F432824

General Info

Members Datasets Scaffolds Average Seq Length
394 231 788 201

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100198894|Ga0070713_1001988942
Length 238
Sequence VVWLAVVFGQFTQLVSEASGWAYGIVFLLAYLDVLVPVVPSEASVITAGVVASAGGLYLPLIIVAAACGAFLGDNTAYLVGRRFGTRATKRFLRGGKAQRTLDWAERQLTRRGGELIVVSRFIPGGRTAVTLAAGTLRFPWRRFAVFDALAALIWALYASLLGYFGGRAFENEAWKGLLLAFGLAFAVTGGVEVVRWFLGRRPGRPAPGAASXXPQAAEAARSPDGRGQDPADGRPAG

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
146 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
147 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
148 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
151 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
152 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
153 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.94
Rhizosphere 85.79
Stem 0
Stem Tuber 0
Unclassified 6.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100198894 3300005436 Bacteria 1809
2 JGI24751J29686_10063053 3300002459 Bacteria 763
3 Ga0070658_10000656 3300005327 Bacteria 29868
4 Ga0070658_10054918 3300005327 Bacteria 3235
5 Ga0070658_10313870 3300005327 Bacteria 1338
6 Ga0070676_10042420 3300005328 Bacteria 2641
7 Ga0070683_100001486 3300005329 Bacteria 18080
8 Ga0070683_100055884 3300005329 Bacteria 3664
9 Ga0070683_100243113 3300005329 Bacteria 1712
10 Ga0070670_100005072 3300005331 Bacteria 11075
11 Ga0070670_100006448 3300005331 Bacteria 9935
12 Ga0068869_100147739 3300005334 Bacteria 1820
13 Ga0070680_100114789 3300005336 Bacteria 2244
14 Ga0070680_100120339 3300005336 Unclassified 2191
15 Ga0070680_100139563 3300005336 Bacteria 2032
16 Ga0070682_100270743 3300005337 Bacteria 1234
17 Ga0068868_100479260 3300005338 Bacteria 1086
18 Ga0070660_100024307 3300005339 Bacteria 4495
19 Ga0070660_100165093 3300005339 Bacteria 1786
20 Ga0070689_100445465 3300005340 Bacteria 1101
21 Ga0070661_100740636 3300005344 Bacteria 803
22 Ga0070668_100529037 3300005347 Bacteria 1024
23 Ga0070675_100430917 3300005354 Bacteria 1180
24 Ga0070671_100119601 3300005355 Bacteria 2216
25 Ga0070671_100194691 3300005355 Bacteria 1718
26 Ga0070674_100009843 3300005356 Bacteria 5749
27 Ga0070674_100025971 3300005356 Bacteria 3819
28 Ga0070674_100260070 3300005356 Bacteria 1367
29 Ga0070674_100270027 3300005356 Bacteria 1344
30 Ga0070673_100756905 3300005364 Unclassified 895
31 Ga0070688_100229490 3300005365 Bacteria 1312
32 Ga0070709_10050799 3300005434 Unclassified 2599
33 Ga0070713_100420205 3300005436 Bacteria 1251
34 Ga0070713_100844938 3300005436 Bacteria 879
35 Ga0070701_10058403 3300005438 Bacteria 2025
36 Ga0070701_10272659 3300005438 Bacteria 1030
37 Ga0070711_100035396 3300005439 Bacteria 3338
38 Ga0070700_100168038 3300005441 Bacteria 1517
39 Ga0070694_100420606 3300005444 Bacteria 1050
40 Ga0070678_100063650 3300005456 Bacteria 2730
41 Ga0070678_100137188 3300005456 Bacteria 1952
42 Ga0070662_100009362 3300005457 Bacteria 6403
43 Ga0070662_100420713 3300005457 Bacteria 1105
44 Ga0070681_10003938 3300005458 Bacteria 13996
45 Ga0070681_10469706 3300005458 Bacteria 1170
46 Ga0068867_100057330 3300005459 Bacteria 2885
47 Ga0068867_100180747 3300005459 Bacteria 1677
48 Ga0068867_100666265 3300005459 Bacteria 915
49 Ga0070685_10059638 3300005466 Bacteria 2228
50 Ga0070685_10109073 3300005466 Unclassified 1702
51 Ga0070706_100032291 3300005467 Bacteria 4828
52 Ga0070698_100008016 3300005471 Bacteria 11422
53 Ga0070699_100131100 3300005518 Bacteria 2210
54 Ga0070699_100153887 3300005518 Bacteria 2035
55 Ga0070679_100004275 3300005530 Bacteria 13175
56 Ga0070679_100045326 3300005530 Bacteria 4382
57 Ga0070679_100068771 3300005530 Bacteria 3532
58 Ga0070679_100201337 3300005530 Bacteria 1957
59 Ga0070679_100379532 3300005530 Bacteria 1360
60 Ga0070684_100001004 3300005535 Bacteria 20097
61 Ga0070684_100040552 3300005535 Bacteria 4010
62 Ga0070686_100018889 3300005544 Bacteria 4054
63 Ga0070686_100476769 3300005544 Bacteria 964
64 Ga0070695_100778566 3300005545 Bacteria 765
65 Ga0070696_100836003 3300005546 Bacteria 760
66 Ga0070693_100003025 3300005547 Bacteria 7791
67 Ga0070665_100140502 3300005548 Bacteria 2418
68 Ga0070704_100124564 3300005549 Bacteria 1986
69 Ga0070704_100199917 3300005549 Bacteria 1613
70 Ga0068855_101463651 3300005563 Unclassified 702
71 Ga0068857_100022365 3300005577 Bacteria 5563
72 Ga0068857_100588747 3300005577 Bacteria 1051
73 Ga0068854_100303676 3300005578 Bacteria 1292
74 Ga0068856_100130594 3300005614 Bacteria 2516
75 Ga0070702_100129892 3300005615 Bacteria 1589
76 Ga0070702_100340322 3300005615 Unclassified 1053
77 Ga0068859_100136277 3300005617 Bacteria 2528
78 Ga0068864_100018319 3300005618 Bacteria 5848
79 Ga0068866_10304028 3300005718 Bacteria 997
80 Ga0068861_100002628 3300005719 Bacteria 11743
81 Ga0068870_10007576 3300005840 Bacteria 4849
82 Ga0081455_10527039 3300005937 Bacteria 787
83 Ga0070717_10025875 3300006028 Bacteria 4676
84 Ga0070717_10125850 3300006028 Bacteria 2200
85 Ga0070715_10043303 3300006163 Bacteria 1897
86 Ga0070716_100166284 3300006173 Bacteria 1435
87 Ga0070712_100093796 3300006175 Bacteria 2204
88 Ga0097621_100131679 3300006237 Bacteria 2130
89 Ga0075428_100200506 3300006844 Unclassified 2157
90 Ga0075428_100238845 3300006844 Bacteria 1961
91 Ga0075430_100238516 3300006846 Bacteria 1507
92 Ga0075431_100131646 3300006847 Bacteria 2579
93 Ga0075433_10535763 3300006852 Bacteria 1030
94 Ga0075434_100364503 3300006871 Bacteria 1466
95 Ga0068865_100037188 3300006881 Bacteria 3286
96 Ga0068865_100075513 3300006881 Bacteria 2403
97 Ga0097620_100136274 3300006931 Bacteria 2528
98 Ga0075435_100341050 3300007076 Bacteria 1284
99 Ga0111539_10077897 3300009094 Bacteria 3901
100 Ga0111539_11005904 3300009094 Unclassified 969
101 Ga0105245_10003898 3300009098 Bacteria 13261
102 Ga0105245_10102606 3300009098 Bacteria 2649
103 Ga0105245_10118513 3300009098 Bacteria 2470
104 Ga0105245_10195547 3300009098 Bacteria 1940
105 Ga0105245_10328151 3300009098 Bacteria 1509
106 Ga0114129_10156356 3300009147 Bacteria 3117
107 Ga0114129_10250223 3300009147 Bacteria 2379
108 Ga0114129_10500005 3300009147 Bacteria 1588
109 Ga0105243_10071986 3300009148 Bacteria 2797
110 Ga0105243_10072975 3300009148 Bacteria 2779
111 Ga0105243_10222022 3300009148 Bacteria 1671
112 Ga0105243_10620420 3300009148 Bacteria 1044
113 Ga0105241_10142960 3300009174 Bacteria 1950
114 Ga0105242_10017423 3300009176 Bacteria 5599
115 Ga0105242_10022185 3300009176 Bacteria 4990
116 Ga0105242_10034326 3300009176 Bacteria 4066
117 Ga0105242_10104362 3300009176 Bacteria 2406
118 Ga0105242_10257871 3300009176 Bacteria 1574
119 Ga0105248_10162977 3300009177 Bacteria 2514
120 Ga0105237_10284472 3300009545 Bacteria 1656
121 Ga0105249_10028478 3300009553 Bacteria 5042
122 Ga0105249_10176588 3300009553 Bacteria 2075
123 Ga0105249_10393102 3300009553 Bacteria 1415
124 Ga0105249_10477249 3300009553 Bacteria 1289
125 Ga0105239_10040841 3300010375 Bacteria 5083
126 Ga0105239_10459445 3300010375 Bacteria 1445
127 Ga0105239_10872781 3300010375 Bacteria 1032
128 Ga0105246_10033369 3300011119 Bacteria 3421
129 Ga0105246_10058139 3300011119 Bacteria 2678
130 Ga0157370_10960597 3300013104 Bacteria 774
131 Ga0157374_10295509 3300013296 Bacteria 1602
132 Ga0157374_10619314 3300013296 Bacteria 1093
133 Ga0157378_10265645 3300013297 Bacteria 1648
134 Ga0163162_10079016 3300013306 Bacteria 3356
135 Ga0163162_10308172 3300013306 Bacteria 1715
136 Ga0163162_11200921 3300013306 Unclassified 861
137 Ga0157372_10440501 3300013307 Bacteria 1519
138 Ga0157375_10182561 3300013308 Bacteria 2250
139 Ga0157375_10252410 3300013308 Bacteria 1925
140 Ga0163163_10063106 3300014325 Bacteria 3672
141 Ga0163163_10211376 3300014325 Bacteria 1989
142 Ga0157380_11418708 3300014326 Bacteria 745
143 Ga0157377_10069343 3300014745 Bacteria 2034
144 Ga0157379_10288892 3300014968 Bacteria 1493
145 Ga0157376_10092829 3300014969 Bacteria 2618
146 Ga0157376_10843574 3300014969 Unclassified 931
147 Ga0163161_10017252 3300017792 Bacteria 5051
148 Ga0207692_10129221 3300025898 Bacteria 1424
149 Ga0207688_10018869 3300025901 Bacteria 3751
150 Ga0207688_10099269 3300025901 Bacteria 1680
151 Ga0207685_10070277 3300025905 Bacteria 1416
152 Ga0207699_10011614 3300025906 Bacteria 4455
153 Ga0207645_10036644 3300025907 Bacteria 3150
154 Ga0207643_10001636 3300025908 Bacteria 12604
155 Ga0207643_10020515 3300025908 Bacteria 3627
156 Ga0207705_10003692 3300025909 Bacteria 11648
157 Ga0207705_10134874 3300025909 Bacteria 1840
158 Ga0207705_10261862 3300025909 Bacteria 1320
159 Ga0207654_10019411 3300025911 Bacteria 3587
160 Ga0207707_10002322 3300025912 Bacteria 17126
161 Ga0207707_10277689 3300025912 Bacteria 1451
162 Ga0207693_10056477 3300025915 Bacteria 3077
163 Ga0207693_10456244 3300025915 Bacteria 999
164 Ga0207663_10039731 3300025916 Bacteria 2853
165 Ga0207660_10111431 3300025917 Bacteria 2060
166 Ga0207660_10144836 3300025917 Bacteria 1820
167 Ga0207660_10657052 3300025917 Bacteria 855
168 Ga0207657_10024920 3300025919 Bacteria 5527
169 Ga0207657_10123120 3300025919 Unclassified 2132
170 Ga0207649_10060813 3300025920 Bacteria 2375
171 Ga0207652_10024174 3300025921 Bacteria 5039
172 Ga0207652_10051732 3300025921 Bacteria 3523
173 Ga0207652_10079952 3300025921 Bacteria 2857
174 Ga0207652_10331597 3300025921 Bacteria 1374
175 Ga0207650_10014300 3300025925 Bacteria 5514
176 Ga0207650_10101472 3300025925 Bacteria 2216
177 Ga0207687_10043354 3300025927 Bacteria 3100
178 Ga0207687_10513290 3300025927 Bacteria 1002
179 Ga0207700_10293589 3300025928 Bacteria 1402
180 Ga0207644_10094475 3300025931 Bacteria 2234
181 Ga0207644_10746771 3300025931 Bacteria 817
182 Ga0207690_10143259 3300025932 Bacteria 1764
183 Ga0207706_10010525 3300025933 Bacteria 8452
184 Ga0207706_10403792 3300025933 Bacteria 1184
185 Ga0207706_10555085 3300025933 Bacteria 989
186 Ga0207706_10730359 3300025933 Bacteria 845
187 Ga0207686_10003756 3300025934 Bacteria 8149
188 Ga0207686_10171644 3300025934 Bacteria 1530
189 Ga0207686_10194276 3300025934 Bacteria 1449
190 Ga0207686_10220791 3300025934 Bacteria 1368
191 Ga0207686_10418379 3300025934 Bacteria 1024
192 Ga0207686_10715163 3300025934 Bacteria 797
193 Ga0207709_10039586 3300025935 Bacteria 2816
194 Ga0207709_10040437 3300025935 Bacteria 2791
195 Ga0207709_10051707 3300025935 Bacteria 2519
196 Ga0207709_10180915 3300025935 Bacteria 1489
197 Ga0207670_10141428 3300025936 Bacteria 1775
198 Ga0207669_10043742 3300025937 Bacteria 2625
199 Ga0207665_10210718 3300025939 Bacteria 1419
200 Ga0207691_10324150 3300025940 Bacteria 1320
201 Ga0207691_10495559 3300025940 Bacteria 1038
202 Ga0207711_10174094 3300025941 Bacteria 1954
203 Ga0207689_10984733 3300025942 Bacteria 711
204 Ga0207661_10000318 3300025944 Bacteria 30718
205 Ga0207661_10300323 3300025944 Bacteria 1439
206 Ga0207679_10527858 3300025945 Bacteria 1056
207 Ga0207667_10061571 3300025949 Bacteria 3926
208 Ga0207712_10004746 3300025961 Bacteria 8594
209 Ga0207712_10431355 3300025961 Bacteria 1114
210 Ga0207668_10073306 3300025972 Bacteria 2453
211 Ga0207668_10650443 3300025972 Bacteria 923
212 Ga0207640_10144918 3300025981 Bacteria 1737
213 Ga0207677_10248463 3300026023 Bacteria 1443
214 Ga0207677_10736378 3300026023 Bacteria 878
215 Ga0207708_10005699 3300026075 Bacteria 9205
216 Ga0207702_10012300 3300026078 Bacteria 7123
217 Ga0207702_10343587 3300026078 Bacteria 1426
218 Ga0207641_11201360 3300026088 Unclassified 758
219 Ga0207648_10051004 3300026089 Bacteria 3617
220 Ga0207648_10310172 3300026089 Bacteria 1416
221 Ga0207676_10026117 3300026095 Bacteria 4341
222 Ga0207676_10279520 3300026095 Bacteria 1515
223 Ga0207674_10022026 3300026116 Bacteria 6853
224 Ga0207674_10396923 3300026116 Bacteria 1333
225 Ga0207675_100003335 3300026118 Bacteria 15717
226 Ga0207683_10009998 3300026121 Bacteria 8095
227 Ga0207683_10017408 3300026121 Bacteria 6125
228 Ga0207683_10022853 3300026121 Bacteria 5372
229 Ga0207683_10102043 3300026121 Bacteria 2562
230 Ga0268266_10020810 3300028379 Bacteria 5595
231 Ga0373944_0070868 3300035089 Bacteria 1135
232 Ga0373945_0092274 3300035116 Bacteria 1174
233 Ga0373943_0157992 3300035170 Bacteria 1232
234 Ga0373943_0254934 3300035170 Bacteria 986
235 Ga0373927_0056405 3300035695 Bacteria 2540
236 Ga0373933_0178238 3300035724 Bacteria 1355
237 Ga0373947_0023283 3300035725 Bacteria 3601
238 Ga0373925_0027986 3300037068 Bacteria 4128
239 Ga0373925_0452227 3300037068 Bacteria 1052
240 Ga0395899_0003127 3300037312 Bacteria 13183
241 Ga0395900_0005040 3300037418 Bacteria 13865
242 Ga0395900_0005204 3300037418 Bacteria 13654
243 Ga0395900_0055300 3300037418 Bacteria 4087
244 Ga0395900_0365845 3300037418 Bacteria 1413
245 Ga0395900_0564285 3300037418 Unclassified 1082
246 Ga0395898_0004187 3300037466 Bacteria 15804
247 Ga0395898_0007784 3300037466 Bacteria 11372
248 Ga0395898_0049359 3300037466 Unclassified 4123
249 Ga0395905_0044900 3300037471 Unclassified 4145
250 Ga0395905_0293809 3300037471 Unclassified 1512
251 Ga0395901_0000500 3300038443 Bacteria 45375
252 Ga0395901_0017850 3300038443 Bacteria 7242
253 Ga0395901_0019211 3300038443 Bacteria 6986
254 Ga0395901_0034442 3300038443 Bacteria 5230
255 Ga0395901_0093823 3300038443 Unclassified 3143
256 Ga0395901_0235297 3300038443 Bacteria 1912
257 Ga0395901_0702874 3300038443 Unclassified 1008
258 Ga0395901_0924159 3300038443 Bacteria 853
259 Ga0242420_036635 3300038996 Bacteria 927
260 Ga0451789_0122936 3300041443 Bacteria 2429
261 Ga0451793_0459803 3300041452 Bacteria 1156
262 Ga0451804_0227465 3300041463 Unclassified 2186
263 Ga0451807_0757165 3300041486 Bacteria 854
264 Ga0451835_1012293 3300041492 Bacteria 1451
265 Ga0451839_0111960 3300041496 Bacteria 2855
266 Ga0451841_0378742 3300041498 Bacteria 1066
267 Ga0451851_0915057 3300041507 Unclassified 1427
268 Ga0451853_3843695 3300041512 Unclassified 818
269 Ga0450920_020751 3300042122 Bacteria 1267
270 Ga0466963_0049467 3300044694 Bacteria 2780
271 Ga0466958_0094382 3300045836 Unclassified 1854
272 Ga0495592_0169187 3300046454 Bacteria 1498
273 Ga0495603_0015735 3300046455 Bacteria 4575
274 Ga0495603_0019003 3300046455 Bacteria 4160
275 Ga0495603_0131497 3300046455 Unclassified 1457
276 Ga0495603_0192570 3300046455 Bacteria 1179
277 Ga0495629_0022368 3300046459 Bacteria 4508
278 Ga0495641_0065213 3300046461 Bacteria 1639
279 Ga0495641_0251311 3300046461 Unclassified 795
280 Ga0495651_0154899 3300046462 Bacteria 1648
281 Ga0495582_0011172 3300046473 Bacteria 4946
282 Ga0495582_0041054 3300046473 Bacteria 2549
283 Ga0495582_0172082 3300046473 Bacteria 1233
284 Ga0495639_0134874 3300046475 Bacteria 1184
285 Ga0495662_0016783 3300046476 Bacteria 3545
286 Ga0495664_0015647 3300046477 Bacteria 4315
287 Ga0495585_0435679 3300046492 Bacteria 628
288 Ga0495607_0248806 3300046501 Bacteria 857
289 Ga0495616_0118767 3300046513 Bacteria 1223
290 Ga0495618_0428183 3300046514 Bacteria 806
291 Ga0495628_0180722 3300046516 Bacteria 1596
292 Ga0495630_0058498 3300046517 Bacteria 2890
293 Ga0495637_0075438 3300046520 Bacteria 1353
294 Ga0495644_0092350 3300046523 Bacteria 1143
295 Ga0495644_0107289 3300046523 Bacteria 1059
296 Ga0495665_0051380 3300046531 Bacteria 2183
297 Ga0495665_0359523 3300046531 Bacteria 741
298 Ga0495640_0040190 3300046533 Bacteria 3276
299 Ga0495640_0453847 3300046533 Bacteria 783
300 Ga0495586_0028417 3300046535 Bacteria 2993
301 Ga0495586_0160380 3300046535 Bacteria 1268
302 Ga0495645_0472798 3300046543 Bacteria 787
303 Ga0495634_0035755 3300046642 Bacteria 3399
304 Ga0495635_0140202 3300046663 Bacteria 1647
305 Ga0495588_0226444 3300046674 Bacteria 987
306 Ga0495599_0136147 3300046678 Bacteria 1525
307 Ga0495647_0034705 3300046681 Bacteria 1890
308 Ga0495613_0008242 3300046689 Bacteria 7735
309 Ga0495624_0136170 3300046690 Bacteria 1505
310 Ga0495624_0341304 3300046690 Bacteria 901
311 Ga0495649_0361145 3300046694 Bacteria 733
312 Ga0495589_0131819 3300046794 Bacteria 1200
313 Ga0495581_0001842 3300047315 Bacteria 11856
314 Ga0495636_0031546 3300047318 Bacteria 2173
315 Ga0495674_0018456 3300047319 Bacteria 6491
316 Ga0495676_0011400 3300047321 Bacteria 8024
317 Ga0495676_0021650 3300047321 Bacteria 5609
318 Ga0495676_0037041 3300047321 Bacteria 4066
319 Ga0495684_0132751 3300047471 Bacteria 1869
320 Ga0496100_0034154 3300048903 Bacteria 3189
321 Ga0496100_0062843 3300048903 Bacteria 2452
322 Ga0496100_0191079 3300048903 Bacteria 1486
323 Ga0496101_0001540 3300048904 Bacteria 13812
324 Ga0496101_0035677 3300048904 Bacteria 3519
325 Ga0496101_0179162 3300048904 Bacteria 1631
326 Ga0496102_0022801 3300048905 Bacteria 5550
327 Ga0496102_0212513 3300048905 Bacteria 1824
328 Ga0496103_0037147 3300048906 Bacteria 2984
329 Ga0496104_0000432 3300048907 Bacteria 36339
330 Ga0496104_0011588 3300048907 Bacteria 7902
331 Ga0496104_0015748 3300048907 Bacteria 6858
332 Ga0496104_0061217 3300048907 Bacteria 3568
333 Ga0496105_0000348 3300048908 Bacteria 30485
334 Ga0496105_0000687 3300048908 Bacteria 22781
335 Ga0496105_0129508 3300048908 Bacteria 2081
336 Ga0496106_0118853 3300048909 Bacteria 2064
337 Ga0496106_0204084 3300048909 Bacteria 1574
338 Ga0496107_0009866 3300048910 Bacteria 6621
339 Ga0496107_0019789 3300048910 Bacteria 4752
340 Ga0496107_0107474 3300048910 Bacteria 2049
341 Ga0496108_0003626 3300048911 Bacteria 12373
342 Ga0496108_0005047 3300048911 Bacteria 10662
343 Ga0496108_0931564 3300048911 Bacteria 744
344 Ga0496109_0023213 3300048912 Bacteria 5504
345 Ga0496109_0229934 3300048912 Bacteria 1744
346 Ga0496110_0000826 3300048913 Bacteria 21737
347 Ga0496110_0000944 3300048913 Bacteria 20341
348 Ga0496110_0025713 3300048913 Bacteria 5033
349 Ga0496110_0036589 3300048913 Bacteria 4263
350 Ga0496110_0217309 3300048913 Bacteria 1738
351 Ga0496110_0970289 3300048913 Bacteria 757
352 Ga0496111_0000045 3300048914 Bacteria 48903
353 Ga0496111_0000277 3300048914 Bacteria 24931
354 Ga0496111_0009492 3300048914 Bacteria 6497
355 Ga0496111_0151604 3300048914 Bacteria 1719
356 Ga0496112_0144115 3300048915 Bacteria 2351
357 Ga0496112_0588607 3300048915 Bacteria 1045
358 Ga0496113_0000076 3300048916 Bacteria 42925
359 Ga0496113_0406589 3300048916 Bacteria 1093
360 Ga0496114_0000267 3300048917 Bacteria 37979
361 Ga0496114_0000482 3300048917 Bacteria 29245
362 Ga0496114_0035966 3300048917 Bacteria 4092
363 Ga0496114_0041150 3300048917 Bacteria 3829
364 Ga0496114_0057238 3300048917 Bacteria 3254
365 Ga0496115_0370713 3300048918 Bacteria 1165
366 Ga0496115_0934842 3300048918 Bacteria 667
367 Ga0501040_0090132 3300049576 Bacteria 2131
368 Ga0501046_0125742 3300049580 Bacteria 1948
369 Ga0501048_0087226 3300049582 Bacteria 2202
370 Ga0501067_0059552 3300049583 Bacteria 2114
371 Ga0501069_0015123 3300049585 Bacteria 4134
372 Ga0501069_0034976 3300049585 Bacteria 2766
373 Ga0501069_0072804 3300049585 Bacteria 1927
374 Ga0501070_0042933 3300049586 Bacteria 3764
375 Ga0501074_0383397 3300049590 Bacteria 997
376 Ga0501075_0079133 3300049591 Bacteria 2488
377 Ga0501077_0148525 3300049593 Bacteria 1487
378 Ga0501079_0389779 3300049741 Bacteria 1092
379 Ga0501080_0314306 3300049742 Bacteria 1419
380 Ga0501081_0018747 3300049743 Bacteria 4596
381 Ga0501045_0079228 3300049824 Bacteria 2422
382 nmdc:mga05p37_138735_c1 3300050507 Bacteria 2980
383 nmdc:mga05p37_30599_c1 3300050507 Bacteria 6568
384 nmdc:mga0qj67_26086_c1 3300050509 Bacteria 4522
385 nmdc:mga06r32_262650_c1 3300050510 Bacteria 1714
386 nmdc:mga08y16_1485356_c1 3300050511 Archaea 639
387 nmdc:mga08y16_444111_c1 3300050511 Unclassified 1323
388 nmdc:mga0n895_156784_c1 3300050512 Bacteria 2307
389 nmdc:mga0a205_389881_c1 3300050515 Bacteria 1257
390 nmdc:mga0a205_481408_c1 3300050515 Unclassified 1099
391 Ga0495601_0014112 3300053077 Bacteria 4813
392 Ga0501084_0031524 3300054114 Bacteria 4432
393 Ga0501082_0089965 3300060353 Bacteria 2650
394 Ga0530510_0005857 3300061734 Bacteria 8516
395 Ga0070713_100198894
396 JGI24751J29686_10063053
397 Ga0070658_10000656
398 Ga0070658_10054918
399 Ga0070658_10313870
400 Ga0070676_10042420
401 Ga0070683_100001486
402 Ga0070683_100055884
403 Ga0070683_100243113
404 Ga0070670_100005072
405 Ga0070670_100006448
406 Ga0068869_100147739
407 Ga0070680_100114789
408 Ga0070680_100120339
409 Ga0070680_100139563
410 Ga0070682_100270743
411 Ga0068868_100479260
412 Ga0070660_100024307
413 Ga0070660_100165093
414 Ga0070689_100445465
415 Ga0070661_100740636
416 Ga0070668_100529037
417 Ga0070675_100430917
418 Ga0070671_100119601
419 Ga0070671_100194691
420 Ga0070674_100009843
421 Ga0070674_100025971
422 Ga0070674_100260070
423 Ga0070674_100270027
424 Ga0070673_100756905
425 Ga0070688_100229490
426 Ga0070709_10050799
427 Ga0070713_100420205
428 Ga0070713_100844938
429 Ga0070701_10058403
430 Ga0070701_10272659
431 Ga0070711_100035396
432 Ga0070700_100168038
433 Ga0070694_100420606
434 Ga0070678_100063650
435 Ga0070678_100137188
436 Ga0070662_100009362
437 Ga0070662_100420713
438 Ga0070681_10003938
439 Ga0070681_10469706
440 Ga0068867_100057330
441 Ga0068867_100180747
442 Ga0068867_100666265
443 Ga0070685_10059638
444 Ga0070685_10109073
445 Ga0070706_100032291
446 Ga0070698_100008016
447 Ga0070699_100131100
448 Ga0070699_100153887
449 Ga0070679_100004275
450 Ga0070679_100045326
451 Ga0070679_100068771
452 Ga0070679_100201337
453 Ga0070679_100379532
454 Ga0070684_100001004
455 Ga0070684_100040552
456 Ga0070686_100018889
457 Ga0070686_100476769
458 Ga0070695_100778566
459 Ga0070696_100836003
460 Ga0070693_100003025
461 Ga0070665_100140502
462 Ga0070704_100124564
463 Ga0070704_100199917
464 Ga0068855_101463651
465 Ga0068857_100022365
466 Ga0068857_100588747
467 Ga0068854_100303676
468 Ga0068856_100130594
469 Ga0070702_100129892
470 Ga0070702_100340322
471 Ga0068859_100136277
472 Ga0068864_100018319
473 Ga0068866_10304028
474 Ga0068861_100002628
475 Ga0068870_10007576
476 Ga0081455_10527039
477 Ga0070717_10025875
478 Ga0070717_10125850
479 Ga0070715_10043303
480 Ga0070716_100166284
481 Ga0070712_100093796
482 Ga0097621_100131679
483 Ga0075428_100200506
484 Ga0075428_100238845
485 Ga0075430_100238516
486 Ga0075431_100131646
487 Ga0075433_10535763
488 Ga0075434_100364503
489 Ga0068865_100037188
490 Ga0068865_100075513
491 Ga0097620_100136274
492 Ga0075435_100341050
493 Ga0111539_10077897
494 Ga0111539_11005904
495 Ga0105245_10003898
496 Ga0105245_10102606
497 Ga0105245_10118513
498 Ga0105245_10195547
499 Ga0105245_10328151
500 Ga0114129_10156356
501 Ga0114129_10250223
502 Ga0114129_10500005
503 Ga0105243_10071986
504 Ga0105243_10072975
505 Ga0105243_10222022
506 Ga0105243_10620420
507 Ga0105241_10142960
508 Ga0105242_10017423
509 Ga0105242_10022185
510 Ga0105242_10034326
511 Ga0105242_10104362
512 Ga0105242_10257871
513 Ga0105248_10162977
514 Ga0105237_10284472
515 Ga0105249_10028478
516 Ga0105249_10176588
517 Ga0105249_10393102
518 Ga0105249_10477249
519 Ga0105239_10040841
520 Ga0105239_10459445
521 Ga0105239_10872781
522 Ga0105246_10033369
523 Ga0105246_10058139
524 Ga0157370_10960597
525 Ga0157374_10295509
526 Ga0157374_10619314
527 Ga0157378_10265645
528 Ga0163162_10079016
529 Ga0163162_10308172
530 Ga0163162_11200921
531 Ga0157372_10440501
532 Ga0157375_10182561
533 Ga0157375_10252410
534 Ga0163163_10063106
535 Ga0163163_10211376
536 Ga0157380_11418708
537 Ga0157377_10069343
538 Ga0157379_10288892
539 Ga0157376_10092829
540 Ga0157376_10843574
541 Ga0163161_10017252
542 Ga0207692_10129221
543 Ga0207688_10018869
544 Ga0207688_10099269
545 Ga0207685_10070277
546 Ga0207699_10011614
547 Ga0207645_10036644
548 Ga0207643_10001636
549 Ga0207643_10020515
550 Ga0207705_10003692
551 Ga0207705_10134874
552 Ga0207705_10261862
553 Ga0207654_10019411
554 Ga0207707_10002322
555 Ga0207707_10277689
556 Ga0207693_10056477
557 Ga0207693_10456244
558 Ga0207663_10039731
559 Ga0207660_10111431
560 Ga0207660_10144836
561 Ga0207660_10657052
562 Ga0207657_10024920
563 Ga0207657_10123120
564 Ga0207649_10060813
565 Ga0207652_10024174
566 Ga0207652_10051732
567 Ga0207652_10079952
568 Ga0207652_10331597
569 Ga0207650_10014300
570 Ga0207650_10101472
571 Ga0207687_10043354
572 Ga0207687_10513290
573 Ga0207700_10293589
574 Ga0207644_10094475
575 Ga0207644_10746771
576 Ga0207690_10143259
577 Ga0207706_10010525
578 Ga0207706_10403792
579 Ga0207706_10555085
580 Ga0207706_10730359
581 Ga0207686_10003756
582 Ga0207686_10171644
583 Ga0207686_10194276
584 Ga0207686_10220791
585 Ga0207686_10418379
586 Ga0207686_10715163
587 Ga0207709_10039586
588 Ga0207709_10040437
589 Ga0207709_10051707
590 Ga0207709_10180915
591 Ga0207670_10141428
592 Ga0207669_10043742
593 Ga0207665_10210718
594 Ga0207691_10324150
595 Ga0207691_10495559
596 Ga0207711_10174094
597 Ga0207689_10984733
598 Ga0207661_10000318
599 Ga0207661_10300323
600 Ga0207679_10527858
601 Ga0207667_10061571
602 Ga0207712_10004746
603 Ga0207712_10431355
604 Ga0207668_10073306
605 Ga0207668_10650443
606 Ga0207640_10144918
607 Ga0207677_10248463
608 Ga0207677_10736378
609 Ga0207708_10005699
610 Ga0207702_10012300
611 Ga0207702_10343587
612 Ga0207641_11201360
613 Ga0207648_10051004
614 Ga0207648_10310172
615 Ga0207676_10026117
616 Ga0207676_10279520
617 Ga0207674_10022026
618 Ga0207674_10396923
619 Ga0207675_100003335
620 Ga0207683_10009998
621 Ga0207683_10017408
622 Ga0207683_10022853
623 Ga0207683_10102043
624 Ga0268266_10020810
625 Ga0373944_0070868
626 Ga0373945_0092274
627 Ga0373943_0157992
628 Ga0373943_0254934
629 Ga0373927_0056405
630 Ga0373933_0178238
631 Ga0373947_0023283
632 Ga0373925_0027986
633 Ga0373925_0452227
634 Ga0395899_0003127
635 Ga0395900_0005040
636 Ga0395900_0005204
637 Ga0395900_0055300
638 Ga0395900_0365845
639 Ga0395900_0564285
640 Ga0395898_0004187
641 Ga0395898_0007784
642 Ga0395898_0049359
643 Ga0395905_0044900
644 Ga0395905_0293809
645 Ga0395901_0000500
646 Ga0395901_0017850
647 Ga0395901_0019211
648 Ga0395901_0034442
649 Ga0395901_0093823
650 Ga0395901_0235297
651 Ga0395901_0702874
652 Ga0395901_0924159
653 Ga0242420_036635
654 Ga0451789_0122936
655 Ga0451793_0459803
656 Ga0451804_0227465
657 Ga0451807_0757165
658 Ga0451835_1012293
659 Ga0451839_0111960
660 Ga0451841_0378742
661 Ga0451851_0915057
662 Ga0451853_3843695
663 Ga0450920_020751
664 Ga0466963_0049467
665 Ga0466958_0094382
666 Ga0495592_0169187
667 Ga0495603_0015735
668 Ga0495603_0019003
669 Ga0495603_0131497
670 Ga0495603_0192570
671 Ga0495629_0022368
672 Ga0495641_0065213
673 Ga0495641_0251311
674 Ga0495651_0154899
675 Ga0495582_0011172
676 Ga0495582_0041054
677 Ga0495582_0172082
678 Ga0495639_0134874
679 Ga0495662_0016783
680 Ga0495664_0015647
681 Ga0495585_0435679
682 Ga0495607_0248806
683 Ga0495616_0118767
684 Ga0495618_0428183
685 Ga0495628_0180722
686 Ga0495630_0058498
687 Ga0495637_0075438
688 Ga0495644_0092350
689 Ga0495644_0107289
690 Ga0495665_0051380
691 Ga0495665_0359523
692 Ga0495640_0040190
693 Ga0495640_0453847
694 Ga0495586_0028417
695 Ga0495586_0160380
696 Ga0495645_0472798
697 Ga0495634_0035755
698 Ga0495635_0140202
699 Ga0495588_0226444
700 Ga0495599_0136147
701 Ga0495647_0034705
702 Ga0495613_0008242
703 Ga0495624_0136170
704 Ga0495624_0341304
705 Ga0495649_0361145
706 Ga0495589_0131819
707 Ga0495581_0001842
708 Ga0495636_0031546
709 Ga0495674_0018456
710 Ga0495676_0011400
711 Ga0495676_0021650
712 Ga0495676_0037041
713 Ga0495684_0132751
714 Ga0496100_0034154
715 Ga0496100_0062843
716 Ga0496100_0191079
717 Ga0496101_0001540
718 Ga0496101_0035677
719 Ga0496101_0179162
720 Ga0496102_0022801
721 Ga0496102_0212513
722 Ga0496103_0037147
723 Ga0496104_0000432
724 Ga0496104_0011588
725 Ga0496104_0015748
726 Ga0496104_0061217
727 Ga0496105_0000348
728 Ga0496105_0000687
729 Ga0496105_0129508
730 Ga0496106_0118853
731 Ga0496106_0204084
732 Ga0496107_0009866
733 Ga0496107_0019789
734 Ga0496107_0107474
735 Ga0496108_0003626
736 Ga0496108_0005047
737 Ga0496108_0931564
738 Ga0496109_0023213
739 Ga0496109_0229934
740 Ga0496110_0000826
741 Ga0496110_0000944
742 Ga0496110_0025713
743 Ga0496110_0036589
744 Ga0496110_0217309
745 Ga0496110_0970289
746 Ga0496111_0000045
747 Ga0496111_0000277
748 Ga0496111_0009492
749 Ga0496111_0151604
750 Ga0496112_0144115
751 Ga0496112_0588607
752 Ga0496113_0000076
753 Ga0496113_0406589
754 Ga0496114_0000267
755 Ga0496114_0000482
756 Ga0496114_0035966
757 Ga0496114_0041150
758 Ga0496114_0057238
759 Ga0496115_0370713
760 Ga0496115_0934842
761 Ga0501040_0090132
762 Ga0501046_0125742
763 Ga0501048_0087226
764 Ga0501067_0059552
765 Ga0501069_0015123
766 Ga0501069_0034976
767 Ga0501069_0072804
768 Ga0501070_0042933
769 Ga0501074_0383397
770 Ga0501075_0079133
771 Ga0501077_0148525
772 Ga0501079_0389779
773 Ga0501080_0314306
774 Ga0501081_0018747
775 Ga0501045_0079228
776 nmdc:mga05p37_138735_c1
777 nmdc:mga05p37_30599_c1
778 nmdc:mga0qj67_26086_c1
779 nmdc:mga06r32_262650_c1
780 nmdc:mga08y16_1485356_c1
781 nmdc:mga08y16_444111_c1
782 nmdc:mga0n895_156784_c1
783 nmdc:mga0a205_389881_c1
784 nmdc:mga0a205_481408_c1
785 Ga0495601_0014112
786 Ga0501084_0031524
787 Ga0501082_0089965
788 Ga0530510_0005857

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09335

VTT_dom

VTT domain

39

165

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a5v-assembly1.cif.gz_A cryoem structure of a human gamma-aminobutyric acid receptor, the gaba(a)r-beta3 homopentamer, in complex with histamine and megabody mb25 in lipid nanodisc 0.4526 111 196
4cof-assembly1.cif.gz_E crystal structure of a human gamma-aminobutyric acid receptor, the gaba(a)r-beta3 homopentamer 0.4435 111 196
7uwa-assembly1.cif.gz_j citrus v-atpase state 1, h in contact with subunits ab 0.3383 54 200
7uwa-assembly1.cif.gz_j citrus v-atpase state 1, h in contact with subunits ab 0.3234 54 200
4jq6-assembly1.cif.gz_B-2 crystal structure of blue light-absorbing proteorhodopsin from med12 at 2.3 angstrom 0.2842 1 170
ID Description Score Start End Superfamily
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8162 34 161 1.10.1760.20
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7975 34 161 1.10.1760.20
4cofC02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.4444 111 196 1.20.58.390
4cofA02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.4442 111 196 1.20.58.390
5osbE02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.3904 111 197 1.20.58.390
ID Description Score Start End GO Terms
AF-A0A2M8B0D8-F1-model_v4 Sulfurtransferase 0.9216 21 165 GO:0005886
GO:0016740
AF-A0A0S7X8R6-F1-model_v4 VTT domain-containing protein 0.9123 20 169 GO:0005886
AF-A0A5D0UYG4-F1-model_v4 DedA family protein 0.9018 19 169 GO:0005886
AF-A0A3M1CXE0-F1-model_v4 DedA family protein 0.8986 14 169 GO:0005886
AF-A0A6B1PB88-F1-model_v4 deleted 0.8857 1 162

Map