 3300025924 Bacteria 46518
246 Ga0207694_10001712 3300025924 Bacteria 18367
247 Ga0207694_10049891 3300025924 Bacteria 3240
248 Ga0207700_10032590 3300025928 Bacteria 3718
249 Ga0207664_10000026 3300025929 Bacteria 194571
250 Ga0207664_10000841 3300025929 Bacteria 20828
251 Ga0207690_10010666 3300025932 Bacteria 5475
252 Ga0207690_10072069 3300025932 Bacteria 2385
253 Ga0207706_10105795 3300025933 Bacteria 2476
254 Ga0207670_10001131 3300025936 Bacteria 14046
255 Ga0207711_10003048 3300025941 Bacteria 14647
256 Ga0207661_10174561 3300025944 Bacteria 1873
257 Ga0207661_10562608 3300025944 Bacteria 1045
258 Ga0207679_10314025 3300025945 Bacteria 1355
259 Ga0207667_10000140 3300025949 Bacteria 109932
260 Ga0207667_10003163 3300025949 Bacteria 20370
261 Ga0207667_10033731 3300025949 Bacteria 5501
262 Ga0207667_10047932 3300025949 Bacteria 4520
263 Ga0207667_10273597 3300025949 Bacteria 1726
264 Ga0207667_10333157 3300025949 Bacteria 1549
265 Ga0207640_10000678 3300025981 Bacteria 19803
266 Ga0207640_10059159 3300025981 Bacteria 2528
267 Ga0207640_10368994 3300025981 Bacteria 1159
268 Ga0207677_10563073 3300026023 Bacteria 995
269 Ga0207639_10000200 3300026041 Bacteria 45090
270 Ga0207678_10010210 3300026067 Bacteria 8242
271 Ga0207678_10022815 3300026067 Bacteria 5481
272 Ga0207678_10025485 3300026067 Bacteria 5162
273 Ga0207678_10058415 3300026067 Bacteria 3319
274 Ga0207678_10151450 3300026067 Bacteria 1980
275 Ga0207702_10000032 3300026078 Bacteria 168047
276 Ga0207702_10000204 3300026078 Bacteria 70128
277 Ga0207702_10004670 3300026078 Bacteria 12104
278 Ga0207702_10084268 3300026078 Bacteria 2767
279 Ga0207702_10245587 3300026078 Bacteria 1679
280 Ga0207674_10002999 3300026116 Bacteria 20935
281 Ga0207674_10007856 3300026116 Bacteria 12401
282 Ga0207674_10126646 3300026116 Bacteria 2520
283 Ga0207674_10187148 3300026116 Bacteria 2021
284 Ga0207674_10416019 3300026116 Bacteria 1299
285 Ga0207698_10000017 3300026142 Bacteria 178846
286 Ga0207698_10002615 3300026142 Bacteria 10707
287 Ga0207698_10025631 3300026142 Bacteria 4157
288 Ga0207698_10665997 3300026142 Bacteria 1032
289 Ga0265336_10007270 3300028666 Bacteria 3944
290 Ga0316575_10022365 3300031665 Bacteria 2439
291 Ga0395899_0000321 3300037312 Bacteria 60941
292 Ga0395899_0030652 3300037312 Bacteria 4044
293 Ga0395899_0053044 3300037312 Bacteria 3003
294 Ga0395899_0055407 3300037312 Bacteria 2932
295 Ga0395899_0194793 3300037312 Bacteria 1416
296 Ga0395900_0000283 3300037418 Bacteria 76215
297 Ga0395900_0000377 3300037418 Bacteria 64395
298 Ga0395900_0000867 3300037418 Bacteria 39764
299 Ga0395898_0000018 3300037466 Bacteria 418600
300 Ga0395898_0000049 3300037466 Bacteria 284792
301 Ga0395898_0001606 3300037466 Bacteria 30833
302 Ga0395898_0012587 3300037466 Bacteria 8747
303 Ga0395898_0016336 3300037466 Bacteria 7596
304 Ga0395898_0071368 3300037466 Bacteria 3355
305 Ga0395905_0137150 3300037471 Bacteria 2302
306 Ga0395901_0005524 3300038443 Bacteria 12802
307 Ga0395901_0008237 3300038443 Bacteria 10532
308 Ga0395901_0160247 3300038443 Bacteria 2363
309 Ga0395901_0164499 3300038443 Bacteria 2329
310 Ga0395901_1072145 3300038443 Bacteria 777
311 Ga0439465_0000557 3300041413 Bacteria 11216
312 Ga0439437_003360 3300042000 Bacteria 1726
313 Ga0439445_0013848 3300042004 Bacteria 1956
314 Ga0439449_0000004 3300042007 Bacteria 82454
315 Ga0466969_0161522 3300044656 Bacteria 1029
316 Ga0466982_0000003 3300044672 Bacteria 417243
317 Ga0466966_0001872 3300044684 Bacteria 13651
318 Ga0466961_0001024 3300044693 Bacteria 17286
319 Ga0466963_0012112 3300044694 Bacteria 5271
320 Ga0466971_0002394 3300044719 Bacteria 7920
321 Ga0466971_0042211 3300044719 Bacteria 2049
322 Ga0466970_0065939 3300044765 Bacteria 1943
323 Ga0466957_0053300 3300044842 Bacteria 2465
324 Ga0466960_0001827 3300044901 Bacteria 7823
325 Ga0466958_0007404 3300045836 Bacteria 6037
326 Ga0466967_0030605 3300045976 Bacteria 4519
327 Ga0495638_0000107 3300046460 Bacteria 133008
328 Ga0495638_0000471 3300046460 Bacteria 48459
329 Ga0495650_0000607 3300046471 Bacteria 48960
330 Ga0495606_0000216 3300046507 Bacteria 102891
331 Ga0495625_0010240 3300046660 Bacteria 7775
332 Ga0495588_0123033 3300046674 Bacteria 1368
333 Ga0495613_0267128 3300046689 Unclassified 1190
334 Ga0495649_0000714 3300046694 Bacteria 27064
335 Ga0496101_0229166 3300048904 Bacteria 1444
336 Ga0496106_0228670 3300048909 Bacteria 1485
337 Ga0496113_0007093 3300048916 Bacteria 7174
338 Ga0496114_0067850 3300048917 Bacteria 2993
339 Ga0496115_0000110 3300048918 Bacteria 74992
340 Ga0496115_0000779 3300048918 Bacteria 23352
341 Ga0496115_0292242 3300048918 Bacteria 1336
342 Ga0496121_0017239 3300048924 Bacteria 7394
343 Ga0496125_0000804 3300048928 Bacteria 51187
344 Ga0496126_0015859 3300048929 Bacteria 7567
345 Ga0495678_138990 3300049459 Bacteria 797
346 Ga0495682_0020419 3300049460 Bacteria 2487
347 Ga0501031_0075718 3300049568 Bacteria 2191
348 Ga0501031_0091567 3300049568 Bacteria 1983
349 Ga0501032_0027310 3300049569 Bacteria 3923
350 Ga0501033_0007106 3300049570 Bacteria 8738
351 Ga0501033_0014254 3300049570 Bacteria 6041
352 Ga0501033_0021025 3300049570 Bacteria 4925
353 Ga0501033_0310351 3300049570 Bacteria 1109
354 Ga0501034_0040060 3300049571 Bacteria 4744
355 Ga0501034_0493118 3300049571 Bacteria 1139
356 Ga0501036_0039352 3300049572 Bacteria 4001
357 Ga0501036_0102299 3300049572 Bacteria 2423
358 Ga0501037_0035490 3300049573 Bacteria 3677
359 Ga0501037_0038361 3300049573 Bacteria 3529
360 Ga0501037_0260274 3300049573 Bacteria 1212
361 Ga0501039_0614607 3300049575 Bacteria 852
362 Ga0501042_0212631 3300049578 Bacteria 1395
363 Ga0501043_0015721 3300049579 Bacteria 5933
364 Ga0501043_0029281 3300049579 Bacteria 4325
365 Ga0501043_0168220 3300049579 Bacteria 1711
366 Ga0501046_0098940 3300049580 Bacteria 2239
367 Ga0501047_0032062 3300049581 Bacteria 5070
368 Ga0501047_0049955 3300049581 Bacteria 4038
369 Ga0501047_0090403 3300049581 Bacteria 2938
370 Ga0501047_0298693 3300049581 Bacteria 1453
371 Ga0501047_0503068 3300049581 Bacteria 1038
372 Ga0501048_0012862 3300049582 Bacteria 6217
373 Ga0501070_0171235 3300049586 Bacteria 1788
374 Ga0501070_0221565 3300049586 Bacteria 1551
375 Ga0501225_0004969 3300049705 Bacteria 3928
376 Ga0501035_0003576 3300049822 Bacteria 14852
377 Ga0501035_0024823 3300049822 Bacteria 5496
378 Ga0501035_0083651 3300049822 Bacteria 2815
379 Ga0501035_0288085 3300049822 Bacteria 1386
380 Ga0501035_0364345 3300049822 Bacteria 1207
381 Ga0501044_0025372 3300049823 Bacteria 6282
382 Ga0501044_0046321 3300049823 Bacteria 4503
383 Ga0501044_0123236 3300049823 Bacteria 2591
384 Ga0501044_0357029 3300049823 Bacteria 1380
385 Ga0501044_0422023 3300049823 Bacteria 1244
386 Ga0501044_0495264 3300049823 Bacteria 1124
387 Ga0501044_0814802 3300049823 Bacteria 812
388 Ga0466962_0001998 3300061719 Bacteria 9633
389 Ga0466962_0015750 3300061719 Bacteria 3646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10084688 Ga0157378_100846881 199
2 3300005329 Ga0070683_100241739 Ga0070683_1002417392 209
3 3300005329 Ga0070683_100260020 Ga0070683_1002600203 209
4 3300005344 Ga0070661_100003074 Ga0070661_1000030744 209
5 3300005539 Ga0068853_100000942 Ga0068853_1000009427 209
6 3300005563 Ga0068855_100002423 Ga0068855_1000024233 209
7 3300005563 Ga0068855_100008383 Ga0068855_10000838310 209
8 3300005564 Ga0070664_100852497 Ga0070664_1008524971 209
9 3300005614 Ga0068856_100025763 Ga0068856_1000257634 209
10 3300005616 Ga0068852_100000041 Ga0068852_10000004124 209
11 3300005616 Ga0068852_100001846 Ga0068852_1000018463 209
12 3300009093 Ga0105240_10000251 Ga0105240_1000025166 209
13 3300009093 Ga0105240_10004404 Ga0105240_1000440412 209
14 3300009174 Ga0105241_10006306 Ga0105241_100063067 209
15 3300009545 Ga0105237_10061871 Ga0105237_100618712 209
16 3300009545 Ga0105237_10165489 Ga0105237_101654893 209
17 3300009551 Ga0105238_10000416 Ga0105238_1000041621 209
18 3300010375 Ga0105239_10002494 Ga0105239_1000249422 209
19 3300013104 Ga0157370_10000003 Ga0157370_10000003156 209
20 3300013105 Ga0157369_10000094 Ga0157369_1000009465 209
21 3300013105 Ga0157369_10004756 Ga0157369_100047565 209
22 3300013307 Ga0157372_10000074 Ga0157372_1000007466 209
23 3300013307 Ga0157372_10023047 Ga0157372_100230474 209
24 3300025911 Ga0207654_10000424 Ga0207654_100004243 209
25 3300025913 Ga0207695_10000129 Ga0207695_10000129179 209
26 3300025913 Ga0207695_10001665 Ga0207695_1000166515 209
27 3300025914 Ga0207671_10001550 Ga0207671_1000155022 209
28 3300025924 Ga0207694_10000301 Ga0207694_1000030120 209
29 3300025944 Ga0207661_10174561 Ga0207661_101745612 209
30 3300025949 Ga0207667_10003163 Ga0207667_100031634 209
31 3300025949 Ga0207667_10333157 Ga0207667_103331572 209
32 3300026041 Ga0207639_10000200 Ga0207639_1000020019 209
33 3300026078 Ga0207702_10004670 Ga0207702_1000467011 209
34 3300026142 Ga0207698_10000017 Ga0207698_1000001767 209
35 3300026142 Ga0207698_10002615 Ga0207698_100026155 209
36 3300038443 Ga0395901_1072145 Ga0395901_1072145_30_668 212
37 3300049575 Ga0501039_0614607 Ga0501039_0614607_10_648 212
38 3300005577 Ga0068857_100015480 Ga0068857_1000154802 213
39 3300005614 Ga0068856_100137357 Ga0068856_1001373574 213
40 3300005616 Ga0068852_100059540 Ga0068852_1000595402 213
41 3300025945 Ga0207679_10314025 Ga0207679_103140252 213
42 3300026078 Ga0207702_10084268 Ga0207702_100842684 213
43 3300026116 Ga0207674_10007856 Ga0207674_1000785613 213
44 3300044694 Ga0466963_0012112 Ga0466963_0012112_236_976 213
45 3300045976 Ga0466967_0030605 Ga0466967_0030605_1145_1885 213
46 3300009093 Ga0105240_10001964 Ga0105240_1000196426 214
47 3300009174 Ga0105241_10000098 Ga0105241_1000009833 214
48 3300009177 Ga0105248_10002347 Ga0105248_100023476 214
49 3300009551 Ga0105238_10001618 Ga0105238_100016189 214
50 3300010375 Ga0105239_10006809 Ga0105239_100068099 214
51 3300013297 Ga0157378_10196242 Ga0157378_101962423 214
52 3300025911 Ga0207654_10001029 Ga0207654_100010292 214
53 3300005367 Ga0070667_100613145 Ga0070667_1006131451 216
54 3300005834 Ga0068851_10026507 Ga0068851_100265075 216
55 3300009174 Ga0105241_10417228 Ga0105241_104172282 216
56 3300009177 Ga0105248_10589830 Ga0105248_105898302 216
57 3300009545 Ga0105237_10022153 Ga0105237_100221536 216
58 3300010375 Ga0105239_10767914 Ga0105239_107679142 216
59 3300013297 Ga0157378_10337849 Ga0157378_103378492 216
60 3300013307 Ga0157372_10436492 Ga0157372_104364922 216
61 3300013308 Ga0157375_10020413 Ga0157375_100204132 216
62 3300014968 Ga0157379_10234648 Ga0157379_102346482 216
63 3300025321 Ga0207656_10029278 Ga0207656_100292783 216
64 3300026023 Ga0207677_10563073 Ga0207677_105630732 216
65 3300046689 Ga0495613_0267128 Ga0495613_0267128_244_978 216
66 3300013307 Ga0157372_10022036 Ga0157372_100220366 217
67 iso_pu_bacteria 2928963466 2928965593 217
68 3300005329 Ga0070683_100032923 Ga0070683_1000329234 219
69 3300026142 Ga0207698_10025631 Ga0207698_100256312 219
70 3300005539 Ga0068853_100120600 Ga0068853_1001206004 220
71 3300009551 Ga0105238_10039465 Ga0105238_100394652 220
72 3300013307 Ga0157372_10066367 Ga0157372_100663672 220
73 3300009093 Ga0105240_10018395 Ga0105240_100183955 221
74 3300013296 Ga0157374_10064713 Ga0157374_100647135 221
75 3300025911 Ga0207654_10004538 Ga0207654_100045384 221
76 3300025913 Ga0207695_10000194 Ga0207695_10000194104 221
77 3300025924 Ga0207694_10001712 Ga0207694_100017125 221
78 3300025941 Ga0207711_10003048 Ga0207711_100030486 221
79 3300026067 Ga0207678_10025485 Ga0207678_100254854 221
80 3300048904 Ga0496101_0229166 Ga0496101_0229166_89_775 221
81 3300041413 Ga0439465_0000557 Ga0439465_0000557_10246_10923 225
82 3300042007 Ga0439449_0000004 Ga0439449_0000004_24587_25264 225
83 3300042004 Ga0439445_0013848 Ga0439445_0013848_1034_1741 227
84 3300049705 Ga0501225_0004969 Ga0501225_0004969_725_1432 227
85 3300026116 Ga0207674_10416019 Ga0207674_104160192 229
86 iso_pu_bacteria 2884411467 2884412249 229
87 3300028666 Ga0265336_10007270 Ga0265336_100072702 230
88 3300037312 Ga0395899_0053044 Ga0395899_0053044_807_1499 230
89 3300037312 Ga0395899_0055407 Ga0395899_0055407_1731_2423 230
90 3300037312 Ga0395899_0194793 Ga0395899_0194793_524_1216 230
91 3300037418 Ga0395900_0000377 Ga0395900_0000377_21894_22586 230
92 3300037418 Ga0395900_0000867 Ga0395900_0000867_28151_28843 230
93 3300037466 Ga0395898_0001606 Ga0395898_0001606_19960_20652 230
94 3300037466 Ga0395898_0012587 Ga0395898_0012587_3109_3801 230
95 3300037466 Ga0395898_0016336 Ga0395898_0016336_2118_2810 230
96 3300037466 Ga0395898_0071368 Ga0395898_0071368_2555_3247 230
97 3300037471 Ga0395905_0137150 Ga0395905_0137150_1257_1949 230
98 3300038443 Ga0395901_0005524 Ga0395901_0005524_4025_4717 230
99 3300038443 Ga0395901_0164499 Ga0395901_0164499_365_1057 230
100 3300049569 Ga0501032_0027310 Ga0501032_0027310_2524_3216 230
101 3300049570 Ga0501033_0021025 Ga0501033_0021025_3093_3785 230
102 3300049572 Ga0501036_0039352 Ga0501036_0039352_2863_3555 230
103 3300049573 Ga0501037_0035490 Ga0501037_0035490_1987_2679 230
104 3300049581 Ga0501047_0090403 Ga0501047_0090403_1139_1831 230
105 3300049581 Ga0501047_0298693 Ga0501047_0298693_294_992 230
106 iso_pu_bacteria 2643221685 2644477505 230
107 3300002705 JGI25156J39149_1003884 JGI25156J39149_10038846 231
108 3300002737 JGI25162J39368_1000579 JGI25162J39368_100057913 231
109 3300002738 JGI25154J39366_1008632 JGI25154J39366_10086322 231
110 3300002741 JGI25157J39369_1008033 JGI25157J39369_10080331 231
111 3300002772 JGI25164J39214_1000057 JGI25164J39214_100005736 231
112 3300003214 JGI25165J46597_1000072 JGI25165J46597_1000072176 231
113 3300003215 JGI25153J46596_10021237 JGI25153J46596_100212372 231
114 3300003578 Ga0006562J51391_1189161 Ga0006562J51391_11891617 231
115 3300003578 Ga0006562J51391_1189162 Ga0006562J51391_11891624 231
116 3300003761 Ga0055535_1000547 Ga0055535_100054730 231
117 3300003761 Ga0055535_1003195 Ga0055535_10031951 231
118 3300003762 Ga0055542_1000392 Ga0055542_100039246 231
119 3300003762 Ga0055542_1000487 Ga0055542_10004872 231
120 3300003763 Ga0055529_1000160 Ga0055529_100016053 231
121 3300005455 Ga0070663_100072393 Ga0070663_1000723932 231
122 3300005563 Ga0068855_100012478 Ga0068855_1000124788 231
123 3300005577 Ga0068857_100002972 Ga0068857_10000297210 231
124 3300005578 Ga0068854_100030222 Ga0068854_1000302224 231
125 3300005617 Ga0068859_100389594 Ga0068859_1003895942 231
126 3300005842 Ga0068858_100128730 Ga0068858_1001287302 231
127 3300006931 Ga0097620_100389603 Ga0097620_1003896032 231
128 3300009093 Ga0105240_10007753 Ga0105240_1000775310 231
129 3300009093 Ga0105240_10320426 Ga0105240_103204262 231
130 3300009545 Ga0105237_10002806 Ga0105237_1000280612 231
131 3300009551 Ga0105238_10071895 Ga0105238_100718954 231
132 3300010375 Ga0105239_10018068 Ga0105239_100180687 231
133 3300012500 Ga0157314_1000216 Ga0157314_10002162 231
134 3300013105 Ga0157369_10169675 Ga0157369_101696752 231
135 3300013105 Ga0157369_10240066 Ga0157369_102400662 231
136 3300013307 Ga0157372_10310029 Ga0157372_103100292 231
137 3300025228 Ga0209672_100112 Ga0209672_10011235 231
138 3300025228 Ga0209672_101557 Ga0209672_1015578 231
139 3300025231 Ga0207427_100055 Ga0207427_10005535 231
140 3300025233 Ga0209437_100127 Ga0209437_10012741 231
141 3300025242 Ga0209258_100064 Ga0209258_100064126 231
142 3300025242 Ga0209258_100139 Ga0209258_100139101 231
143 3300025246 Ga0209646_1003225 Ga0209646_10032254 231
144 3300025250 Ga0209026_1006828 Ga0209026_10068282 231
145 3300025254 Ga0209148_1000073 Ga0209148_1000073193 231
146 3300025254 Ga0209148_1000173 Ga0209148_10001731 231
147 3300025256 Ga0209759_1001111 Ga0209759_100111113 231
148 3300025258 Ga0209129_1002145 Ga0209129_10021457 231
149 3300025261 Ga0209233_1000063 Ga0209233_1000063185 231
150 3300025272 Ga0209455_1000018 Ga0209455_1000018536 231
151 3300025272 Ga0209455_1008770 Ga0209455_10087702 231
152 3300025297 Ga0209758_1001158 Ga0209758_100115832 231
153 3300025913 Ga0207695_10001945 Ga0207695_1000194512 231
154 3300025914 Ga0207671_10002198 Ga0207671_1000219810 231
155 3300025949 Ga0207667_10000140 Ga0207667_1000014039 231
156 3300025981 Ga0207640_10000678 Ga0207640_100006786 231
157 3300026067 Ga0207678_10058415 Ga0207678_100584152 231
158 3300026116 Ga0207674_10002999 Ga0207674_1000299910 231
159 3300026142 Ga0207698_10665997 Ga0207698_106659971 231
160 3300037312 Ga0395899_0030652 Ga0395899_0030652_219_914 231
161 3300037466 Ga0395898_0000049 Ga0395898_0000049_106746_107441 231
162 3300044672 Ga0466982_0000003 Ga0466982_0000003_224156_224857 231
163 3300044684 Ga0466966_0001872 Ga0466966_0001872_6072_6773 231
164 3300044693 Ga0466961_0001024 Ga0466961_0001024_6312_7007 231
165 3300044719 Ga0466971_0002394 Ga0466971_0002394_469_1170 231
166 3300044719 Ga0466971_0042211 Ga0466971_0042211_921_1616 231
167 3300044765 Ga0466970_0065939 Ga0466970_0065939_1188_1889 231
168 3300044842 Ga0466957_0053300 Ga0466957_0053300_1731_2426 231
169 3300044901 Ga0466960_0001827 Ga0466960_0001827_1044_1745 231
170 3300045836 Ga0466958_0007404 Ga0466958_0007404_3041_3736 231
171 3300048928 Ga0496125_0000804 Ga0496125_0000804_41059_41754 231
172 3300061719 Ga0466962_0001998 Ga0466962_0001998_8128_8829 231
173 3300061719 Ga0466962_0015750 Ga0466962_0015750_2387_3082 231
174 iso_pu_bacteria 2939611941 2939612598 231
175 3300025225 Ga0209566_101061 Ga0209566_1010617 232
176 3300025256 Ga0209759_1008012 Ga0209759_10080123 232
177 3300002705 JGI25156J39149_1003639 JGI25156J39149_10036396 233
178 3300002738 JGI25154J39366_1008852 JGI25154J39366_10088522 233
179 3300002741 JGI25157J39369_1001907 JGI25157J39369_10019076 233
180 3300003763 Ga0055529_1005412 Ga0055529_10054122 233
181 3300005337 Ga0070682_100002950 Ga0070682_1000029505 233
182 3300005337 Ga0070682_100007071 Ga0070682_1000070716 233
183 3300005339 Ga0070660_100022975 Ga0070660_1000229752 233
184 3300005366 Ga0070659_100000820 Ga0070659_1000008207 233
185 3300005435 Ga0070714_100000030 Ga0070714_10000003061 233
186 3300005455 Ga0070663_100319317 Ga0070663_1003193171 233
187 3300005458 Ga0070681_10032908 Ga0070681_100329084 233
188 3300005466 Ga0070685_10004142 Ga0070685_100041422 233
189 3300005547 Ga0070693_100026186 Ga0070693_1000261861 233
190 3300005563 Ga0068855_100116550 Ga0068855_1001165503 233
191 3300005563 Ga0068855_100123691 Ga0068855_1001236912 233
192 3300005578 Ga0068854_100174169 Ga0068854_1001741691 233
193 3300005614 Ga0068856_100000053 Ga0068856_10000005339 233
194 3300005614 Ga0068856_100021078 Ga0068856_1000210787 233
195 3300009093 Ga0105240_10017916 Ga0105240_100179166 233
196 3300009545 Ga0105237_10000007 Ga0105237_1000000751 233
197 3300009551 Ga0105238_10141075 Ga0105238_101410752 233
198 3300013100 Ga0157373_10047776 Ga0157373_100477763 233
199 3300013104 Ga0157370_10223959 Ga0157370_102239592 233
200 3300013105 Ga0157369_10067772 Ga0157369_100677724 233
201 3300013105 Ga0157369_10655921 Ga0157369_106559211 233
202 3300013307 Ga0157372_10174157 Ga0157372_101741571 233
203 3300020082 Ga0206353_10744876 Ga0206353_107448761 233
204 3300025246 Ga0209646_1002422 Ga0209646_10024224 233
205 3300025250 Ga0209026_1000205 Ga0209026_100020531 233
206 3300025256 Ga0209759_1003474 Ga0209759_10034742 233
207 3300025272 Ga0209455_1000474 Ga0209455_100047421 233
208 3300025912 Ga0207707_10022589 Ga0207707_100225892 233
209 3300025913 Ga0207695_10004570 Ga0207695_100045707 233
210 3300025914 Ga0207671_10000763 Ga0207671_100007637 233
211 3300025919 Ga0207657_10033091 Ga0207657_100330912 233
212 3300025919 Ga0207657_10079254 Ga0207657_100792543 233
213 3300025929 Ga0207664_10000026 Ga0207664_1000002694 233
214 3300025932 Ga0207690_10010666 Ga0207690_100106664 233
215 3300025949 Ga0207667_10047932 Ga0207667_100479322 233
216 3300025949 Ga0207667_10273597 Ga0207667_102735972 233
217 3300025981 Ga0207640_10368994 Ga0207640_103689942 233
218 3300026067 Ga0207678_10022815 Ga0207678_100228152 233
219 3300026078 Ga0207702_10000032 Ga0207702_1000003288 233
220 3300031665 Ga0316575_10022365 Ga0316575_100223652 233
221 3300049568 Ga0501031_0075718 Ga0501031_0075718_867_1604 233
222 3300049568 Ga0501031_0091567 Ga0501031_0091567_1091_1828 233
223 3300049570 Ga0501033_0007106 Ga0501033_0007106_379_1116 233
224 3300049570 Ga0501033_0014254 Ga0501033_0014254_556_1293 233
225 3300049570 Ga0501033_0310351 Ga0501033_0310351_353_1090 233
226 3300049573 Ga0501037_0260274 Ga0501037_0260274_34_771 233
227 3300049578 Ga0501042_0212631 Ga0501042_0212631_32_769 233
228 3300049579 Ga0501043_0015721 Ga0501043_0015721_4484_5221 233
229 3300049579 Ga0501043_0029281 Ga0501043_0029281_366_1103 233
230 3300049580 Ga0501046_0098940 Ga0501046_0098940_546_1283 233
231 3300049581 Ga0501047_0032062 Ga0501047_0032062_4015_4752 233
232 3300049581 Ga0501047_0049955 Ga0501047_0049955_2940_3677 233
233 3300049582 Ga0501048_0012862 Ga0501048_0012862_5288_6025 233
234 3300049586 Ga0501070_0221565 Ga0501070_0221565_361_1098 233
235 3300049822 Ga0501035_0024823 Ga0501035_0024823_2652_3356 233
236 3300049822 Ga0501035_0083651 Ga0501035_0083651_764_1501 233
237 3300049822 Ga0501035_0288085 Ga0501035_0288085_140_877 233
238 3300049822 Ga0501035_0364345 Ga0501035_0364345_438_1175 233
239 3300049823 Ga0501044_0025372 Ga0501044_0025372_3626_4330 233
240 3300049823 Ga0501044_0046321 Ga0501044_0046321_136_840 233
241 3300049823 Ga0501044_0357029 Ga0501044_0357029_185_928 233
242 3300049823 Ga0501044_0495264 Ga0501044_0495264_246_950 233
243 3300049823 Ga0501044_0814802 Ga0501044_0814802_46_750 233
244 3300003752 Ga0055539_1001751 Ga0055539_10017512 234
245 3300003760 Ga0055527_1000031 Ga0055527_100003188 234
246 3300003761 Ga0055535_1000203 Ga0055535_100020362 234
247 3300003762 Ga0055542_1000100 Ga0055542_100010041 234
248 3300003763 Ga0055529_1000073 Ga0055529_100007362 234
249 3300005539 Ga0068853_100016228 Ga0068853_1000162284 234
250 3300005563 Ga0068855_100039903 Ga0068855_1000399032 234
251 3300005577 Ga0068857_100256945 Ga0068857_1002569452 234
252 3300005614 Ga0068856_100005680 Ga0068856_1000056802 234
253 3300009551 Ga0105238_10037538 Ga0105238_100375382 234
254 3300013100 Ga0157373_10096494 Ga0157373_100964942 234
255 3300025226 Ga0209674_101055 Ga0209674_1010555 234
256 3300025228 Ga0209672_100016 Ga0209672_100016226 234
257 3300025242 Ga0209258_100012 Ga0209258_100012367 234
258 3300025250 Ga0209026_1000108 Ga0209026_100010890 234
259 3300025253 Ga0209677_107622 Ga0209677_1076222 234
260 3300025254 Ga0209148_1000014 Ga0209148_1000014288 234
261 3300025256 Ga0209759_1000498 Ga0209759_100049815 234
262 3300025272 Ga0209455_1000014 Ga0209455_1000014176 234
263 3300025949 Ga0207667_10033731 Ga0207667_100337316 234
264 3300026078 Ga0207702_10000204 Ga0207702_1000020446 234
265 3300026078 Ga0207702_10245587 Ga0207702_102455872 234
266 3300026116 Ga0207674_10126646 Ga0207674_101266462 234
267 3300037312 Ga0395899_0000321 Ga0395899_0000321_51261_51965 234
268 3300037418 Ga0395900_0000283 Ga0395900_0000283_19151_19855 234
269 3300037466 Ga0395898_0000018 Ga0395898_0000018_220365_221069 234
270 3300044656 Ga0466969_0161522 Ga0466969_0161522_99_803 234
271 3300049571 Ga0501034_0040060 Ga0501034_0040060_658_1392 234
272 3300049571 Ga0501034_0493118 Ga0501034_0493118_37_771 234
273 3300049572 Ga0501036_0102299 Ga0501036_0102299_1574_2308 234
274 3300049573 Ga0501037_0038361 Ga0501037_0038361_164_898 234
275 3300049579 Ga0501043_0168220 Ga0501043_0168220_456_1190 234
276 3300049586 Ga0501070_0171235 Ga0501070_0171235_728_1462 234
277 3300049822 Ga0501035_0003576 Ga0501035_0003576_6388_7122 234
278 3300049823 Ga0501044_0123236 Ga0501044_0123236_888_1622 234
279 iso_pu_bacteria 2739367700 2739730164 234
280 3300002737 JGI25162J39368_1002933 JGI25162J39368_10029332 235
281 3300002772 JGI25164J39214_1000390 JGI25164J39214_10003904 235
282 3300002772 JGI25164J39214_1000782 JGI25164J39214_10007822 235
283 3300003214 JGI25165J46597_1000725 JGI25165J46597_10007254 235
284 3300005436 Ga0070713_100000235 Ga0070713_10000023525 235
285 3300005539 Ga0068853_100697045 Ga0068853_1006970452 235
286 3300005578 Ga0068854_100071393 Ga0068854_1000713932 235
287 3300009545 Ga0105237_10115516 Ga0105237_101155162 235
288 3300009551 Ga0105238_10007508 Ga0105238_100075084 235
289 3300009551 Ga0105238_10203092 Ga0105238_102030922 235
290 3300010375 Ga0105239_10181416 Ga0105239_101814162 235
291 3300013102 Ga0157371_10086170 Ga0157371_100861703 235
292 3300013104 Ga0157370_10000662 Ga0157370_100006626 235
293 3300013104 Ga0157370_10004578 Ga0157370_100045784 235
294 3300013104 Ga0157370_10084921 Ga0157370_100849212 235
295 3300013105 Ga0157369_10387579 Ga0157369_103875791 235
296 3300013307 Ga0157372_10231717 Ga0157372_102317172 235
297 3300013307 Ga0157372_10243998 Ga0157372_102439983 235
298 3300014497 Ga0182008_10025563 Ga0182008_100255632 235
299 3300015262 Ga0182007_10036741 Ga0182007_100367412 235
300 3300025231 Ga0207427_100118 Ga0207427_10011865 235
301 3300025231 Ga0207427_100120 Ga0207427_10012036 235
302 3300025233 Ga0209437_100020 Ga0209437_100020479 235
303 3300025233 Ga0209437_100231 Ga0209437_10023123 235
304 3300025250 Ga0209026_1000037 Ga0209026_1000037201 235
305 3300025256 Ga0209759_1005023 Ga0209759_10050232 235
306 3300025261 Ga0209233_1000020 Ga0209233_1000020147 235
307 3300025261 Ga0209233_1000147 Ga0209233_1000147119 235
308 3300025898 Ga0207692_10163990 Ga0207692_101639901 235
309 3300025915 Ga0207693_10107116 Ga0207693_101071162 235
310 3300025919 Ga0207657_10015424 Ga0207657_100154247 235
311 3300025928 Ga0207700_10032590 Ga0207700_100325902 235
312 3300025932 Ga0207690_10072069 Ga0207690_100720692 235
313 3300025933 Ga0207706_10105795 Ga0207706_101057952 235
314 3300025981 Ga0207640_10059159 Ga0207640_100591592 235
315 3300026116 Ga0207674_10187148 Ga0207674_101871483 235
316 3300038443 Ga0395901_0008237 Ga0395901_0008237_1112_1849 235
317 3300038443 Ga0395901_0160247 Ga0395901_0160247_500_1237 235
318 3300042000 Ga0439437_003360 Ga0439437_003360_686_1423 235
319 3300046674 Ga0495588_0123033 Ga0495588_0123033_543_1280 235
320 3300049581 Ga0501047_0503068 Ga0501047_0503068_235_942 235
321 3300049823 Ga0501044_0422023 Ga0501044_0422023_450_1157 235
322 3300001989 JGI24739J22299_10004343 JGI24739J22299_100043431 238
323 3300002705 JGI25156J39149_1004132 JGI25156J39149_10041323 238
324 3300002737 JGI25162J39368_1000312 JGI25162J39368_100031216 238
325 3300002737 JGI25162J39368_1002648 JGI25162J39368_10026487 238
326 3300002741 JGI25157J39369_1000191 JGI25157J39369_100019119 238
327 3300002771 JGI25163J39215_1000093 JGI25163J39215_100009310 238
328 3300002772 JGI25164J39214_1000140 JGI25164J39214_100014020 238
329 3300003214 JGI25165J46597_1000261 JGI25165J46597_100026140 238
330 3300003751 Ga0055538_1000938 Ga0055538_10009386 238
331 3300003756 Ga0055533_1000524 Ga0055533_10005246 238
332 3300003761 Ga0055535_1000171 Ga0055535_100017140 238
333 3300003761 Ga0055535_1007655 Ga0055535_10076552 238
334 3300003762 Ga0055542_1000400 Ga0055542_100040016 238
335 3300003762 Ga0055542_1000461 Ga0055542_100046118 238
336 3300003763 Ga0055529_1000260 Ga0055529_100026035 238
337 3300005327 Ga0070658_10117832 Ga0070658_101178322 238
338 3300005336 Ga0070680_100041833 Ga0070680_1000418335 238
339 3300005340 Ga0070689_100002527 Ga0070689_1000025272 238
340 3300005455 Ga0070663_100029555 Ga0070663_1000295554 238
341 3300005455 Ga0070663_100171828 Ga0070663_1001718282 238
342 3300005530 Ga0070679_100024363 Ga0070679_1000243635 238
343 3300005546 Ga0070696_100002365 Ga0070696_1000023658 238
344 3300005844 Ga0068862_100017991 Ga0068862_1000179915 238
345 3300013105 Ga0157369_10281670 Ga0157369_102816702 238
346 3300015687 Ga0183368_1003 Ga0183368_1003628 238
347 3300025207 Ga0209760_100364 Ga0209760_1003649 238
348 3300025224 Ga0209784_100011 Ga0209784_10001173 238
349 3300025226 Ga0209674_100012 Ga0209674_100012378 238
350 3300025228 Ga0209672_100325 Ga0209672_10032520 238
351 3300025228 Ga0209672_104059 Ga0209672_1040593 238
352 3300025231 Ga0207427_100019 Ga0207427_100019471 238
353 3300025231 Ga0207427_103070 Ga0207427_1030702 238
354 3300025233 Ga0209437_100054 Ga0209437_10005440 238
355 3300025233 Ga0209437_100362 Ga0209437_10036234 238
356 3300025242 Ga0209258_100216 Ga0209258_10021659 238
357 3300025242 Ga0209258_100642 Ga0209258_10064216 238
358 3300025242 Ga0209258_101424 Ga0209258_1014246 238
359 3300025246 Ga0209646_1000381 Ga0209646_10003819 238
360 3300025250 Ga0209026_1000146 Ga0209026_100014640 238
361 3300025250 Ga0209026_1001988 Ga0209026_10019884 238
362 3300025254 Ga0209148_1000001 Ga0209148_10000011212 238
363 3300025254 Ga0209148_1000005 Ga0209148_10000051087 238
364 3300025256 Ga0209759_1000418 Ga0209759_100041823 238
365 3300025261 Ga0209233_1000002 Ga0209233_10000021018 238
366 3300025272 Ga0209455_1000019 Ga0209455_1000019541 238
367 3300025272 Ga0209455_1002769 Ga0209455_10027694 238
368 3300025904 Ga0207647_10006620 Ga0207647_100066204 238
369 3300025909 Ga0207705_10166549 Ga0207705_101665492 238
370 3300025912 Ga0207707_10049326 Ga0207707_100493262 238
371 3300025917 Ga0207660_10030107 Ga0207660_100301075 238
372 3300025921 Ga0207652_10027959 Ga0207652_100279592 238
373 3300025924 Ga0207694_10049891 Ga0207694_100498912 238
374 3300025929 Ga0207664_10000841 Ga0207664_1000084118 238
375 3300025936 Ga0207670_10001131 Ga0207670_1000113110 238
376 3300025944 Ga0207661_10562608 Ga0207661_105626081 238
377 3300026067 Ga0207678_10010210 Ga0207678_100102108 238
378 3300026067 Ga0207678_10151450 Ga0207678_101514502 238
379 3300046460 Ga0495638_0000107 Ga0495638_0000107_62083_62811 238
380 3300046460 Ga0495638_0000471 Ga0495638_0000471_26063_26800 238
381 3300046471 Ga0495650_0000607 Ga0495650_0000607_21541_22278 238
382 3300046507 Ga0495606_0000216 Ga0495606_0000216_97685_98413 238
383 3300046660 Ga0495625_0010240 Ga0495625_0010240_75_803 238
384 3300046694 Ga0495649_0000714 Ga0495649_0000714_6981_7709 238
385 3300048909 Ga0496106_0228670 Ga0496106_0228670_633_1370 238
386 3300048916 Ga0496113_0007093 Ga0496113_0007093_5889_6605 238
387 3300048917 Ga0496114_0067850 Ga0496114_0067850_50_787 238
388 3300048918 Ga0496115_0000110 Ga0496115_0000110_17346_18062 238
389 3300048918 Ga0496115_0000779 Ga0496115_0000779_21791_22519 238
390 3300048918 Ga0496115_0292242 Ga0496115_0292242_525_1253 238
391 3300048924 Ga0496121_0017239 Ga0496121_0017239_2896_3633 238
392 3300048929 Ga0496126_0015859 Ga0496126_0015859_4728_5456 238
393 3300049459 Ga0495678_138990 Ga0495678_138990_55_783 238
394 3300049460 Ga0495682_0020419 Ga0495682_0020419_1696_2424 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

33

259

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uax-assembly1.cif.gz_A the crystal structure of the k36a/k38a double mutant of e. coli yggs in complex with plp 0.9538 11 230
1w8g-assembly1.cif.gz_A crystal structure of e. coli k-12 yggs 0.9516 11 231
7uat-assembly1.cif.gz_A the crystal structure of the k36a mutant of e. coli yggs in complex with plp 0.9509 11 231
7ubp-assembly1.cif.gz_A the crystal structure of the k36a/k137a double mutant of e. coli yggs in complex with plp 0.9505 11 231
7ub8-assembly2.cif.gz_B the crystal structure of the k38a/k137a/k233a/k234a quadruple mutant of e. coli yggs in complex with plp 0.9484 11 230
ID Description Score Start End Superfamily
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9516 11 231 3.20.20.10
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9272 11 231 3.20.20.10
5nm8B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9224 11 230 3.20.20.10
5nm8B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.914 11 230 3.20.20.10
3r79B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9135 11 232 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A2Z6E3Q4-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9927 8 232 GO:0030170
AF-A0A4R3YT01-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9923 8 232 GO:0030170
AF-A0A1U9K2U1-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9876 14 232 GO:0030170
AF-A0A2R4XMH8-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9852 11 232 GO:0030170
AF-A0A7C6XQ77-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.9836 11 193 GO:0030170

Feature Viewer

pLDDT pTM Quality
94.47 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map