F432814

General Info

Members Datasets Scaffolds Average Seq Length
394 181 788 121

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_101281475|Ga0070675_1012814752
Length 141
Sequence VVVLTSYCHAVVRTYVSDNAALILPMAYSAAFKDHLANPRNAGELHHANAVAEATNPVCGDRLRLFLLINDGRIEAAGFLAYGCPPTLVCGSVVTELITGKSVREAMSLTRKDVVAAIGELPSRKQHAAALAIETLKTAIE

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
135 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
136 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
146 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
147 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
148 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
149 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
150 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
151 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
152 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
153 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
154 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
155 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
156 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
157 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
158 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
159 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
160 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
161 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
162 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
163 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
164 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
165 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
166 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
167 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
168 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
169 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
170 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
171 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
172 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
173 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.28
Rhizosphere 97.21
Stem 0
Stem Tuber 0
Unclassified 48.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_101281475 3300005354 Unclassified 675
2 MRS1b_contig_8253223 2162886011 Bacteria 855
3 CNAas_1000011 3300000532 Bacteria 11080
4 JGI25406J46586_10016403 3300003203 Bacteria 3089
5 rootL2_10107531 3300003322 Bacteria 1475
6 rootL2_10175310 3300003322 Bacteria 1005
7 Ga0065704_10277417 3300005289 Unclassified 930
8 Ga0065704_10439820 3300005289 Unclassified 715
9 Ga0065712_10000127 3300005290 Bacteria 117106
10 Ga0065715_10023013 3300005293 Bacteria 1921
11 Ga0065715_10090628 3300005293 Bacteria 6707
12 Ga0065715_10096877 3300005293 Bacteria 3803
13 Ga0065715_11113132 3300005293 Unclassified 517
14 Ga0070670_100005843 3300005331 Bacteria 10403
15 Ga0070670_100651057 3300005331 Bacteria 945
16 Ga0070677_10092175 3300005333 Bacteria 1320
17 Ga0068869_100139301 3300005334 Bacteria 1872
18 Ga0068869_100140071 3300005334 Bacteria 1867
19 Ga0068869_100356564 3300005334 Unclassified 1193
20 Ga0068869_101820092 3300005334 Unclassified 545
21 Ga0070680_100020943 3300005336 Bacteria 5192
22 Ga0070689_100001418 3300005340 Bacteria 15284
23 Ga0070689_100053133 3300005340 Bacteria 3135
24 Ga0070687_100932607 3300005343 Unclassified 625
25 Ga0070692_10030458 3300005345 Bacteria 2698
26 Ga0070692_10048610 3300005345 Bacteria 2198
27 Ga0070692_10166888 3300005345 Bacteria 1266
28 Ga0070692_10275272 3300005345 Bacteria 1018
29 Ga0070692_10752121 3300005345 Unclassified 661
30 Ga0070669_100190787 3300005353 Bacteria 1607
31 Ga0070669_100649262 3300005353 Unclassified 888
32 Ga0070675_100020159 3300005354 Bacteria 5320
33 Ga0070675_101030073 3300005354 Unclassified 756
34 Ga0070673_100920873 3300005364 Unclassified 811
35 Ga0070673_100940618 3300005364 Unclassified 803
36 Ga0070688_100603379 3300005365 Unclassified 840
37 Ga0070688_100673765 3300005365 Bacteria 798
38 Ga0070688_101054686 3300005365 Unclassified 648
39 Ga0070703_10241826 3300005406 Unclassified 728
40 Ga0070703_10301614 3300005406 Unclassified 668
41 Ga0070703_10308324 3300005406 Bacteria 662
42 Ga0070701_10036883 3300005438 Bacteria 2465
43 Ga0070711_101549199 3300005439 Unclassified 579
44 Ga0070705_100005877 3300005440 Bacteria 5999
45 Ga0070705_100044753 3300005440 Bacteria 2544
46 Ga0070705_100182494 3300005440 Bacteria 1423
47 Ga0070705_100895477 3300005440 Unclassified 713
48 Ga0070705_101374442 3300005440 Bacteria 588
49 Ga0070700_100034934 3300005441 Bacteria 3039
50 Ga0070700_100577390 3300005441 Unclassified 877
51 Ga0070700_101000702 3300005441 Unclassified 687
52 Ga0070694_100003337 3300005444 Bacteria 9605
53 Ga0070694_100309220 3300005444 Bacteria 1213
54 Ga0070694_101605398 3300005444 Unclassified 552
55 Ga0070708_101253131 3300005445 Unclassified 693
56 Ga0070662_100016255 3300005457 Bacteria 4993
57 Ga0070681_10410859 3300005458 Bacteria 1265
58 Ga0068867_100745757 3300005459 Unclassified 868
59 Ga0070698_100001973 3300005471 Bacteria 22816
60 Ga0070698_100026737 3300005471 Bacteria 6003
61 Ga0070699_101011100 3300005518 Bacteria 762
62 Ga0070697_100000292 3300005536 Bacteria 40131
63 Ga0070697_100008618 3300005536 Bacteria 7961
64 Ga0070697_100155481 3300005536 Bacteria 1930
65 Ga0070697_100324188 3300005536 Bacteria 1327
66 Ga0070697_100708444 3300005536 Unclassified 888
67 Ga0068853_100594869 3300005539 Bacteria 1050
68 Ga0070686_100026527 3300005544 Unclassified 3498
69 Ga0070695_100120039 3300005545 Bacteria 1797
70 Ga0070695_100171983 3300005545 Unclassified 1529
71 Ga0070695_100250750 3300005545 Bacteria 1288
72 Ga0070695_100290989 3300005545 Bacteria 1204
73 Ga0070695_100732892 3300005545 Unclassified 787
74 Ga0070695_101287970 3300005545 Unclassified 603
75 Ga0070696_100036493 3300005546 Bacteria 3389
76 Ga0070696_100647118 3300005546 Bacteria 857
77 Ga0070696_100883857 3300005546 Unclassified 740
78 Ga0070696_101386362 3300005546 Unclassified 599
79 Ga0070693_100008907 3300005547 Unclassified 4978
80 Ga0070693_100279643 3300005547 Unclassified 1117
81 Ga0070693_100867391 3300005547 Unclassified 674
82 Ga0070704_100282833 3300005549 Unclassified 1375
83 Ga0070664_101897458 3300005564 Unclassified 565
84 Ga0068857_100240643 3300005577 Unclassified 1657
85 Ga0068857_100914805 3300005577 Unclassified 842
86 Ga0068857_101121768 3300005577 Unclassified 760
87 Ga0068854_101802014 3300005578 Unclassified 561
88 Ga0070702_100014618 3300005615 Unclassified 3986
89 Ga0070702_100320062 3300005615 Unclassified 1081
90 Ga0070702_101243637 3300005615 Unclassified 602
91 Ga0070702_101851021 3300005615 Unclassified 505
92 Ga0068859_100013288 3300005617 Bacteria 8261
93 Ga0068859_100043642 3300005617 Bacteria 4507
94 Ga0068859_100066737 3300005617 Bacteria 3633
95 Ga0068859_100119638 3300005617 Bacteria 2700
96 Ga0068859_100782163 3300005617 Bacteria 1042
97 Ga0068859_100783570 3300005617 Bacteria 1042
98 Ga0068859_101978403 3300005617 Unclassified 644
99 Ga0068859_102632357 3300005617 Unclassified 553
100 Ga0068864_100014419 3300005618 Bacteria 6564
101 Ga0068864_100091073 3300005618 Unclassified 2689
102 Ga0068864_100152801 3300005618 Bacteria 2092
103 Ga0068864_100393485 3300005618 Unclassified 1316
104 Ga0068864_100915525 3300005618 Bacteria 866
105 Ga0068866_10299210 3300005718 Bacteria 1004
106 Ga0068861_100569966 3300005719 Unclassified 1035
107 Ga0068861_101171425 3300005719 Bacteria 742
108 Ga0068851_10014057 3300005834 Unclassified 3795
109 Ga0068870_10335056 3300005840 Unclassified 966
110 Ga0068870_10374757 3300005840 Unclassified 920
111 Ga0068870_10401995 3300005840 Unclassified 891
112 Ga0068870_10787962 3300005840 Unclassified 663
113 Ga0068863_100052618 3300005841 Unclassified 3859
114 Ga0068863_100067455 3300005841 Bacteria 3384
115 Ga0068863_100311704 3300005841 Unclassified 1527
116 Ga0068863_100862814 3300005841 Unclassified 904
117 Ga0068858_100036175 3300005842 Bacteria 4578
118 Ga0068858_100659888 3300005842 Bacteria 1016
119 Ga0068860_100072911 3300005843 Bacteria 3264
120 Ga0068860_100137330 3300005843 Unclassified 2348
121 Ga0068860_100635245 3300005843 Bacteria 1075
122 Ga0068860_101381410 3300005843 Archaea 725
123 Ga0068860_102310847 3300005843 Unclassified 558
124 Ga0068862_100035065 3300005844 Bacteria 4247
125 Ga0068862_100094831 3300005844 Bacteria 2603
126 Ga0068862_101079065 3300005844 Bacteria 797
127 Ga0068862_102247204 3300005844 Unclassified 557
128 Ga0081540_1052565 3300005983 Bacteria 2004
129 Ga0081539_10000476 3300005985 Bacteria 84955
130 Ga0081539_10001446 3300005985 Bacteria 40634
131 Ga0081539_10315011 3300005985 Unclassified 667
132 Ga0070712_101347222 3300006175 Unclassified 622
133 Ga0075430_100425695 3300006846 Unclassified 1096
134 Ga0075431_100566155 3300006847 Unclassified 1123
135 Ga0075431_101117278 3300006847 Unclassified 752
136 Ga0075433_10011225 3300006852 Bacteria 7210
137 Ga0075433_10082518 3300006852 Unclassified 2835
138 Ga0075433_10327116 3300006852 Unclassified 1356
139 Ga0075434_100146478 3300006871 Bacteria 2382
140 Ga0075434_100330928 3300006871 Unclassified 1544
141 Ga0075434_100354504 3300006871 Bacteria 1488
142 Ga0075429_100186693 3300006880 Bacteria 1816
143 Ga0075436_100001628 3300006914 Bacteria 15372
144 Ga0097620_100013288 3300006931 Bacteria 8261
145 Ga0097620_100030005 3300006931 Bacteria 5455
146 Ga0097620_100043642 3300006931 Bacteria 4507
147 Ga0097620_100066739 3300006931 Bacteria 3633
148 Ga0097620_100119629 3300006931 Bacteria 2700
149 Ga0097620_100782143 3300006931 Bacteria 1042
150 Ga0097620_100783523 3300006931 Bacteria 1042
151 Ga0097620_101978436 3300006931 Unclassified 644
152 Ga0097620_102630611 3300006931 Unclassified 553
153 Ga0075435_100154460 3300007076 Bacteria 1931
154 Ga0075435_100259159 3300007076 Bacteria 1481
155 Ga0105240_10051760 3300009093 Bacteria 5166
156 Ga0105240_11063241 3300009093 Bacteria 863
157 Ga0111539_10007271 3300009094 Bacteria 14177
158 Ga0111539_10095994 3300009094 Unclassified 3482
159 Ga0105245_10561019 3300009098 Bacteria 1165
160 Ga0105245_10614025 3300009098 Bacteria 1115
161 Ga0105245_11138712 3300009098 Unclassified 827
162 Ga0105245_13067490 3300009098 Unclassified 518
163 Ga0105247_10055184 3300009101 Unclassified 2452
164 Ga0105247_10443687 3300009101 Unclassified 934
165 Ga0114129_10006354 3300009147 Bacteria 16753
166 Ga0114129_10017737 3300009147 Bacteria 10136
167 Ga0114129_10046357 3300009147 Bacteria 6109
168 Ga0114129_10057713 3300009147 Bacteria 5431
169 Ga0114129_10213919 3300009147 Bacteria 2604
170 Ga0114129_11136351 3300009147 Unclassified 976
171 Ga0114129_13170075 3300009147 Bacteria 536
172 Ga0105243_10006964 3300009148 Bacteria 8704
173 Ga0105243_10609703 3300009148 Bacteria 1052
174 Ga0105243_10778556 3300009148 Bacteria 941
175 Ga0105243_11154076 3300009148 Unclassified 786
176 Ga0105243_11810397 3300009148 Unclassified 642
177 Ga0105243_12809809 3300009148 Unclassified 527
178 Ga0105241_10143066 3300009174 Bacteria 1949
179 Ga0105241_10276419 3300009174 Bacteria 1433
180 Ga0105241_10353921 3300009174 Unclassified 1276
181 Ga0105241_10696300 3300009174 Unclassified 927
182 Ga0105241_12526430 3300009174 Bacteria 515
183 Ga0105241_12605158 3300009174 Unclassified 508
184 Ga0105242_11790990 3300009176 Unclassified 652
185 Ga0105248_10559300 3300009177 Bacteria 1290
186 Ga0105248_10642392 3300009177 Unclassified 1197
187 Ga0105248_10682317 3300009177 Unclassified 1159
188 Ga0105248_10719797 3300009177 Bacteria 1126
189 Ga0105248_11059875 3300009177 Unclassified 916
190 Ga0105237_10002034 3300009545 Bacteria 25707
191 Ga0105238_10050745 3300009551 Bacteria 4175
192 Ga0105249_10157326 3300009553 Bacteria 2193
193 Ga0105249_10353234 3300009553 Bacteria 1490
194 Ga0105239_13603041 3300010375 Unclassified 503
195 Ga0105246_10016820 3300011119 Bacteria 4640
196 Ga0105246_10044705 3300011119 Bacteria 3011
197 Ga0105246_10298602 3300011119 Bacteria 1299
198 Ga0105246_11054649 3300011119 Unclassified 739
199 Ga0157373_10003543 3300013100 Bacteria 11791
200 Ga0157373_10005784 3300013100 Bacteria 9263
201 Ga0157373_10254077 3300013100 Unclassified 1243
202 Ga0157374_10557180 3300013296 Unclassified 1154
203 Ga0157378_10017328 3300013297 Bacteria 6319
204 Ga0157378_10165328 3300013297 Bacteria 2072
205 Ga0157378_13262525 3300013297 Unclassified 504
206 Ga0163162_10090961 3300013306 Bacteria 3134
207 Ga0163162_10886757 3300013306 Unclassified 1006
208 Ga0157372_10061349 3300013307 Unclassified 4210
209 Ga0157372_10394073 3300013307 Bacteria 1614
210 Ga0157372_11246003 3300013307 Unclassified 859
211 Ga0157375_10070757 3300013308 Bacteria 3500
212 Ga0157375_10848378 3300013308 Bacteria 1060
213 Ga0157375_11116571 3300013308 Unclassified 923
214 Ga0157375_12282870 3300013308 Unclassified 645
215 Ga0163163_10151007 3300014325 Bacteria 2367
216 Ga0163163_10227377 3300014325 Unclassified 1914
217 Ga0163163_10500877 3300014325 Bacteria 1276
218 Ga0163163_12344128 3300014325 Unclassified 592
219 Ga0157380_10180829 3300014326 Unclassified 1853
220 Ga0157380_10814733 3300014326 Unclassified 952
221 Ga0157377_11021072 3300014745 Unclassified 628
222 Ga0157377_11281581 3300014745 Unclassified 572
223 Ga0157379_10033722 3300014968 Unclassified 4566
224 Ga0157379_11286609 3300014968 Unclassified 706
225 Ga0207656_10008376 3300025321 Unclassified 3804
226 Ga0207653_10140985 3300025885 Bacteria 881
227 Ga0207653_10176219 3300025885 Unclassified 798
228 Ga0207682_10178221 3300025893 Bacteria 970
229 Ga0207647_10764408 3300025904 Unclassified 522
230 Ga0207643_10025658 3300025908 Bacteria 3259
231 Ga0207643_10041192 3300025908 Bacteria 2602
232 Ga0207643_10056586 3300025908 Bacteria 2231
233 Ga0207643_10089452 3300025908 Bacteria 1793
234 Ga0207684_10000297 3300025910 Bacteria 71105
235 Ga0207654_11086117 3300025911 Unclassified 583
236 Ga0207654_11217768 3300025911 Unclassified 549
237 Ga0207707_10103560 3300025912 Unclassified 2488
238 Ga0207695_10034489 3300025913 Bacteria 5503
239 Ga0207671_10016043 3300025914 Bacteria 5838
240 Ga0207693_11068497 3300025915 Unclassified 614
241 Ga0207662_10561469 3300025918 Bacteria 791
242 Ga0207662_10792501 3300025918 Unclassified 668
243 Ga0207652_10227072 3300025921 Unclassified 1683
244 Ga0207681_10451632 3300025923 Unclassified 1046
245 Ga0207681_11094177 3300025923 Bacteria 669
246 Ga0207694_10005310 3300025924 Bacteria 9925
247 Ga0207650_10573652 3300025925 Unclassified 947
248 Ga0207650_10763234 3300025925 Bacteria 819
249 Ga0207650_11647224 3300025925 Unclassified 544
250 Ga0207659_10028860 3300025926 Bacteria 3774
251 Ga0207659_10505655 3300025926 Unclassified 1023
252 Ga0207687_10418477 3300025927 Unclassified 1105
253 Ga0207687_10945479 3300025927 Unclassified 738
254 Ga0207690_10546742 3300025932 Bacteria 941
255 Ga0207706_10011576 3300025933 Bacteria 8032
256 Ga0207709_10006609 3300025935 Bacteria 6507
257 Ga0207709_10336077 3300025935 Unclassified 1135
258 Ga0207709_10492853 3300025935 Unclassified 955
259 Ga0207670_10000595 3300025936 Bacteria 19771
260 Ga0207670_10330089 3300025936 Bacteria 1202
261 Ga0207670_10361395 3300025936 Bacteria 1152
262 Ga0207670_11221522 3300025936 Unclassified 636
263 Ga0207711_10186910 3300025941 Bacteria 1886
264 Ga0207711_10509600 3300025941 Unclassified 1122
265 Ga0207711_10739972 3300025941 Unclassified 917
266 Ga0207711_10994619 3300025941 Unclassified 778
267 Ga0207711_11115141 3300025941 Bacteria 730
268 Ga0207689_10048094 3300025942 Unclassified 3519
269 Ga0207689_10169797 3300025942 Bacteria 1797
270 Ga0207689_10292868 3300025942 Bacteria 1348
271 Ga0207689_10368849 3300025942 Bacteria 1194
272 Ga0207689_10521623 3300025942 Bacteria 996
273 Ga0207689_11622775 3300025942 Unclassified 538
274 Ga0207679_10700465 3300025945 Unclassified 919
275 Ga0207679_11130557 3300025945 Unclassified 719
276 Ga0207667_10156099 3300025949 Bacteria 2348
277 Ga0207651_10319302 3300025960 Bacteria 1298
278 Ga0207712_11108726 3300025961 Bacteria 705
279 Ga0207640_11306196 3300025981 Unclassified 648
280 Ga0207677_10516011 3300026023 Unclassified 1036
281 Ga0207703_10040600 3300026035 Bacteria 3724
282 Ga0207703_10711363 3300026035 Unclassified 956
283 Ga0207703_11401643 3300026035 Bacteria 672
284 Ga0207703_11581632 3300026035 Unclassified 631
285 Ga0207708_10084924 3300026075 Bacteria 2435
286 Ga0207708_10648826 3300026075 Unclassified 898
287 Ga0207708_11344769 3300026075 Unclassified 626
288 Ga0207641_10103308 3300026088 Bacteria 2514
289 Ga0207641_10168599 3300026088 Bacteria 1996
290 Ga0207641_10282184 3300026088 Bacteria 1563
291 Ga0207641_10334179 3300026088 Bacteria 1440
292 Ga0207648_10047132 3300026089 Unclassified 3778
293 Ga0207648_10534837 3300026089 Unclassified 1075
294 Ga0207676_10154820 3300026095 Unclassified 1978
295 Ga0207676_10262681 3300026095 Unclassified 1559
296 Ga0207676_10513981 3300026095 Unclassified 1139
297 Ga0207674_10054445 3300026116 Bacteria 4073
298 Ga0207674_10075915 3300026116 Unclassified 3370
299 Ga0207674_10677696 3300026116 Unclassified 995
300 Ga0207674_11226654 3300026116 Unclassified 719
301 Ga0207675_101991368 3300026118 Unclassified 598
302 Ga0207675_102634260 3300026118 Unclassified 512
303 Ga0207698_11372818 3300026142 Bacteria 721
304 Ga0268266_11893080 3300028379 Unclassified 571
305 Ga0268265_10866180 3300028380 Bacteria 885
306 Ga0268265_10915709 3300028380 Unclassified 862
307 Ga0268265_11932201 3300028380 Unclassified 597
308 Ga0268265_12271240 3300028380 Unclassified 549
309 Ga0268264_10539252 3300028381 Bacteria 1143
310 Ga0268264_10650449 3300028381 Unclassified 1043
311 Ga0268264_11207399 3300028381 Archaea 766
312 Ga0268264_11372337 3300028381 Unclassified 717
313 Ga0268264_12186090 3300028381 Unclassified 561
314 Ga0307406_10268540 3300031901 Unclassified 1295
315 Ga0307406_10385177 3300031901 Bacteria 1107
316 Ga0307412_11183632 3300031911 Bacteria 684
317 Ga0307416_100226834 3300032002 Bacteria 1797
318 Ga0307414_10425224 3300032004 Bacteria 1159
319 Ga0307414_11419854 3300032004 Unclassified 645
320 Ga0307411_10721716 3300032005 Bacteria 870
321 Ga0307415_100019571 3300032126 Bacteria 4113
322 Ga0307415_101338328 3300032126 Unclassified 680
323 Ga0373929_0237569 3300035085 Unclassified 524
324 Ga0373951_0002644 3300035091 Bacteria 4496
325 Ga0439433_0089027 3300041999 Bacteria 757
326 Ga0451576_0178685 3300045051 Bacteria 2216
327 Ga0451576_0700742 3300045051 Unclassified 1064
328 Ga0451576_2056164 3300045051 Unclassified 588
329 Ga0495672_0174187 3300047320 Unclassified 1094
330 Ga0496100_0648344 3300048903 Unclassified 822
331 Ga0496106_0193096 3300048909 Bacteria 1619
332 Ga0496106_0497096 3300048909 Bacteria 980
333 Ga0496107_0326377 3300048910 Unclassified 1142
334 Ga0496107_0569285 3300048910 Unclassified 838
335 Ga0496109_1453357 3300048912 Bacteria 621
336 Ga0496112_1555314 3300048915 Unclassified 575
337 Ga0496113_0567757 3300048916 Bacteria 910
338 Ga0496113_1429219 3300048916 Unclassified 535
339 Ga0501291_006079 3300049514 Bacteria 1599
340 Ga0501292_070389 3300049515 Unclassified 649
341 Ga0501292_077850 3300049515 Unclassified 627
342 Ga0501295_193282 3300049518 Bacteria 512
343 Ga0501298_026767 3300049521 Bacteria 1111
344 Ga0501298_103141 3300049521 Unclassified 653
345 Ga0501202_023012 3300049652 Bacteria 1254
346 Ga0501206_066758 3300049653 Unclassified 601
347 Ga0501208_061190 3300049655 Bacteria 738
348 Ga0501211_050458 3300049658 Unclassified 515
349 Ga0501216_006520 3300049660 Bacteria 1790
350 Ga0501217_026624 3300049661 Bacteria 1399
351 Ga0501223_042322 3300049663 Unclassified 884
352 Ga0501227_011871 3300049665 Bacteria 1903
353 Ga0501227_020969 3300049665 Bacteria 1504
354 Ga0501233_003812 3300049668 Unclassified 2732
355 Ga0501235_018203 3300049669 Bacteria 1556
356 Ga0501235_051744 3300049669 Unclassified 952
357 Ga0501239_020589 3300049672 Unclassified 807
358 Ga0501240_011380 3300049673 Bacteria 1198
359 Ga0501243_010492 3300049675 Bacteria 1446
360 Ga0501243_104392 3300049675 Unclassified 575
361 Ga0501249_013235 3300049679 Bacteria 1752
362 Ga0501251_014829 3300049681 Unclassified 973
363 Ga0501256_004987 3300049685 Bacteria 1156
364 Ga0501260_004545 3300049689 Bacteria 1283
365 Ga0501261_027661 3300049690 Unclassified 844
366 Ga0501225_0027579 3300049705 Bacteria 1561
367 Ga0501225_0131137 3300049705 Unclassified 751
368 Ga0501229_057677 3300049706 Bacteria 586
369 Ga0501234_068097 3300049707 Unclassified 612
370 Ga0501268_032355 3300049765 Unclassified 953
371 Ga0501272_043925 3300049769 Unclassified 604
372 Ga0501273_006642 3300049770 Bacteria 1342
373 Ga0501273_033457 3300049770 Unclassified 739
374 Ga0501274_051436 3300049771 Unclassified 518
375 nmdc:mga05p37_228918_c1 3300050507 Bacteria 2240
376 nmdc:mga05p37_41685_c1 3300050507 Bacteria 5637
377 nmdc:mga05p37_62996_c1 3300050507 Unclassified 4564
378 nmdc:mga09592_176489_c1 3300050508 Bacteria 1848
379 nmdc:mga0qj67_357968_c1 3300050509 Bacteria 1179
380 nmdc:mga0qj67_472124_c1 3300050509 Unclassified 1010
381 nmdc:mga06r32_1006882_c1 3300050510 Unclassified 786
382 nmdc:mga06r32_684611_c1 3300050510 Unclassified 992
383 nmdc:mga06r32_766646_c1 3300050510 Unclassified 927
384 nmdc:mga0n895_126943_c1 3300050512 Bacteria 2575
385 nmdc:mga0n895_596281_c1 3300050512 Bacteria 1107
386 nmdc:mga0n895_79510_c1 3300050512 Unclassified 3265
387 nmdc:mga0rr50_246175_c1 3300050513 Bacteria 1483
388 nmdc:mga0rr50_44356_c1 3300050513 Unclassified 3261
389 nmdc:mga08x19_850_c1 3300050514 Bacteria 18151
390 nmdc:mga0a205_231581_c1 3300050515 Bacteria 1730
391 nmdc:mga0a205_400988_c1 3300050515 Unclassified 1235
392 nmdc:mga0a205_500757_c1 3300050515 Unclassified 1072
393 nmdc:mga0a205_661360_c1 3300050515 Bacteria 896
394 nmdc:mga0a205_78289_c1 3300050515 Unclassified 3194
395 Ga0070675_101281475
396 MRS1b_contig_8253223
397 CNAas_1000011
398 JGI25406J46586_10016403
399 rootL2_10107531
400 rootL2_10175310
401 Ga0065704_10277417
402 Ga0065704_10439820
403 Ga0065712_10000127
404 Ga0065715_10023013
405 Ga0065715_10090628
406 Ga0065715_10096877
407 Ga0065715_11113132
408 Ga0070670_100005843
409 Ga0070670_100651057
410 Ga0070677_10092175
411 Ga0068869_100139301
412 Ga0068869_100140071
413 Ga0068869_100356564
414 Ga0068869_101820092
415 Ga0070680_100020943
416 Ga0070689_100001418
417 Ga0070689_100053133
418 Ga0070687_100932607
419 Ga0070692_10030458
420 Ga0070692_10048610
421 Ga0070692_10166888
422 Ga0070692_10275272
423 Ga0070692_10752121
424 Ga0070669_100190787
425 Ga0070669_100649262
426 Ga0070675_100020159
427 Ga0070675_101030073
428 Ga0070673_100920873
429 Ga0070673_100940618
430 Ga0070688_100603379
431 Ga0070688_100673765
432 Ga0070688_101054686
433 Ga0070703_10241826
434 Ga0070703_10301614
435 Ga0070703_10308324
436 Ga0070701_10036883
437 Ga0070711_101549199
438 Ga0070705_100005877
439 Ga0070705_100044753
440 Ga0070705_100182494
441 Ga0070705_100895477
442 Ga0070705_101374442
443 Ga0070700_100034934
444 Ga0070700_100577390
445 Ga0070700_101000702
446 Ga0070694_100003337
447 Ga0070694_100309220
448 Ga0070694_101605398
449 Ga0070708_101253131
450 Ga0070662_100016255
451 Ga0070681_10410859
452 Ga0068867_100745757
453 Ga0070698_100001973
454 Ga0070698_100026737
455 Ga0070699_101011100
456 Ga0070697_100000292
457 Ga0070697_100008618
458 Ga0070697_100155481
459 Ga0070697_100324188
460 Ga0070697_100708444
461 Ga0068853_100594869
462 Ga0070686_100026527
463 Ga0070695_100120039
464 Ga0070695_100171983
465 Ga0070695_100250750
466 Ga0070695_100290989
467 Ga0070695_100732892
468 Ga0070695_101287970
469 Ga0070696_100036493
470 Ga0070696_100647118
471 Ga0070696_100883857
472 Ga0070696_101386362
473 Ga0070693_100008907
474 Ga0070693_100279643
475 Ga0070693_100867391
476 Ga0070704_100282833
477 Ga0070664_101897458
478 Ga0068857_100240643
479 Ga0068857_100914805
480 Ga0068857_101121768
481 Ga0068854_101802014
482 Ga0070702_100014618
483 Ga0070702_100320062
484 Ga0070702_101243637
485 Ga0070702_101851021
486 Ga0068859_100013288
487 Ga0068859_100043642
488 Ga0068859_100066737
489 Ga0068859_100119638
490 Ga0068859_100782163
491 Ga0068859_100783570
492 Ga0068859_101978403
493 Ga0068859_102632357
494 Ga0068864_100014419
495 Ga0068864_100091073
496 Ga0068864_100152801
497 Ga0068864_100393485
498 Ga0068864_100915525
499 Ga0068866_10299210
500 Ga0068861_100569966
501 Ga0068861_101171425
502 Ga0068851_10014057
503 Ga0068870_10335056
504 Ga0068870_10374757
505 Ga0068870_10401995
506 Ga0068870_10787962
507 Ga0068863_100052618
508 Ga0068863_100067455
509 Ga0068863_100311704
510 Ga0068863_100862814
511 Ga0068858_100036175
512 Ga0068858_100659888
513 Ga0068860_100072911
514 Ga0068860_100137330
515 Ga0068860_100635245
516 Ga0068860_101381410
517 Ga0068860_102310847
518 Ga0068862_100035065
519 Ga0068862_100094831
520 Ga0068862_101079065
521 Ga0068862_102247204
522 Ga0081540_1052565
523 Ga0081539_10000476
524 Ga0081539_10001446
525 Ga0081539_10315011
526 Ga0070712_101347222
527 Ga0075430_100425695
528 Ga0075431_100566155
529 Ga0075431_101117278
530 Ga0075433_10011225
531 Ga0075433_10082518
532 Ga0075433_10327116
533 Ga0075434_100146478
534 Ga0075434_100330928
535 Ga0075434_100354504
536 Ga0075429_100186693
537 Ga0075436_100001628
538 Ga0097620_100013288
539 Ga0097620_100030005
540 Ga0097620_100043642
541 Ga0097620_100066739
542 Ga0097620_100119629
543 Ga0097620_100782143
544 Ga0097620_100783523
545 Ga0097620_101978436
546 Ga0097620_102630611
547 Ga0075435_100154460
548 Ga0075435_100259159
549 Ga0105240_10051760
550 Ga0105240_11063241
551 Ga0111539_10007271
552 Ga0111539_10095994
553 Ga0105245_10561019
554 Ga0105245_10614025
555 Ga0105245_11138712
556 Ga0105245_13067490
557 Ga0105247_10055184
558 Ga0105247_10443687
559 Ga0114129_10006354
560 Ga0114129_10017737
561 Ga0114129_10046357
562 Ga0114129_10057713
563 Ga0114129_10213919
564 Ga0114129_11136351
565 Ga0114129_13170075
566 Ga0105243_10006964
567 Ga0105243_10609703
568 Ga0105243_10778556
569 Ga0105243_11154076
570 Ga0105243_11810397
571 Ga0105243_12809809
572 Ga0105241_10143066
573 Ga0105241_10276419
574 Ga0105241_10353921
575 Ga0105241_10696300
576 Ga0105241_12526430
577 Ga0105241_12605158
578 Ga0105242_11790990
579 Ga0105248_10559300
580 Ga0105248_10642392
581 Ga0105248_10682317
582 Ga0105248_10719797
583 Ga0105248_11059875
584 Ga0105237_10002034
585 Ga0105238_10050745
586 Ga0105249_10157326
587 Ga0105249_10353234
588 Ga0105239_13603041
589 Ga0105246_10016820
590 Ga0105246_10044705
591 Ga0105246_10298602
592 Ga0105246_11054649
593 Ga0157373_10003543
594 Ga0157373_10005784
595 Ga0157373_10254077
596 Ga0157374_10557180
597 Ga0157378_10017328
598 Ga0157378_10165328
599 Ga0157378_13262525
600 Ga0163162_10090961
601 Ga0163162_10886757
602 Ga0157372_10061349
603 Ga0157372_10394073
604 Ga0157372_11246003
605 Ga0157375_10070757
606 Ga0157375_10848378
607 Ga0157375_11116571
608 Ga0157375_12282870
609 Ga0163163_10151007
610 Ga0163163_10227377
611 Ga0163163_10500877
612 Ga0163163_12344128
613 Ga0157380_10180829
614 Ga0157380_10814733
615 Ga0157377_11021072
616 Ga0157377_11281581
617 Ga0157379_10033722
618 Ga0157379_11286609
619 Ga0207656_10008376
620 Ga0207653_10140985
621 Ga0207653_10176219
622 Ga0207682_10178221
623 Ga0207647_10764408
624 Ga0207643_10025658
625 Ga0207643_10041192
626 Ga0207643_10056586
627 Ga0207643_10089452
628 Ga0207684_10000297
629 Ga0207654_11086117
630 Ga0207654_11217768
631 Ga0207707_10103560
632 Ga0207695_10034489
633 Ga0207671_10016043
634 Ga0207693_11068497
635 Ga0207662_10561469
636 Ga0207662_10792501
637 Ga0207652_10227072
638 Ga0207681_10451632
639 Ga0207681_11094177
640 Ga0207694_10005310
641 Ga0207650_10573652
642 Ga0207650_10763234
643 Ga0207650_11647224
644 Ga0207659_10028860
645 Ga0207659_10505655
646 Ga0207687_10418477
647 Ga0207687_10945479
648 Ga0207690_10546742
649 Ga0207706_10011576
650 Ga0207709_10006609
651 Ga0207709_10336077
652 Ga0207709_10492853
653 Ga0207670_10000595
654 Ga0207670_10330089
655 Ga0207670_10361395
656 Ga0207670_11221522
657 Ga0207711_10186910
658 Ga0207711_10509600
659 Ga0207711_10739972
660 Ga0207711_10994619
661 Ga0207711_11115141
662 Ga0207689_10048094
663 Ga0207689_10169797
664 Ga0207689_10292868
665 Ga0207689_10368849
666 Ga0207689_10521623
667 Ga0207689_11622775
668 Ga0207679_10700465
669 Ga0207679_11130557
670 Ga0207667_10156099
671 Ga0207651_10319302
672 Ga0207712_11108726
673 Ga0207640_11306196
674 Ga0207677_10516011
675 Ga0207703_10040600
676 Ga0207703_10711363
677 Ga0207703_11401643
678 Ga0207703_11581632
679 Ga0207708_10084924
680 Ga0207708_10648826
681 Ga0207708_11344769
682 Ga0207641_10103308
683 Ga0207641_10168599
684 Ga0207641_10282184
685 Ga0207641_10334179
686 Ga0207648_10047132
687 Ga0207648_10534837
688 Ga0207676_10154820
689 Ga0207676_10262681
690 Ga0207676_10513981
691 Ga0207674_10054445
692 Ga0207674_10075915
693 Ga0207674_10677696
694 Ga0207674_11226654
695 Ga0207675_101991368
696 Ga0207675_102634260
697 Ga0207698_11372818
698 Ga0268266_11893080
699 Ga0268265_10866180
700 Ga0268265_10915709
701 Ga0268265_11932201
702 Ga0268265_12271240
703 Ga0268264_10539252
704 Ga0268264_10650449
705 Ga0268264_11207399
706 Ga0268264_11372337
707 Ga0268264_12186090
708 Ga0307406_10268540
709 Ga0307406_10385177
710 Ga0307412_11183632
711 Ga0307416_100226834
712 Ga0307414_10425224
713 Ga0307414_11419854
714 Ga0307411_10721716
715 Ga0307415_100019571
716 Ga0307415_101338328
717 Ga0373929_0237569
718 Ga0373951_0002644
719 Ga0439433_0089027
720 Ga0451576_0178685
721 Ga0451576_0700742
722 Ga0451576_2056164
723 Ga0495672_0174187
724 Ga0496100_0648344
725 Ga0496106_0193096
726 Ga0496106_0497096
727 Ga0496107_0326377
728 Ga0496107_0569285
729 Ga0496109_1453357
730 Ga0496112_1555314
731 Ga0496113_0567757
732 Ga0496113_1429219
733 Ga0501291_006079
734 Ga0501292_070389
735 Ga0501292_077850
736 Ga0501295_193282
737 Ga0501298_026767
738 Ga0501298_103141
739 Ga0501202_023012
740 Ga0501206_066758
741 Ga0501208_061190
742 Ga0501211_050458
743 Ga0501216_006520
744 Ga0501217_026624
745 Ga0501223_042322
746 Ga0501227_011871
747 Ga0501227_020969
748 Ga0501233_003812
749 Ga0501235_018203
750 Ga0501235_051744
751 Ga0501239_020589
752 Ga0501240_011380
753 Ga0501243_010492
754 Ga0501243_104392
755 Ga0501249_013235
756 Ga0501251_014829
757 Ga0501256_004987
758 Ga0501260_004545
759 Ga0501261_027661
760 Ga0501225_0027579
761 Ga0501225_0131137
762 Ga0501229_057677
763 Ga0501234_068097
764 Ga0501268_032355
765 Ga0501272_043925
766 Ga0501273_006642
767 Ga0501273_033457
768 Ga0501274_051436
769 nmdc:mga05p37_228918_c1
770 nmdc:mga05p37_41685_c1
771 nmdc:mga05p37_62996_c1
772 nmdc:mga09592_176489_c1
773 nmdc:mga0qj67_357968_c1
774 nmdc:mga0qj67_472124_c1
775 nmdc:mga06r32_1006882_c1
776 nmdc:mga06r32_684611_c1
777 nmdc:mga06r32_766646_c1
778 nmdc:mga0n895_126943_c1
779 nmdc:mga0n895_596281_c1
780 nmdc:mga0n895_79510_c1
781 nmdc:mga0rr50_246175_c1
782 nmdc:mga0rr50_44356_c1
783 nmdc:mga08x19_850_c1
784 nmdc:mga0a205_231581_c1
785 nmdc:mga0a205_400988_c1
786 nmdc:mga0a205_500757_c1
787 nmdc:mga0a205_661360_c1
788 nmdc:mga0a205_78289_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01592

NifU_N

NifU-like N terminal domain

27

141

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eb5-assembly1.cif.gz_C a. fulgidus iscs-iscu complex structure 0.9732 3 116
4eb5-assembly1.cif.gz_D a. fulgidus iscs-iscu complex structure 0.9667 3 116
4eb7-assembly1.cif.gz_C a. fulgidus iscs-iscu complex structure 0.964 3 116
2z7e-assembly1.cif.gz_B crystal structure of aquifex aeolicus iscu with bound [2fe-2s] cluster 0.9458 1 115
5wlw-assembly1.cif.gz_H crystal structure of the human mitochondrial cysteine desulfurase with active cysteine loop within iscu1 active site, coordinating zn ion. complexed with human isd11 and e. coli acp1 at 3.3a. 0.9419 4 121
ID Description Score Start End Superfamily
4eb5D00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9667 3 116 3.90.1010.10
4eb7C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.964 3 116 3.90.1010.10
5wlwD01 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9597 25 121 3.90.1010.10
af_Q9MAB6_26_163_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9265 2 121 3.90.1010.10
5wlwD01 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9138 25 121 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A3B9LYF4-F1-model_v4 NIF system FeS cluster assembly NifU N-terminal domain-containing protein 0.9987 13 117 GO:0005506
GO:0016226
GO:0051536
AF-A0A352F1I1-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 0.9974 1 116 GO:0005506
GO:0016226
GO:0051536
AF-A0A2V8LKW4-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 0.9964 3 121 GO:0005506
GO:0016226
GO:0051536
AF-A0A317I2D2-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 0.9959 1 121 GO:0005506
GO:0016226
GO:0051536
AF-A0A3B9MJ36-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 0.994 1 117 GO:0005506
GO:0016226
GO:0051536

Map